F465153

General Info

Members Datasets Scaffolds Average Seq Length
573 300 573 77

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_101457762|Ga0070670_1014577622
Length 81
Sequence MAADLQELERMIAEALPGADVSVVDEGGGDHLRAIVTAPQFEGLTRIDQHRLVRTAVKPRMDDGTIHALSISTTAPGTQSH

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
177 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.9
Nodule 0
Rhizoplane 6.28
Rhizosphere 81.33
Stem 0
Stem Tuber 0
Unclassified 3.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10262304 3300001990 Bacteria 511
2 JGI24750J21931_1009086 3300002070 Bacteria 1274
3 JGI24748J21848_1000232 3300002074 Bacteria 6730
4 JGI24738J21930_10050273 3300002075 Bacteria 850
5 JGI24744J21845_10034710 3300002077 Bacteria 956
6 JGI24034J26672_10000252 3300002239 Bacteria 7059
7 JGI24742J22300_10004606 3300002244 Bacteria 2262
8 JGI24751J29686_10066292 3300002459 Bacteria 743
9 Ga0070658_10266364 3300005327 Bacteria 1456
10 Ga0070676_10431105 3300005328 Bacteria 923
11 Ga0070683_100085971 3300005329 Bacteria 2949
12 Ga0070683_100098697 3300005329 Bacteria 2749
13 Ga0070683_100154280 3300005329 Bacteria 2178
14 Ga0070683_100202022 3300005329 Bacteria 1887
15 Ga0070683_100301786 3300005329 Bacteria 1523
16 Ga0070683_100510277 3300005329 Bacteria 1149
17 Ga0070670_100560195 3300005331 Bacteria 1020
18 Ga0070670_101457762 3300005331 Bacteria 628
19 Ga0068869_100114315 3300005334 Bacteria 2057
20 Ga0070666_10205807 3300005335 Bacteria 1385
21 Ga0070666_10537017 3300005335 Bacteria 850
22 Ga0070680_100386624 3300005336 Bacteria 1192
23 Ga0070680_100435485 3300005336 Bacteria 1119
24 Ga0070682_100875491 3300005337 Bacteria 736
25 Ga0068868_100015021 3300005338 Bacteria 5720
26 Ga0068868_100939604 3300005338 Unclassified 788
27 Ga0070660_100001352 3300005339 Bacteria 16674
28 Ga0070661_100000032 3300005344 Bacteria 112964
29 Ga0070661_100117591 3300005344 Bacteria 1989
30 Ga0070668_100179768 3300005347 Bacteria 1727
31 Ga0070669_100098357 3300005353 Bacteria 2204
32 Ga0070675_100026360 3300005354 Bacteria 4664
33 Ga0070671_100156215 3300005355 Bacteria 1927
34 Ga0070674_100010932 3300005356 Bacteria 5506
35 Ga0070674_102088450 3300005356 Unclassified 517
36 Ga0070673_100235373 3300005364 Bacteria 1590
37 Ga0070688_100020472 3300005365 Bacteria 3848
38 Ga0070659_100000396 3300005366 Bacteria 33083
39 Ga0070659_101615099 3300005366 Bacteria 579
40 Ga0070667_100022286 3300005367 Bacteria 5255
41 Ga0070667_100088069 3300005367 Bacteria 2665
42 Ga0070667_100437104 3300005367 Bacteria 1194
43 Ga0070667_100902388 3300005367 Bacteria 823
44 Ga0070713_100288337 3300005436 Bacteria 1508
45 Ga0070700_100007039 3300005441 Bacteria 6044
46 Ga0070700_100086449 3300005441 Bacteria 2036
47 Ga0070663_100006561 3300005455 Bacteria 7012
48 Ga0070663_100008130 3300005455 Bacteria 6436
49 Ga0070663_100872213 3300005455 Unclassified 776
50 Ga0070663_101999856 3300005455 Unclassified 521
51 Ga0070678_100173196 3300005456 Bacteria 1760
52 Ga0070678_101291094 3300005456 Bacteria 679
53 Ga0070662_100202437 3300005457 Bacteria 1576
54 Ga0070681_10081424 3300005458 Bacteria 3193
55 Ga0070681_10649026 3300005458 Bacteria 970
56 Ga0068867_100255425 3300005459 Bacteria 1427
57 Ga0070685_10060155 3300005466 Bacteria 2220
58 Ga0070679_100124752 3300005530 Bacteria 2558
59 Ga0070684_100011898 3300005535 Bacteria 6949
60 Ga0070684_100019500 3300005535 Bacteria 5611
61 Ga0070684_100076934 3300005535 Bacteria 2946
62 Ga0070684_100580022 3300005535 Bacteria 1042
63 Ga0070684_100641265 3300005535 Bacteria 988
64 Ga0070684_101802252 3300005535 Bacteria 577
65 Ga0068853_100019034 3300005539 Bacteria 5689
66 Ga0068853_100565379 3300005539 Bacteria 1078
67 Ga0070672_100000013 3300005543 Bacteria 75650
68 Ga0070672_100005703 3300005543 Bacteria 8294
69 Ga0070686_100014046 3300005544 Bacteria 4605
70 Ga0070686_101267196 3300005544 Bacteria 614
71 Ga0070695_100340472 3300005545 Bacteria 1121
72 Ga0070695_100401467 3300005545 Bacteria 1039
73 Ga0070695_100496787 3300005545 Bacteria 943
74 Ga0070693_100002496 3300005547 Bacteria 8477
75 Ga0070693_100599430 3300005547 Bacteria 795
76 Ga0070665_100236950 3300005548 Bacteria 1825
77 Ga0070665_101621306 3300005548 Bacteria 655
78 Ga0070704_100892637 3300005549 Bacteria 799
79 Ga0068855_100443679 3300005563 Bacteria 1417
80 Ga0068855_100727711 3300005563 Bacteria 1060
81 Ga0068855_100992125 3300005563 Bacteria 883
82 Ga0070664_101262018 3300005564 Bacteria 697
83 Ga0068857_100326353 3300005577 Bacteria 1418
84 Ga0068854_100007996 3300005578 Bacteria 6775
85 Ga0068856_102682356 3300005614 Bacteria 504
86 Ga0070702_100067036 3300005615 Bacteria 2107
87 Ga0068852_100054777 3300005616 Bacteria 3439
88 Ga0068859_100745703 3300005617 Bacteria 1068
89 Ga0068859_102618168 3300005617 Unclassified 555
90 Ga0068864_100000023 3300005618 Bacteria 257064
91 Ga0068864_100081628 3300005618 Bacteria 2835
92 Ga0068866_10000007 3300005718 Bacteria 121729
93 Ga0068861_100172879 3300005719 Bacteria 1792
94 Ga0068851_10117298 3300005834 Bacteria 1427
95 Ga0068870_10845894 3300005840 Bacteria 642
96 Ga0068863_100034844 3300005841 Bacteria 4794
97 Ga0068863_100837911 3300005841 Bacteria 918
98 Ga0068863_102758755 3300005841 Unclassified 500
99 Ga0068858_100130044 3300005842 Bacteria 2360
100 Ga0068858_102096783 3300005842 Bacteria 559
101 Ga0068860_100152203 3300005843 Bacteria 2228
102 Ga0068862_100192668 3300005844 Bacteria 1835
103 Ga0081455_10017920 3300005937 Bacteria 6768
104 Ga0081455_10248269 3300005937 Bacteria 1303
105 Ga0081538_10000034 3300005981 Bacteria 120557
106 Ga0081539_10001387 3300005985 Bacteria 41711
107 Ga0075365_10008057 3300006038 Bacteria 5950
108 Ga0075365_10020868 3300006038 Bacteria 4072
109 Ga0075365_10070875 3300006038 Bacteria 2345
110 Ga0075365_10679444 3300006038 Bacteria 727
111 Ga0075365_10703749 3300006038 Bacteria 714
112 Ga0075365_11068894 3300006038 Bacteria 568
113 Ga0075365_11166064 3300006038 Bacteria 542
114 Ga0075368_10246554 3300006042 Bacteria 763
115 Ga0075368_10548280 3300006042 Bacteria 520
116 Ga0075363_100016297 3300006048 Bacteria 3670
117 Ga0075363_100048892 3300006048 Bacteria 2250
118 Ga0075363_100123290 3300006048 Bacteria 1449
119 Ga0075363_100167874 3300006048 Bacteria 1245
120 Ga0075363_100332800 3300006048 Bacteria 885
121 Ga0075363_100607847 3300006048 Bacteria 655
122 Ga0075364_10032183 3300006051 Bacteria 3370
123 Ga0075364_10125727 3300006051 Bacteria 1719
124 Ga0075364_10146173 3300006051 Bacteria 1592
125 Ga0075364_10188541 3300006051 Bacteria 1396
126 Ga0075364_10202551 3300006051 Bacteria 1345
127 Ga0075364_10304702 3300006051 Bacteria 1085
128 Ga0075364_10517500 3300006051 Bacteria 816
129 Ga0075364_10820870 3300006051 Unclassified 634
130 Ga0070716_100115317 3300006173 Bacteria 1672
131 Ga0075367_10064238 3300006178 Bacteria 2195
132 Ga0075367_10083623 3300006178 Bacteria 1934
133 Ga0075367_10181824 3300006178 Bacteria 1311
134 Ga0075367_10664337 3300006178 Bacteria 663
135 Ga0068871_100061386 3300006358 Bacteria 3070
136 Ga0075430_100479094 3300006846 Bacteria 1027
137 Ga0075433_10010741 3300006852 Bacteria 7364
138 Ga0068865_100009350 3300006881 Bacteria 6073
139 Ga0097620_100745738 3300006931 Bacteria 1068
140 Ga0097620_102617496 3300006931 Unclassified 555
141 Ga0097620_102823785 3300006931 Bacteria 533
142 Ga0105244_10377939 3300009036 Bacteria 652
143 Ga0105240_10386973 3300009093 Bacteria 1578
144 Ga0105240_10666360 3300009093 Bacteria 1139
145 Ga0105240_11383029 3300009093 Bacteria 740
146 Ga0111539_10164631 3300009094 Bacteria 2593
147 Ga0111539_11549256 3300009094 Unclassified 769
148 Ga0105245_10014070 3300009098 Bacteria 6969
149 Ga0105245_12043786 3300009098 Archaea 626
150 Ga0105247_10045271 3300009101 Bacteria 2699
151 Ga0105247_10561850 3300009101 Bacteria 840
152 Ga0105243_10005110 3300009148 Bacteria 10296
153 Ga0105243_10702326 3300009148 Bacteria 986
154 Ga0105241_11649618 3300009174 Bacteria 621
155 Ga0105242_10221747 3300009176 Bacteria 1690
156 Ga0105248_10668591 3300009177 Bacteria 1172
157 Ga0105248_12817424 3300009177 Unclassified 554
158 Ga0105238_10000016 3300009551 Bacteria 236218
159 Ga0105238_10333058 3300009551 Bacteria 1505
160 Ga0105249_10000054 3300009553 Bacteria 162883
161 Ga0105249_11260094 3300009553 Bacteria 811
162 Ga0105249_13080808 3300009553 Bacteria 535
163 Ga0099796_10266503 3300010159 Bacteria 716
164 Ga0105239_10107435 3300010375 Bacteria 3092
165 Ga0105239_10160569 3300010375 Bacteria 2511
166 Ga0105246_10106248 3300011119 Bacteria 2053
167 Ga0105246_10417416 3300011119 Bacteria 1119
168 Ga0105246_11235258 3300011119 Bacteria 689
169 Ga0157369_11307047 3300013105 Bacteria 739
170 Ga0163162_11982905 3300013306 Bacteria 667
171 Ga0157372_10414816 3300013307 Bacteria 1569
172 Ga0157372_11635223 3300013307 Bacteria 741
173 Ga0157375_10011718 3300013308 Bacteria 7750
174 Ga0157375_12934149 3300013308 Bacteria 570
175 Ga0163163_11572038 3300014325 Bacteria 719
176 Ga0163163_11724678 3300014325 Bacteria 687
177 Ga0163163_11879931 3300014325 Unclassified 659
178 Ga0157380_10377504 3300014326 Bacteria 1337
179 Ga0157380_11862098 3300014326 Bacteria 662
180 Ga0157377_10010951 3300014745 Bacteria 4509
181 Ga0157379_10017532 3300014968 Bacteria 6302
182 Ga0157379_10019064 3300014968 Bacteria 6057
183 Ga0157379_10713074 3300014968 Bacteria 942
184 Ga0157379_11542306 3300014968 Unclassified 647
185 Ga0163161_11556738 3300017792 Bacteria 582
186 Ga0207642_10633627 3300025899 Bacteria 668
187 Ga0207710_10026077 3300025900 Bacteria 2523
188 Ga0207710_10184427 3300025900 Bacteria 1025
189 Ga0207710_10540298 3300025900 Bacteria 607
190 Ga0207688_10012452 3300025901 Bacteria 4628
191 Ga0207680_10003987 3300025903 Bacteria 6975
192 Ga0207680_10213958 3300025903 Bacteria 1319
193 Ga0207680_10432596 3300025903 Bacteria 933
194 Ga0207647_10103670 3300025904 Bacteria 1686
195 Ga0207645_10168950 3300025907 Bacteria 1433
196 Ga0207705_10019045 3300025909 Bacteria 4910
197 Ga0207705_10035941 3300025909 Bacteria 3546
198 Ga0207707_10114253 3300025912 Bacteria 2360
199 Ga0207660_10213327 3300025917 Bacteria 1512
200 Ga0207660_10387301 3300025917 Bacteria 1124
201 Ga0207657_10001969 3300025919 Bacteria 22177
202 Ga0207649_10000015 3300025920 Bacteria 245662
203 Ga0207649_10061038 3300025920 Bacteria 2371
204 Ga0207649_10134146 3300025920 Bacteria 1686
205 Ga0207649_11683505 3300025920 Bacteria 502
206 Ga0207652_10001670 3300025921 Bacteria 19427
207 Ga0207652_10170366 3300025921 Bacteria 1954
208 Ga0207681_10170726 3300025923 Bacteria 1648
209 Ga0207694_10000012 3300025924 Bacteria 411218
210 Ga0207694_10111639 3300025924 Bacteria 2175
211 Ga0207650_11258382 3300025925 Bacteria 630
212 Ga0207659_10017333 3300025926 Bacteria 4704
213 Ga0207687_10053880 3300025927 Bacteria 2812
214 Ga0207664_10956782 3300025929 Bacteria 768
215 Ga0207644_10101551 3300025931 Bacteria 2162
216 Ga0207690_10006166 3300025932 Bacteria 7100
217 Ga0207690_11233393 3300025932 Bacteria 625
218 Ga0207706_10000003 3300025933 Bacteria 345011
219 Ga0207706_10026716 3300025933 Bacteria 5168
220 Ga0207686_10054601 3300025934 Bacteria 2503
221 Ga0207709_10006931 3300025935 Bacteria 6337
222 Ga0207670_11405885 3300025936 Bacteria 592
223 Ga0207669_10000010 3300025937 Bacteria 150070
224 Ga0207669_10000475 3300025937 Bacteria 17506
225 Ga0207669_10008523 3300025937 Bacteria 4820
226 Ga0207704_10004361 3300025938 Bacteria 6470
227 Ga0207665_10040308 3300025939 Bacteria 3115
228 Ga0207691_10000095 3300025940 Bacteria 76860
229 Ga0207691_10022999 3300025940 Bacteria 5871
230 Ga0207711_10680059 3300025941 Bacteria 960
231 Ga0207711_11699054 3300025941 Unclassified 575
232 Ga0207689_10198651 3300025942 Bacteria 1655
233 Ga0207661_10000666 3300025944 Bacteria 22202
234 Ga0207661_10001606 3300025944 Bacteria 15376
235 Ga0207661_10035852 3300025944 Bacteria 3868
236 Ga0207661_10072408 3300025944 Bacteria 2819
237 Ga0207661_10172133 3300025944 Bacteria 1885
238 Ga0207661_10358845 3300025944 Bacteria 1316
239 Ga0207679_10009210 3300025945 Bacteria 6313
240 Ga0207679_10136725 3300025945 Bacteria 1974
241 Ga0207679_11423370 3300025945 Bacteria 636
242 Ga0207679_11900160 3300025945 Bacteria 543
243 Ga0207667_10124115 3300025949 Bacteria 2660
244 Ga0207651_10200198 3300025960 Bacteria 1600
245 Ga0207712_11460808 3300025961 Unclassified 612
246 Ga0207668_10074640 3300025972 Bacteria 2435
247 Ga0207668_10108349 3300025972 Bacteria 2079
248 Ga0207640_10315672 3300025981 Bacteria 1242
249 Ga0207658_10011566 3300025986 Bacteria 6008
250 Ga0207658_10048783 3300025986 Bacteria 3107
251 Ga0207658_10502722 3300025986 Unclassified 1080
252 Ga0207677_10079064 3300026023 Bacteria 2351
253 Ga0207703_10293406 3300026035 Bacteria 1481
254 Ga0207703_10524372 3300026035 Bacteria 1115
255 Ga0207703_11317798 3300026035 Bacteria 694
256 Ga0207639_10039552 3300026041 Bacteria 3515
257 Ga0207639_10387112 3300026041 Bacteria 1257
258 Ga0207678_10001730 3300026067 Bacteria 19988
259 Ga0207678_10012092 3300026067 Bacteria 7578
260 Ga0207708_10003752 3300026075 Bacteria 11196
261 Ga0207708_10126034 3300026075 Bacteria 1999
262 Ga0207708_11147744 3300026075 Bacteria 678
263 Ga0207641_10000436 3300026088 Bacteria 47925
264 Ga0207641_10085782 3300026088 Bacteria 2744
265 Ga0207641_11055967 3300026088 Bacteria 810
266 Ga0207648_10292820 3300026089 Bacteria 1458
267 Ga0207676_10000025 3300026095 Bacteria 261714
268 Ga0207676_12039162 3300026095 Bacteria 572
269 Ga0207674_10136991 3300026116 Bacteria 2409
270 Ga0207675_100485618 3300026118 Bacteria 1228
271 Ga0207683_10656039 3300026121 Bacteria 972
272 Ga0207683_10914525 3300026121 Bacteria 815
273 Ga0207683_10982314 3300026121 Bacteria 784
274 Ga0207698_10009935 3300026142 Bacteria 6087
275 Ga0207698_10017583 3300026142 Bacteria 4857
276 Ga0207428_10219707 3300027907 Bacteria 1425
277 Ga0268266_10000422 3300028379 Bacteria 64158
278 Ga0268266_10018593 3300028379 Bacteria 5922
279 Ga0268266_10333384 3300028379 Bacteria 1422
280 Ga0268266_10353696 3300028379 Bacteria 1381
281 Ga0268266_11439928 3300028379 Bacteria 664
282 Ga0268265_10283975 3300028380 Bacteria 1482
283 Ga0268264_10227112 3300028381 Bacteria 1722
284 Ga0268264_10361956 3300028381 Bacteria 1384
285 Ga0265336_10117333 3300028666 Bacteria 793
286 Ga0307408_101295541 3300031548 Bacteria 683
287 Ga0316576_10003110 3300031727 Bacteria 9678
288 Ga0316576_10819755 3300031727 Unclassified 669
289 Ga0316578_10064066 3300031728 Bacteria 2169
290 Ga0316578_10837317 3300031728 Unclassified 532
291 Ga0307405_10760032 3300031731 Bacteria 808
292 Ga0307413_10667263 3300031824 Bacteria 860
293 Ga0307410_10092283 3300031852 Bacteria 2152
294 Ga0307406_10144983 3300031901 Bacteria 1686
295 Ga0307406_10991375 3300031901 Bacteria 720
296 Ga0307406_11247738 3300031901 Bacteria 647
297 Ga0307412_12078929 3300031911 Bacteria 527
298 Ga0307409_100260999 3300031995 Bacteria 1590
299 Ga0307416_100058138 3300032002 Bacteria 3133
300 Ga0307416_100304174 3300032002 Bacteria 1587
301 Ga0307416_100612735 3300032002 Bacteria 1170
302 Ga0307411_10476037 3300032005 Bacteria 1050
303 Ga0307415_100073325 3300032126 Bacteria 2415
304 Ga0307415_102075585 3300032126 Bacteria 555
305 Ga0316585_10222397 3300032137 Bacteria 625
306 Ga0316574_0183892 3300035398 Bacteria 1344
307 Ga0316574_0904020 3300035398 Bacteria 534
308 Ga0316582_0816423 3300036647 Bacteria 639
309 Ga0316584_0088082 3300036712 Bacteria 2324
310 Ga0316584_0091236 3300036712 Bacteria 2281
311 Ga0316584_0417167 3300036712 Bacteria 954
312 Ga0395899_0461832 3300037312 Bacteria 830
313 Ga0395898_0376567 3300037466 Bacteria 1354
314 Ga0395905_0293159 3300037471 Bacteria 1514
315 Ga0436364_1069239 3300037853 Bacteria 598
316 Ga0395901_0567820 3300038443 Bacteria 1148
317 Ga0395901_0787426 3300038443 Bacteria 941
318 Ga0451791_0016531 3300041451 Bacteria 806
319 Ga0451802_1111570 3300041460 Bacteria 720
320 Ga0451807_1603377 3300041486 Bacteria 2158
321 Ga0451837_0767587 3300041494 Bacteria 1463
322 Ga0451853_2552138 3300041512 Unclassified 564
323 Ga0451853_3962859 3300041512 Bacteria 2045
324 Ga0450911_034913 3300042115 Bacteria 652
325 Ga0466963_0000033 3300044694 Bacteria 45230
326 Ga0466967_2383287 3300045976 Unclassified 525
327 Ga0495592_0720553 3300046454 Unclassified 598
328 Ga0495592_0830225 3300046454 Unclassified 547
329 Ga0495603_0003650 3300046455 Bacteria 9158
330 Ga0495629_0000489 3300046459 Bacteria 33145
331 Ga0495629_0188950 3300046459 Bacteria 1426
332 Ga0495629_0316513 3300046459 Bacteria 1067
333 Ga0495641_0010101 3300046461 Bacteria 5527
334 Ga0495653_0056155 3300046463 Bacteria 3002
335 Ga0495653_0759289 3300046463 Unclassified 585
336 Ga0495662_0279284 3300046476 Bacteria 822
337 Ga0495596_0412129 3300046500 Bacteria 527
338 Ga0495606_0000550 3300046507 Bacteria 60050
339 Ga0495616_0430910 3300046513 Bacteria 537
340 Ga0495618_0000053 3300046514 Bacteria 84115
341 Ga0495620_0000782 3300046515 Bacteria 19484
342 Ga0495628_0000628 3300046516 Bacteria 32247
343 Ga0495628_0124881 3300046516 Bacteria 1972
344 Ga0495628_0147720 3300046516 Bacteria 1791
345 Ga0495630_0000599 3300046517 Bacteria 26251
346 Ga0495630_0062591 3300046517 Bacteria 2795
347 Ga0495630_0580467 3300046517 Bacteria 859
348 Ga0495630_0600846 3300046517 Bacteria 843
349 Ga0495632_0039815 3300046519 Bacteria 2370
350 Ga0495644_0004542 3300046523 Bacteria 5455
351 Ga0495652_0000009 3300046529 Bacteria 311000
352 Ga0495652_0450761 3300046529 Bacteria 901
353 Ga0495640_0844599 3300046533 Bacteria 544
354 Ga0495586_0000500 3300046535 Bacteria 23110
355 Ga0495587_0403700 3300046536 Bacteria 759
356 Ga0495598_0000588 3300046537 Bacteria 6867
357 Ga0495621_0006343 3300046539 Bacteria 3446
358 Ga0495667_0000109 3300046559 Bacteria 59985
359 Ga0495667_0273805 3300046559 Bacteria 1072
360 Ga0495634_0005960 3300046642 Bacteria 9311
361 Ga0495634_0360501 3300046642 Bacteria 869
362 Ga0495634_0875243 3300046642 Unclassified 509
363 Ga0495625_0000029 3300046660 Bacteria 244646
364 Ga0495635_0577720 3300046663 Bacteria 735
365 Ga0495635_0683226 3300046663 Unclassified 666
366 Ga0495657_0097308 3300046675 Bacteria 1879
367 Ga0495599_0431712 3300046678 Bacteria 782
368 Ga0495646_0536753 3300046680 Bacteria 598
369 Ga0495647_0000002 3300046681 Bacteria 174959
370 Ga0495669_0015192 3300046684 Bacteria 3295
371 Ga0495613_0000042 3300046689 Bacteria 130403
372 Ga0495613_0778832 3300046689 Bacteria 625
373 Ga0495670_0039028 3300046691 Bacteria 2368
374 Ga0495589_0356352 3300046794 Bacteria 674
375 Ga0495600_0000922 3300046809 Bacteria 15759
376 Ga0495600_0511662 3300046809 Bacteria 737
377 Ga0495600_0727324 3300046809 Unclassified 595
378 Ga0495604_0000255 3300047317 Bacteria 47375
379 Ga0495674_0172893 3300047319 Bacteria 1802
380 Ga0495674_1181260 3300047319 Bacteria 579
381 Ga0495672_0463218 3300047320 Bacteria 569
382 Ga0495676_0302103 3300047321 Bacteria 1079
383 Ga0495676_0599892 3300047321 Bacteria 717
384 Ga0495676_0803760 3300047321 Bacteria 605
385 Ga0495680_0001999 3300047322 Bacteria 21403
386 Ga0495680_0285043 3300047322 Bacteria 1163
387 Ga0495680_0501511 3300047322 Bacteria 824
388 Ga0495679_011199 3300047446 Bacteria 3477
389 Ga0495684_0133639 3300047471 Bacteria 1862
390 Ga0495686_0198171 3300047472 Bacteria 1154
391 Ga0495602_0003237 3300048088 Bacteria 16812
392 Ga0496100_0189085 3300048903 Bacteria 1494
393 Ga0496100_1501358 3300048903 Archaea 532
394 Ga0496101_0108961 3300048904 Bacteria 2083
395 Ga0496101_0113061 3300048904 Bacteria 2046
396 Ga0496102_0038034 3300048905 Bacteria 4341
397 Ga0496102_1722469 3300048905 Bacteria 544
398 Ga0496103_0231951 3300048906 Bacteria 1187
399 Ga0496104_0014119 3300048907 Bacteria 7210
400 Ga0496105_0005224 3300048908 Bacteria 9841
401 Ga0496106_0032804 3300048909 Bacteria 3872
402 Ga0496107_0026865 3300048910 Bacteria 4085
403 Ga0496107_0050049 3300048910 Bacteria 3012
404 Ga0496107_0471312 3300048910 Bacteria 932
405 Ga0496108_0000004 3300048911 Bacteria 545055
406 Ga0496108_0030176 3300048911 Bacteria 4493
407 Ga0496108_0059767 3300048911 Bacteria 3205
408 Ga0496109_0000011 3300048912 Bacteria 234908
409 Ga0496109_0000031 3300048912 Bacteria 163998
410 Ga0496109_0000870 3300048912 Bacteria 25155
411 Ga0496109_0784271 3300048912 Unclassified 891
412 Ga0496109_1225261 3300048912 Unclassified 687
413 Ga0496110_0063783 3300048913 Bacteria 3256
414 Ga0496110_0805481 3300048913 Unclassified 844
415 Ga0496110_0927459 3300048913 Bacteria 777
416 Ga0496110_1345665 3300048913 Bacteria 623
417 Ga0496111_0009546 3300048914 Bacteria 6484
418 Ga0496111_0084449 3300048914 Bacteria 2321
419 Ga0496111_0195835 3300048914 Bacteria 1502
420 Ga0496111_0261394 3300048914 Bacteria 1284
421 Ga0496113_0024494 3300048916 Bacteria 4290
422 Ga0496114_0139373 3300048917 Bacteria 2099
423 Ga0496114_0539560 3300048917 Bacteria 1031
424 Ga0496115_0588877 3300048918 Bacteria 885
425 Ga0496117_0002711 3300048920 Bacteria 21828
426 Ga0496118_0001277 3300048921 Bacteria 38534
427 Ga0496118_0348427 3300048921 Bacteria 790
428 Ga0496118_0380061 3300048921 Bacteria 741
429 Ga0496120_0015354 3300048923 Bacteria 5057
430 Ga0496120_0192192 3300048923 Unclassified 994
431 Ga0496121_0015047 3300048924 Bacteria 8142
432 Ga0496121_0196325 3300048924 Bacteria 1442
433 Ga0496124_0039181 3300048927 Bacteria 4110
434 Ga0496124_0213778 3300048927 Bacteria 1457
435 Ga0496125_0410968 3300048928 Bacteria 788
436 Ga0496125_0569553 3300048928 Bacteria 624
437 Ga0496126_0067719 3300048929 Bacteria 3189
438 Ga0496126_0127017 3300048929 Bacteria 2206
439 Ga0496126_0434541 3300048929 Bacteria 1059
440 Ga0496126_1023474 3300048929 Bacteria 618
441 Ga0501031_0006300 3300049568 Bacteria 7734
442 Ga0501032_0008990 3300049569 Bacteria 7266
443 Ga0501033_0008846 3300049570 Bacteria 7778
444 Ga0501034_0013871 3300049571 Bacteria 8295
445 Ga0501034_0059301 3300049571 Bacteria 3844
446 Ga0501034_0694231 3300049571 Bacteria 917
447 Ga0501036_0067783 3300049572 Bacteria 3019
448 Ga0501037_0000525 3300049573 Bacteria 30723
449 Ga0501038_0012367 3300049574 Bacteria 7800
450 Ga0501039_0092346 3300049575 Bacteria 2359
451 Ga0501039_1026433 3300049575 Bacteria 640
452 Ga0501039_1235581 3300049575 Unclassified 577
453 Ga0501040_0084637 3300049576 Bacteria 2200
454 Ga0501040_0727388 3300049576 Unclassified 718
455 Ga0501041_0400861 3300049577 Bacteria 869
456 Ga0501042_0012990 3300049578 Bacteria 5658
457 Ga0501042_0044138 3300049578 Bacteria 3176
458 Ga0501042_0066461 3300049578 Bacteria 2577
459 Ga0501042_0591487 3300049578 Bacteria 807
460 Ga0501043_0009296 3300049579 Bacteria 7723
461 Ga0501043_0304435 3300049579 Bacteria 1217
462 Ga0501043_0494608 3300049579 Unclassified 914
463 Ga0501046_0010383 3300049580 Bacteria 8001
464 Ga0501047_0001574 3300049581 Bacteria 22284
465 Ga0501047_0049098 3300049581 Bacteria 4074
466 Ga0501047_1295068 3300049581 Bacteria 543
467 Ga0501048_0008006 3300049582 Bacteria 8000
468 Ga0501048_0130907 3300049582 Bacteria 1774
469 Ga0501048_0161107 3300049582 Bacteria 1588
470 Ga0501048_1359790 3300049582 Bacteria 510
471 Ga0501067_0036828 3300049583 Bacteria 2716
472 Ga0501067_0187431 3300049583 Bacteria 1152
473 Ga0501067_0514880 3300049583 Unclassified 669
474 Ga0501068_0147497 3300049584 Bacteria 1477
475 Ga0501068_0172704 3300049584 Bacteria 1365
476 Ga0501068_0264819 3300049584 Bacteria 1097
477 Ga0501068_0304563 3300049584 Bacteria 1020
478 Ga0501068_0997002 3300049584 Bacteria 553
479 Ga0501069_0029178 3300049585 Bacteria 3027
480 Ga0501069_0047338 3300049585 Bacteria 2387
481 Ga0501069_0092800 3300049585 Bacteria 1708
482 Ga0501069_0264043 3300049585 Bacteria 1005
483 Ga0501070_0004676 3300049586 Bacteria 11728
484 Ga0501070_0010080 3300049586 Bacteria 7995
485 Ga0501070_0018917 3300049586 Bacteria 5778
486 Ga0501070_0060100 3300049586 Bacteria 3150
487 Ga0501070_0092725 3300049586 Bacteria 2499
488 Ga0501070_0189759 3300049586 Bacteria 1689
489 Ga0501070_0841871 3300049586 Bacteria 718
490 Ga0501070_0984618 3300049586 Bacteria 654
491 Ga0501071_0197812 3300049587 Bacteria 1509
492 Ga0501071_0430007 3300049587 Bacteria 1009
493 Ga0501071_0929582 3300049587 Bacteria 671
494 Ga0501071_1267689 3300049587 Bacteria 569
495 Ga0501072_0018431 3300049588 Bacteria 5375
496 Ga0501072_0230061 3300049588 Bacteria 1477
497 Ga0501072_0247691 3300049588 Bacteria 1419
498 Ga0501072_0439462 3300049588 Bacteria 1033
499 Ga0501073_0034514 3300049589 Bacteria 3600
500 Ga0501073_0134353 3300049589 Bacteria 1714
501 Ga0501074_0013122 3300049590 Bacteria 6023
502 Ga0501074_0015911 3300049590 Bacteria 5471
503 Ga0501074_0153190 3300049590 Bacteria 1647
504 Ga0501074_0229951 3300049590 Bacteria 1320
505 Ga0501074_0914190 3300049590 Unclassified 618
506 Ga0501075_0017368 3300049591 Bacteria 5198
507 Ga0501075_0180639 3300049591 Bacteria 1610
508 Ga0501076_0117122 3300049592 Bacteria 2156
509 Ga0501076_0288313 3300049592 Bacteria 1345
510 Ga0501076_1025091 3300049592 Bacteria 680
511 Ga0501077_0748187 3300049593 Bacteria 628
512 Ga0501079_0302078 3300049741 Bacteria 1252
513 Ga0501079_0455468 3300049741 Bacteria 1005
514 Ga0501079_0790074 3300049741 Bacteria 747
515 Ga0501079_1122569 3300049741 Bacteria 619
516 Ga0501080_0111542 3300049742 Bacteria 2535
517 Ga0501080_0135321 3300049742 Bacteria 2280
518 Ga0501080_0379129 3300049742 Bacteria 1274
519 Ga0501080_0381272 3300049742 Bacteria 1270
520 Ga0501081_0139057 3300049743 Bacteria 1740
521 Ga0501083_0007552 3300049744 Bacteria 7704
522 Ga0501083_0018273 3300049744 Bacteria 4887
523 Ga0501083_0799840 3300049744 Bacteria 613
524 Ga0501035_0001973 3300049822 Bacteria 20540
525 Ga0501035_0841852 3300049822 Bacteria 730
526 Ga0501044_0016353 3300049823 Bacteria 7965
527 Ga0501044_0049370 3300049823 Bacteria 4344
528 Ga0501045_0092091 3300049824 Bacteria 2242
529 Ga0501045_0224786 3300049824 Bacteria 1397
530 nmdc:mga03n38_10548_c1 3300050490 Bacteria 3405
531 nmdc:mga03n38_47681_c2 3300050490 Bacteria 1432
532 nmdc:mga03n38_61430_c1 3300050490 Bacteria 1711
533 nmdc:mga00v17_25448_c1 3300050491 Bacteria 3440
534 nmdc:mga00v17_280485_c1 3300050491 Bacteria 1082
535 nmdc:mga00v17_389347_c1 3300050491 Bacteria 906
536 nmdc:mga00v17_444249_c1 3300050491 Unclassified 842
537 nmdc:mga00v17_592550_c1 3300050491 Bacteria 715
538 nmdc:mga00v17_624303_c1 3300050491 Unclassified 694
539 nmdc:mga00v17_845273_c1 3300050491 Bacteria 581
540 nmdc:mga00v17_996704_c1 3300050491 Bacteria 527
541 nmdc:mga0yw44_269775_c1 3300050492 Bacteria 1136
542 nmdc:mga0yw44_45033_c1 3300050492 Bacteria 2643
543 nmdc:mga0yw44_6820_c1 3300050492 Bacteria 5552
544 nmdc:mga0yw44_836809_c1 3300050492 Unclassified 625
545 nmdc:mga0yw44_859794_c1 3300050492 Unclassified 615
546 nmdc:mga0yw44_975110_c1 3300050492 Bacteria 574
547 nmdc:mga06z11_207518_c1 3300050494 Bacteria 1140
548 nmdc:mga06z11_415277_c1 3300050494 Bacteria 811
549 nmdc:mga06z11_570550_c1 3300050494 Bacteria 688
550 nmdc:mga06z11_710486_c1 3300050494 Bacteria 612
551 nmdc:mga04h51_194572_c1 3300050495 Bacteria 794
552 nmdc:mga09592_892729_c1 3300050508 Bacteria 747
553 nmdc:mga0qj67_86299_c1 3300050509 Bacteria 2518
554 nmdc:mga08y16_149057_c1 3300050511 Bacteria 2432
555 nmdc:mga08x19_792644_c1 3300050514 Bacteria 673
556 nmdc:mga0a205_2672_c1 3300050515 Bacteria 15769
557 nmdc:mga0a205_352_c1 3300050515 Bacteria 34822
558 Ga0495601_0000117 3300053077 Bacteria 43844
559 Ga0495601_0094742 3300053077 Bacteria 1924
560 Ga0495601_0240011 3300053077 Unclassified 1183
561 Ga0495601_0306246 3300053077 Bacteria 1035
562 Ga0495612_0002827 3300053078 Bacteria 7181
563 Ga0495612_0007001 3300053078 Bacteria 4613
564 Ga0495655_0171405 3300053083 Bacteria 695
565 Ga0495595_0663927 3300053084 Bacteria 534
566 Ga0495619_0011185 3300053085 Bacteria 5645
567 Ga0495619_0157569 3300053085 Bacteria 1567
568 Ga0500644_0068133 3300053088 Bacteria 1275
569 Ga0500658_0016814 3300053134 Bacteria 2728
570 Ga0501084_0271515 3300054114 Bacteria 1432
571 Ga0501084_0589316 3300054114 Bacteria 939
572 Ga0501084_1097573 3300054114 Bacteria 668
573 Ga0501082_0011154 3300060353 Bacteria 7725

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005618 Ga0068864_100000023 Ga0068864_100000023116 66
2 3300025961 Ga0207712_11460808 Ga0207712_114608082 66
3 3300026095 Ga0207676_10000025 Ga0207676_10000025162 66
4 3300005338 Ga0068868_100939604 Ga0068868_1009396041 67
5 3300006038 Ga0075365_10008057 Ga0075365_100080572 67
6 3300006038 Ga0075365_11068894 Ga0075365_110688941 67
7 3300006048 Ga0075363_100607847 Ga0075363_1006078472 67
8 3300006051 Ga0075364_10032183 Ga0075364_100321833 67
9 3300006051 Ga0075364_10188541 Ga0075364_101885412 67
10 3300006051 Ga0075364_10304702 Ga0075364_103047022 67
11 3300006178 Ga0075367_10064238 Ga0075367_100642382 67
12 3300006846 Ga0075430_100479094 Ga0075430_1004790941 67
13 3300014968 Ga0157379_11542306 Ga0157379_115423062 67
14 3300025937 Ga0207669_10000010 Ga0207669_1000001027 67
15 3300026121 Ga0207683_10914525 Ga0207683_109145252 67
16 3300026121 Ga0207683_10982314 Ga0207683_109823141 67
17 3300028666 Ga0265336_10117333 Ga0265336_101173333 67
18 3300046533 Ga0495640_0844599 Ga0495640_0844599_21_230 67
19 3300050491 nmdc:mga00v17_592550_c1 nmdc:mga00v17_592550_c1_487_696 67
20 3300050492 nmdc:mga0yw44_45033_c1 nmdc:mga0yw44_45033_c1_1860_2063 67
21 3300050494 nmdc:mga06z11_570550_c1 nmdc:mga06z11_570550_c1_339_542 67
22 3300005547 Ga0070693_100002496 Ga0070693_1000024966 73
23 3300006048 Ga0075363_100332800 Ga0075363_1003328002 73
24 3300005329 Ga0070683_100510277 Ga0070683_1005102773 74
25 3300005356 Ga0070674_102088450 Ga0070674_1020884502 74
26 3300006038 Ga0075365_10070875 Ga0075365_100708752 74
27 3300006038 Ga0075365_10679444 Ga0075365_106794442 74
28 3300006042 Ga0075368_10246554 Ga0075368_102465542 74
29 3300006042 Ga0075368_10548280 Ga0075368_105482802 74
30 3300006048 Ga0075363_100123290 Ga0075363_1001232902 74
31 3300006051 Ga0075364_10125727 Ga0075364_101257272 74
32 3300006051 Ga0075364_10202551 Ga0075364_102025513 74
33 3300006051 Ga0075364_10517500 Ga0075364_105175001 74
34 3300006051 Ga0075364_10820870 Ga0075364_108208701 74
35 3300006178 Ga0075367_10664337 Ga0075367_106643372 74
36 3300006358 Ga0068871_100061386 Ga0068871_1000613864 74
37 3300025944 Ga0207661_10358845 Ga0207661_103588453 74
38 3300025945 Ga0207679_10136725 Ga0207679_101367253 74
39 3300031727 Ga0316576_10003110 Ga0316576_100031105 74
40 3300031728 Ga0316578_10837317 Ga0316578_108373172 74
41 3300032137 Ga0316585_10222397 Ga0316585_102223972 74
42 3300035398 Ga0316574_0183892 Ga0316574_0183892_445_675 74
43 3300036647 Ga0316582_0816423 Ga0316582_0816423_11_241 74
44 3300036712 Ga0316584_0088082 Ga0316584_0088082_644_874 74
45 3300041451 Ga0451791_0016531 Ga0451791_0016531_255_485 74
46 3300046476 Ga0495662_0279284 Ga0495662_0279284_74_301 74
47 3300046642 Ga0495634_0005960 Ga0495634_0005960_1160_1387 74
48 3300050491 nmdc:mga00v17_280485_c1 nmdc:mga00v17_280485_c1_605_835 74
49 3300050491 nmdc:mga00v17_389347_c1 nmdc:mga00v17_389347_c1_510_740 74
50 3300050491 nmdc:mga00v17_444249_c1 nmdc:mga00v17_444249_c1_446_676 74
51 3300050491 nmdc:mga00v17_624303_c1 nmdc:mga00v17_624303_c1_82_312 74
52 3300050491 nmdc:mga00v17_845273_c1 nmdc:mga00v17_845273_c1_155_385 74
53 3300050492 nmdc:mga0yw44_269775_c1 nmdc:mga0yw44_269775_c1_440_670 74
54 3300050492 nmdc:mga0yw44_836809_c1 nmdc:mga0yw44_836809_c1_267_497 74
55 3300050492 nmdc:mga0yw44_859794_c1 nmdc:mga0yw44_859794_c1_233_463 74
56 3300050492 nmdc:mga0yw44_975110_c1 nmdc:mga0yw44_975110_c1_150_380 74
57 3300050494 nmdc:mga06z11_710486_c1 nmdc:mga06z11_710486_c1_236_466 74
58 3300050495 nmdc:mga04h51_194572_c1 nmdc:mga04h51_194572_c1_336_566 74
59 3300053088 Ga0500644_0068133 Ga0500644_0068133_71_298 74
60 3300002074 JGI24748J21848_1000232 JGI24748J21848_10002323 75
61 3300002239 JGI24034J26672_10000252 JGI24034J26672_100002524 75
62 3300002244 JGI24742J22300_10004606 JGI24742J22300_100046064 75
63 3300005329 Ga0070683_100098697 Ga0070683_1000986972 75
64 3300005335 Ga0070666_10537017 Ga0070666_105370172 75
65 3300005336 Ga0070680_100386624 Ga0070680_1003866242 75
66 3300005337 Ga0070682_100875491 Ga0070682_1008754912 75
67 3300005355 Ga0070671_100156215 Ga0070671_1001562153 75
68 3300005367 Ga0070667_100022286 Ga0070667_1000222869 75
69 3300005367 Ga0070667_100088069 Ga0070667_1000880693 75
70 3300005367 Ga0070667_100437104 Ga0070667_1004371043 75
71 3300005367 Ga0070667_100902388 Ga0070667_1009023882 75
72 3300005455 Ga0070663_100008130 Ga0070663_1000081305 75
73 3300005455 Ga0070663_101999856 Ga0070663_1019998562 75
74 3300005458 Ga0070681_10081424 Ga0070681_100814244 75
75 3300005535 Ga0070684_100580022 Ga0070684_1005800222 75
76 3300005539 Ga0068853_100565379 Ga0068853_1005653793 75
77 3300005545 Ga0070695_100496787 Ga0070695_1004967872 75
78 3300005548 Ga0070665_100236950 Ga0070665_1002369502 75
79 3300005563 Ga0068855_100992125 Ga0068855_1009921252 75
80 3300005617 Ga0068859_102618168 Ga0068859_1026181682 75
81 3300005841 Ga0068863_100034844 Ga0068863_1000348443 75
82 3300005841 Ga0068863_102758755 Ga0068863_1027587551 75
83 3300005842 Ga0068858_102096783 Ga0068858_1020967832 75
84 3300005843 Ga0068860_100152203 Ga0068860_1001522034 75
85 3300005937 Ga0081455_10248269 Ga0081455_102482693 75
86 3300006931 Ga0097620_102617496 Ga0097620_1026174962 75
87 3300006931 Ga0097620_102823785 Ga0097620_1028237852 75
88 3300009093 Ga0105240_10386973 Ga0105240_103869732 75
89 3300009101 Ga0105247_10045271 Ga0105247_100452713 75
90 3300009101 Ga0105247_10561850 Ga0105247_105618503 75
91 3300009174 Ga0105241_11649618 Ga0105241_116496182 75
92 3300009177 Ga0105248_10668591 Ga0105248_106685913 75
93 3300009177 Ga0105248_12817424 Ga0105248_128174242 75
94 3300009551 Ga0105238_10333058 Ga0105238_103330581 75
95 3300009553 Ga0105249_11260094 Ga0105249_112600941 75
96 3300010375 Ga0105239_10160569 Ga0105239_101605692 75
97 3300011119 Ga0105246_11235258 Ga0105246_112352582 75
98 3300013105 Ga0157369_11307047 Ga0157369_113070472 75
99 3300013306 Ga0163162_11982905 Ga0163162_119829052 75
100 3300013307 Ga0157372_11635223 Ga0157372_116352232 75
101 3300014325 Ga0163163_11572038 Ga0163163_115720382 75
102 3300014325 Ga0163163_11724678 Ga0163163_117246782 75
103 3300014968 Ga0157379_10019064 Ga0157379_100190644 75
104 3300014968 Ga0157379_10713074 Ga0157379_107130742 75
105 3300025900 Ga0207710_10184427 Ga0207710_101844273 75
106 3300025900 Ga0207710_10540298 Ga0207710_105402982 75
107 3300025903 Ga0207680_10003987 Ga0207680_100039872 75
108 3300025903 Ga0207680_10432596 Ga0207680_104325962 75
109 3300025912 Ga0207707_10114253 Ga0207707_101142533 75
110 3300025917 Ga0207660_10213327 Ga0207660_102133272 75
111 3300025920 Ga0207649_10134146 Ga0207649_101341463 75
112 3300025921 Ga0207652_10001670 Ga0207652_1000167017 75
113 3300025924 Ga0207694_10111639 Ga0207694_101116394 75
114 3300025931 Ga0207644_10101551 Ga0207644_101015513 75
115 3300025936 Ga0207670_11405885 Ga0207670_114058852 75
116 3300025941 Ga0207711_10680059 Ga0207711_106800591 75
117 3300025941 Ga0207711_11699054 Ga0207711_116990542 75
118 3300025944 Ga0207661_10072408 Ga0207661_100724083 75
119 3300025986 Ga0207658_10011566 Ga0207658_100115665 75
120 3300025986 Ga0207658_10048783 Ga0207658_100487835 75
121 3300025986 Ga0207658_10502722 Ga0207658_105027223 75
122 3300026035 Ga0207703_10293406 Ga0207703_102934062 75
123 3300026035 Ga0207703_11317798 Ga0207703_113177982 75
124 3300026041 Ga0207639_10387112 Ga0207639_103871123 75
125 3300026067 Ga0207678_10012092 Ga0207678_100120925 75
126 3300026075 Ga0207708_11147744 Ga0207708_111477443 75
127 3300026088 Ga0207641_10085782 Ga0207641_100857823 75
128 3300028379 Ga0268266_10000422 Ga0268266_1000042234 75
129 3300028379 Ga0268266_10333384 Ga0268266_103333843 75
130 3300028381 Ga0268264_10361956 Ga0268264_103619562 75
131 3300031731 Ga0307405_10760032 Ga0307405_107600322 75
132 3300031852 Ga0307410_10092283 Ga0307410_100922832 75
133 3300032002 Ga0307416_100058138 Ga0307416_1000581382 75
134 3300032005 Ga0307411_10476037 Ga0307411_104760372 75
135 3300032126 Ga0307415_100073325 Ga0307415_1000733252 75
136 3300041494 Ga0451837_0767587 Ga0451837_0767587_48_281 75
137 3300041512 Ga0451853_3962859 Ga0451853_3962859_332_565 75
138 3300045976 Ga0466967_2383287 Ga0466967_2383287_76_306 75
139 3300046454 Ga0495592_0830225 Ga0495592_0830225_44_277 75
140 3300046519 Ga0495632_0039815 Ga0495632_0039815_244_477 75
141 3300046523 Ga0495644_0004542 Ga0495644_0004542_1846_2076 75
142 3300046535 Ga0495586_0000500 Ga0495586_0000500_20162_20392 75
143 3300046537 Ga0495598_0000588 Ga0495598_0000588_4335_4565 75
144 3300046539 Ga0495621_0006343 Ga0495621_0006343_1077_1310 75
145 3300046660 Ga0495625_0000029 Ga0495625_0000029_228524_228757 75
146 3300047320 Ga0495672_0463218 Ga0495672_0463218_101_331 75
147 3300047472 Ga0495686_0198171 Ga0495686_0198171_745_978 75
148 3300048903 Ga0496100_1501358 Ga0496100_1501358_222_455 75
149 3300048904 Ga0496101_0108961 Ga0496101_0108961_1710_1943 75
150 3300048905 Ga0496102_0038034 Ga0496102_0038034_963_1193 75
151 3300048906 Ga0496103_0231951 Ga0496103_0231951_640_873 75
152 3300048907 Ga0496104_0014119 Ga0496104_0014119_1530_1763 75
153 3300048908 Ga0496105_0005224 Ga0496105_0005224_8143_8376 75
154 3300048910 Ga0496107_0050049 Ga0496107_0050049_2582_2815 75
155 3300048910 Ga0496107_0471312 Ga0496107_0471312_276_509 75
156 3300048912 Ga0496109_0784271 Ga0496109_0784271_110_343 75
157 3300048913 Ga0496110_0805481 Ga0496110_0805481_334_567 75
158 3300048917 Ga0496114_0539560 Ga0496114_0539560_20_253 75
159 3300048918 Ga0496115_0588877 Ga0496115_0588877_362_595 75
160 3300048920 Ga0496117_0002711 Ga0496117_0002711_19508_19741 75
161 3300048921 Ga0496118_0001277 Ga0496118_0001277_27034_27267 75
162 3300048921 Ga0496118_0348427 Ga0496118_0348427_448_681 75
163 3300048921 Ga0496118_0380061 Ga0496118_0380061_123_353 75
164 3300048923 Ga0496120_0015354 Ga0496120_0015354_3548_3781 75
165 3300048923 Ga0496120_0192192 Ga0496120_0192192_77_310 75
166 3300048924 Ga0496121_0015047 Ga0496121_0015047_4714_4947 75
167 3300048924 Ga0496121_0196325 Ga0496121_0196325_848_1081 75
168 3300048927 Ga0496124_0039181 Ga0496124_0039181_968_1201 75
169 3300048928 Ga0496125_0410968 Ga0496125_0410968_511_744 75
170 3300048929 Ga0496126_0067719 Ga0496126_0067719_1978_2211 75
171 3300048929 Ga0496126_0127017 Ga0496126_0127017_954_1187 75
172 3300048929 Ga0496126_0434541 Ga0496126_0434541_599_832 75
173 3300048929 Ga0496126_1023474 Ga0496126_1023474_219_452 75
174 3300049568 Ga0501031_0006300 Ga0501031_0006300_929_1162 75
175 3300049569 Ga0501032_0008990 Ga0501032_0008990_494_727 75
176 3300049570 Ga0501033_0008846 Ga0501033_0008846_1006_1239 75
177 3300049571 Ga0501034_0013871 Ga0501034_0013871_6862_7095 75
178 3300049571 Ga0501034_0059301 Ga0501034_0059301_3314_3547 75
179 3300049571 Ga0501034_0694231 Ga0501034_0694231_502_747 75
180 3300049572 Ga0501036_0067783 Ga0501036_0067783_1041_1274 75
181 3300049573 Ga0501037_0000525 Ga0501037_0000525_23931_24164 75
182 3300049574 Ga0501038_0012367 Ga0501038_0012367_971_1204 75
183 3300049575 Ga0501039_0092346 Ga0501039_0092346_1207_1440 75
184 3300049575 Ga0501039_1026433 Ga0501039_1026433_45_272 75
185 3300049576 Ga0501040_0084637 Ga0501040_0084637_205_438 75
186 3300049578 Ga0501042_0044138 Ga0501042_0044138_1411_1644 75
187 3300049578 Ga0501042_0066461 Ga0501042_0066461_628_861 75
188 3300049579 Ga0501043_0009296 Ga0501043_0009296_953_1186 75
189 3300049579 Ga0501043_0304435 Ga0501043_0304435_759_998 75
190 3300049579 Ga0501043_0494608 Ga0501043_0494608_156_389 75
191 3300049580 Ga0501046_0010383 Ga0501046_0010383_6559_6792 75
192 3300049581 Ga0501047_0001574 Ga0501047_0001574_4953_5186 75
193 3300049581 Ga0501047_0049098 Ga0501047_0049098_2218_2451 75
194 3300049581 Ga0501047_1295068 Ga0501047_1295068_291_524 75
195 3300049582 Ga0501048_0008006 Ga0501048_0008006_1218_1451 75
196 3300049582 Ga0501048_1359790 Ga0501048_1359790_200_439 75
197 3300049583 Ga0501067_0036828 Ga0501067_0036828_1735_1968 75
198 3300049583 Ga0501067_0187431 Ga0501067_0187431_413_658 75
199 3300049583 Ga0501067_0514880 Ga0501067_0514880_356_589 75
200 3300049584 Ga0501068_0147497 Ga0501068_0147497_700_945 75
201 3300049584 Ga0501068_0264819 Ga0501068_0264819_630_869 75
202 3300049584 Ga0501068_0304563 Ga0501068_0304563_309_554 75
203 3300049584 Ga0501068_0997002 Ga0501068_0997002_188_415 75
204 3300049585 Ga0501069_0029178 Ga0501069_0029178_1124_1363 75
205 3300049585 Ga0501069_0047338 Ga0501069_0047338_1318_1551 75
206 3300049585 Ga0501069_0092800 Ga0501069_0092800_1136_1381 75
207 3300049585 Ga0501069_0264043 Ga0501069_0264043_375_620 75
208 3300049586 Ga0501070_0004676 Ga0501070_0004676_6902_7135 75
209 3300049586 Ga0501070_0010080 Ga0501070_0010080_6559_6792 75
210 3300049586 Ga0501070_0018917 Ga0501070_0018917_4090_4323 75
211 3300049586 Ga0501070_0060100 Ga0501070_0060100_2123_2368 75
212 3300049586 Ga0501070_0092725 Ga0501070_0092725_1794_2039 75
213 3300049586 Ga0501070_0189759 Ga0501070_0189759_433_672 75
214 3300049586 Ga0501070_0841871 Ga0501070_0841871_42_275 75
215 3300049587 Ga0501071_0197812 Ga0501071_0197812_622_867 75
216 3300049587 Ga0501071_0430007 Ga0501071_0430007_243_482 75
217 3300049588 Ga0501072_0018431 Ga0501072_0018431_1844_2089 75
218 3300049588 Ga0501072_0230061 Ga0501072_0230061_808_1041 75
219 3300049588 Ga0501072_0247691 Ga0501072_0247691_492_737 75
220 3300049589 Ga0501073_0034514 Ga0501073_0034514_1507_1752 75
221 3300049589 Ga0501073_0134353 Ga0501073_0134353_602_835 75
222 3300049590 Ga0501074_0013122 Ga0501074_0013122_3924_4169 75
223 3300049590 Ga0501074_0015911 Ga0501074_0015911_383_616 75
224 3300049590 Ga0501074_0153190 Ga0501074_0153190_564_803 75
225 3300049590 Ga0501074_0229951 Ga0501074_0229951_315_548 75
226 3300049590 Ga0501074_0914190 Ga0501074_0914190_184_417 75
227 3300049592 Ga0501076_1025091 Ga0501076_1025091_235_474 75
228 3300049741 Ga0501079_0302078 Ga0501079_0302078_298_537 75
229 3300049742 Ga0501080_0111542 Ga0501080_0111542_1680_1925 75
230 3300049742 Ga0501080_0135321 Ga0501080_0135321_902_1135 75
231 3300049742 Ga0501080_0379129 Ga0501080_0379129_891_1130 75
232 3300049743 Ga0501081_0139057 Ga0501081_0139057_848_1075 75
233 3300049744 Ga0501083_0007552 Ga0501083_0007552_924_1157 75
234 3300049744 Ga0501083_0018273 Ga0501083_0018273_3205_3450 75
235 3300049744 Ga0501083_0799840 Ga0501083_0799840_134_373 75
236 3300049822 Ga0501035_0001973 Ga0501035_0001973_13750_13983 75
237 3300049822 Ga0501035_0841852 Ga0501035_0841852_299_532 75
238 3300049823 Ga0501044_0016353 Ga0501044_0016353_1069_1302 75
239 3300049823 Ga0501044_0049370 Ga0501044_0049370_1958_2197 75
240 3300049824 Ga0501045_0092091 Ga0501045_0092091_232_465 75
241 3300050491 nmdc:mga00v17_996704_c1 nmdc:mga00v17_996704_c1_203_433 75
242 3300053134 Ga0500658_0016814 Ga0500658_0016814_555_788 75
243 3300054114 Ga0501084_1097573 Ga0501084_1097573_178_423 75
244 3300060353 Ga0501082_0011154 Ga0501082_0011154_952_1185 75
245 3300001990 JGI24737J22298_10262304 JGI24737J22298_102623042 76
246 3300002070 JGI24750J21931_1009086 JGI24750J21931_10090862 76
247 3300002075 JGI24738J21930_10050273 JGI24738J21930_100502732 76
248 3300002077 JGI24744J21845_10034710 JGI24744J21845_100347102 76
249 3300002459 JGI24751J29686_10066292 JGI24751J29686_100662921 76
250 3300005327 Ga0070658_10266364 Ga0070658_102663642 76
251 3300005328 Ga0070676_10431105 Ga0070676_104311052 76
252 3300005329 Ga0070683_100085971 Ga0070683_1000859713 76
253 3300005329 Ga0070683_100154280 Ga0070683_1001542801 76
254 3300005329 Ga0070683_100202022 Ga0070683_1002020222 76
255 3300005329 Ga0070683_100301786 Ga0070683_1003017862 76
256 3300005331 Ga0070670_100560195 Ga0070670_1005601952 76
257 3300005331 Ga0070670_101457762 Ga0070670_1014577622 76
258 3300005334 Ga0068869_100114315 Ga0068869_1001143151 76
259 3300005335 Ga0070666_10205807 Ga0070666_102058072 76
260 3300005336 Ga0070680_100435485 Ga0070680_1004354852 76
261 3300005338 Ga0068868_100015021 Ga0068868_1000150214 76
262 3300005339 Ga0070660_100001352 Ga0070660_10000135218 76
263 3300005344 Ga0070661_100000032 Ga0070661_10000003263 76
264 3300005344 Ga0070661_100117591 Ga0070661_1001175912 76
265 3300005347 Ga0070668_100179768 Ga0070668_1001797682 76
266 3300005353 Ga0070669_100098357 Ga0070669_1000983572 76
267 3300005354 Ga0070675_100026360 Ga0070675_1000263602 76
268 3300005356 Ga0070674_100010932 Ga0070674_1000109323 76
269 3300005364 Ga0070673_100235373 Ga0070673_1002353732 76
270 3300005365 Ga0070688_100020472 Ga0070688_1000204722 76
271 3300005366 Ga0070659_100000396 Ga0070659_1000003963 76
272 3300005366 Ga0070659_101615099 Ga0070659_1016150992 76
273 3300005436 Ga0070713_100288337 Ga0070713_1002883374 76
274 3300005441 Ga0070700_100007039 Ga0070700_1000070392 76
275 3300005441 Ga0070700_100086449 Ga0070700_1000864493 76
276 3300005455 Ga0070663_100006561 Ga0070663_1000065614 76
277 3300005455 Ga0070663_100872213 Ga0070663_1008722131 76
278 3300005456 Ga0070678_100173196 Ga0070678_1001731962 76
279 3300005456 Ga0070678_101291094 Ga0070678_1012910942 76
280 3300005457 Ga0070662_100202437 Ga0070662_1002024372 76
281 3300005458 Ga0070681_10649026 Ga0070681_106490262 76
282 3300005459 Ga0068867_100255425 Ga0068867_1002554252 76
283 3300005466 Ga0070685_10060155 Ga0070685_100601552 76
284 3300005530 Ga0070679_100124752 Ga0070679_1001247523 76
285 3300005535 Ga0070684_100011898 Ga0070684_1000118982 76
286 3300005535 Ga0070684_100019500 Ga0070684_1000195006 76
287 3300005535 Ga0070684_100076934 Ga0070684_1000769343 76
288 3300005535 Ga0070684_100641265 Ga0070684_1006412651 76
289 3300005535 Ga0070684_101802252 Ga0070684_1018022522 76
290 3300005539 Ga0068853_100019034 Ga0068853_1000190342 76
291 3300005543 Ga0070672_100000013 Ga0070672_10000001355 76
292 3300005543 Ga0070672_100005703 Ga0070672_1000057035 76
293 3300005544 Ga0070686_100014046 Ga0070686_1000140462 76
294 3300005544 Ga0070686_101267196 Ga0070686_1012671961 76
295 3300005545 Ga0070695_100340472 Ga0070695_1003404723 76
296 3300005545 Ga0070695_100401467 Ga0070695_1004014672 76
297 3300005547 Ga0070693_100599430 Ga0070693_1005994301 76
298 3300005548 Ga0070665_101621306 Ga0070665_1016213062 76
299 3300005549 Ga0070704_100892637 Ga0070704_1008926371 76
300 3300005563 Ga0068855_100443679 Ga0068855_1004436792 76
301 3300005563 Ga0068855_100727711 Ga0068855_1007277112 76
302 3300005564 Ga0070664_101262018 Ga0070664_1012620182 76
303 3300005577 Ga0068857_100326353 Ga0068857_1003263531 76
304 3300005578 Ga0068854_100007996 Ga0068854_1000079963 76
305 3300005614 Ga0068856_102682356 Ga0068856_1026823562 76
306 3300005615 Ga0070702_100067036 Ga0070702_1000670362 76
307 3300005616 Ga0068852_100054777 Ga0068852_1000547774 76
308 3300005617 Ga0068859_100745703 Ga0068859_1007457032 76
309 3300005618 Ga0068864_100081628 Ga0068864_1000816282 76
310 3300005718 Ga0068866_10000007 Ga0068866_10000007116 76
311 3300005719 Ga0068861_100172879 Ga0068861_1001728792 76
312 3300005834 Ga0068851_10117298 Ga0068851_101172982 76
313 3300005840 Ga0068870_10845894 Ga0068870_108458942 76
314 3300005841 Ga0068863_100837911 Ga0068863_1008379112 76
315 3300005842 Ga0068858_100130044 Ga0068858_1001300443 76
316 3300005844 Ga0068862_100192668 Ga0068862_1001926682 76
317 3300005937 Ga0081455_10017920 Ga0081455_100179203 76
318 3300005981 Ga0081538_10000034 Ga0081538_1000003447 76
319 3300005985 Ga0081539_10001387 Ga0081539_1000138718 76
320 3300006038 Ga0075365_10020868 Ga0075365_100208685 76
321 3300006038 Ga0075365_10703749 Ga0075365_107037491 76
322 3300006038 Ga0075365_11166064 Ga0075365_111660642 76
323 3300006048 Ga0075363_100016297 Ga0075363_1000162973 76
324 3300006048 Ga0075363_100048892 Ga0075363_1000488922 76
325 3300006048 Ga0075363_100167874 Ga0075363_1001678742 76
326 3300006051 Ga0075364_10146173 Ga0075364_101461732 76
327 3300006173 Ga0070716_100115317 Ga0070716_1001153174 76
328 3300006178 Ga0075367_10083623 Ga0075367_100836232 76
329 3300006178 Ga0075367_10181824 Ga0075367_101818242 76
330 3300006852 Ga0075433_10010741 Ga0075433_100107412 76
331 3300006881 Ga0068865_100009350 Ga0068865_1000093503 76
332 3300006931 Ga0097620_100745738 Ga0097620_1007457382 76
333 3300009036 Ga0105244_10377939 Ga0105244_103779391 76
334 3300009093 Ga0105240_10666360 Ga0105240_106663603 76
335 3300009093 Ga0105240_11383029 Ga0105240_113830292 76
336 3300009094 Ga0111539_10164631 Ga0111539_101646312 76
337 3300009094 Ga0111539_11549256 Ga0111539_115492562 76
338 3300009098 Ga0105245_10014070 Ga0105245_100140704 76
339 3300009098 Ga0105245_12043786 Ga0105245_120437862 76
340 3300009148 Ga0105243_10005110 Ga0105243_100051105 76
341 3300009148 Ga0105243_10702326 Ga0105243_107023263 76
342 3300009176 Ga0105242_10221747 Ga0105242_102217472 76
343 3300009551 Ga0105238_10000016 Ga0105238_1000001640 76
344 3300009553 Ga0105249_10000054 Ga0105249_10000054145 76
345 3300009553 Ga0105249_13080808 Ga0105249_130808082 76
346 3300010159 Ga0099796_10266503 Ga0099796_102665032 76
347 3300010375 Ga0105239_10107435 Ga0105239_101074353 76
348 3300011119 Ga0105246_10106248 Ga0105246_101062482 76
349 3300011119 Ga0105246_10417416 Ga0105246_104174161 76
350 3300013307 Ga0157372_10414816 Ga0157372_104148162 76
351 3300013308 Ga0157375_10011718 Ga0157375_100117184 76
352 3300013308 Ga0157375_12934149 Ga0157375_129341492 76
353 3300014325 Ga0163163_11879931 Ga0163163_118799312 76
354 3300014326 Ga0157380_10377504 Ga0157380_103775042 76
355 3300014326 Ga0157380_11862098 Ga0157380_118620982 76
356 3300014745 Ga0157377_10010951 Ga0157377_100109512 76
357 3300014968 Ga0157379_10017532 Ga0157379_100175328 76
358 3300017792 Ga0163161_11556738 Ga0163161_115567382 76
359 3300025899 Ga0207642_10633627 Ga0207642_106336271 76
360 3300025900 Ga0207710_10026077 Ga0207710_100260772 76
361 3300025901 Ga0207688_10012452 Ga0207688_100124524 76
362 3300025903 Ga0207680_10213958 Ga0207680_102139582 76
363 3300025904 Ga0207647_10103670 Ga0207647_101036702 76
364 3300025907 Ga0207645_10168950 Ga0207645_101689502 76
365 3300025909 Ga0207705_10019045 Ga0207705_100190459 76
366 3300025909 Ga0207705_10035941 Ga0207705_100359412 76
367 3300025917 Ga0207660_10387301 Ga0207660_103873012 76
368 3300025919 Ga0207657_10001969 Ga0207657_1000196918 76
369 3300025920 Ga0207649_10000015 Ga0207649_1000001531 76
370 3300025920 Ga0207649_10061038 Ga0207649_100610382 76
371 3300025920 Ga0207649_11683505 Ga0207649_116835052 76
372 3300025921 Ga0207652_10170366 Ga0207652_101703662 76
373 3300025923 Ga0207681_10170726 Ga0207681_101707262 76
374 3300025924 Ga0207694_10000012 Ga0207694_10000012381 76
375 3300025925 Ga0207650_11258382 Ga0207650_112583822 76
376 3300025926 Ga0207659_10017333 Ga0207659_100173334 76
377 3300025927 Ga0207687_10053880 Ga0207687_100538802 76
378 3300025929 Ga0207664_10956782 Ga0207664_109567822 76
379 3300025932 Ga0207690_10006166 Ga0207690_100061665 76
380 3300025932 Ga0207690_11233393 Ga0207690_112333932 76
381 3300025933 Ga0207706_10000003 Ga0207706_100000039 76
382 3300025933 Ga0207706_10026716 Ga0207706_100267162 76
383 3300025934 Ga0207686_10054601 Ga0207686_100546012 76
384 3300025935 Ga0207709_10006931 Ga0207709_100069313 76
385 3300025937 Ga0207669_10000475 Ga0207669_100004757 76
386 3300025937 Ga0207669_10008523 Ga0207669_100085234 76
387 3300025938 Ga0207704_10004361 Ga0207704_100043613 76
388 3300025939 Ga0207665_10040308 Ga0207665_100403086 76
389 3300025940 Ga0207691_10000095 Ga0207691_1000009529 76
390 3300025940 Ga0207691_10022999 Ga0207691_100229993 76
391 3300025942 Ga0207689_10198651 Ga0207689_101986512 76
392 3300025944 Ga0207661_10000666 Ga0207661_1000066617 76
393 3300025944 Ga0207661_10001606 Ga0207661_1000160618 76
394 3300025944 Ga0207661_10035852 Ga0207661_100358523 76
395 3300025944 Ga0207661_10172133 Ga0207661_101721334 76
396 3300025945 Ga0207679_10009210 Ga0207679_100092104 76
397 3300025945 Ga0207679_11423370 Ga0207679_114233701 76
398 3300025945 Ga0207679_11900160 Ga0207679_119001602 76
399 3300025949 Ga0207667_10124115 Ga0207667_101241154 76
400 3300025960 Ga0207651_10200198 Ga0207651_102001982 76
401 3300025972 Ga0207668_10074640 Ga0207668_100746404 76
402 3300025972 Ga0207668_10108349 Ga0207668_101083492 76
403 3300025981 Ga0207640_10315672 Ga0207640_103156721 76
404 3300026023 Ga0207677_10079064 Ga0207677_100790642 76
405 3300026035 Ga0207703_10524372 Ga0207703_105243722 76
406 3300026041 Ga0207639_10039552 Ga0207639_100395522 76
407 3300026067 Ga0207678_10001730 Ga0207678_100017306 76
408 3300026075 Ga0207708_10003752 Ga0207708_100037524 76
409 3300026075 Ga0207708_10126034 Ga0207708_101260343 76
410 3300026088 Ga0207641_10000436 Ga0207641_1000043615 76
411 3300026088 Ga0207641_11055967 Ga0207641_110559672 76
412 3300026089 Ga0207648_10292820 Ga0207648_102928202 76
413 3300026095 Ga0207676_12039162 Ga0207676_120391622 76
414 3300026116 Ga0207674_10136991 Ga0207674_101369912 76
415 3300026118 Ga0207675_100485618 Ga0207675_1004856182 76
416 3300026121 Ga0207683_10656039 Ga0207683_106560392 76
417 3300026142 Ga0207698_10009935 Ga0207698_100099357 76
418 3300026142 Ga0207698_10017583 Ga0207698_100175832 76
419 3300027907 Ga0207428_10219707 Ga0207428_102197072 76
420 3300028379 Ga0268266_10018593 Ga0268266_100185933 76
421 3300028379 Ga0268266_10353696 Ga0268266_103536962 76
422 3300028379 Ga0268266_11439928 Ga0268266_114399281 76
423 3300028380 Ga0268265_10283975 Ga0268265_102839752 76
424 3300028381 Ga0268264_10227112 Ga0268264_102271121 76
425 3300031548 Ga0307408_101295541 Ga0307408_1012955412 76
426 3300031727 Ga0316576_10819755 Ga0316576_108197552 76
427 3300031728 Ga0316578_10064066 Ga0316578_100640662 76
428 3300031824 Ga0307413_10667263 Ga0307413_106672631 76
429 3300031901 Ga0307406_10144983 Ga0307406_101449832 76
430 3300031901 Ga0307406_10991375 Ga0307406_109913751 76
431 3300031901 Ga0307406_11247738 Ga0307406_112477381 76
432 3300031911 Ga0307412_12078929 Ga0307412_120789292 76
433 3300031995 Ga0307409_100260999 Ga0307409_1002609992 76
434 3300032002 Ga0307416_100304174 Ga0307416_1003041742 76
435 3300032002 Ga0307416_100612735 Ga0307416_1006127352 76
436 3300032126 Ga0307415_102075585 Ga0307415_1020755851 76
437 3300035398 Ga0316574_0904020 Ga0316574_0904020_12_248 76
438 3300036712 Ga0316584_0091236 Ga0316584_0091236_1746_1982 76
439 3300036712 Ga0316584_0417167 Ga0316584_0417167_677_919 76
440 3300037312 Ga0395899_0461832 Ga0395899_0461832_211_444 76
441 3300037466 Ga0395898_0376567 Ga0395898_0376567_715_945 76
442 3300037471 Ga0395905_0293159 Ga0395905_0293159_568_798 76
443 3300037853 Ga0436364_1069239 Ga0436364_1069239_304_537 76
444 3300038443 Ga0395901_0567820 Ga0395901_0567820_759_992 76
445 3300038443 Ga0395901_0787426 Ga0395901_0787426_651_881 76
446 3300041460 Ga0451802_1111570 Ga0451802_1111570_315_548 76
447 3300041486 Ga0451807_1603377 Ga0451807_1603377_675_911 76
448 3300041512 Ga0451853_2552138 Ga0451853_2552138_271_504 76
449 3300042115 Ga0450911_034913 Ga0450911_034913_377_622 76
450 3300044694 Ga0466963_0000033 Ga0466963_0000033_40239_40475 76
451 3300046454 Ga0495592_0720553 Ga0495592_0720553_102_344 76
452 3300046455 Ga0495603_0003650 Ga0495603_0003650_6242_6475 76
453 3300046459 Ga0495629_0000489 Ga0495629_0000489_13216_13452 76
454 3300046459 Ga0495629_0188950 Ga0495629_0188950_259_501 76
455 3300046459 Ga0495629_0316513 Ga0495629_0316513_501_734 76
456 3300046461 Ga0495641_0010101 Ga0495641_0010101_564_800 76
457 3300046463 Ga0495653_0056155 Ga0495653_0056155_1312_1548 76
458 3300046463 Ga0495653_0759289 Ga0495653_0759289_308_544 76
459 3300046500 Ga0495596_0412129 Ga0495596_0412129_109_354 76
460 3300046507 Ga0495606_0000550 Ga0495606_0000550_40683_40919 76
461 3300046513 Ga0495616_0430910 Ga0495616_0430910_116_361 76
462 3300046514 Ga0495618_0000053 Ga0495618_0000053_76271_76504 76
463 3300046515 Ga0495620_0000782 Ga0495620_0000782_11668_11904 76
464 3300046516 Ga0495628_0000628 Ga0495628_0000628_4908_5144 76
465 3300046516 Ga0495628_0124881 Ga0495628_0124881_252_488 76
466 3300046516 Ga0495628_0147720 Ga0495628_0147720_1055_1291 76
467 3300046517 Ga0495630_0000599 Ga0495630_0000599_14954_15190 76
468 3300046517 Ga0495630_0062591 Ga0495630_0062591_418_651 76
469 3300046517 Ga0495630_0580467 Ga0495630_0580467_491_727 76
470 3300046517 Ga0495630_0600846 Ga0495630_0600846_170_406 76
471 3300046529 Ga0495652_0000009 Ga0495652_0000009_151164_151400 76
472 3300046529 Ga0495652_0450761 Ga0495652_0450761_219_455 76
473 3300046536 Ga0495587_0403700 Ga0495587_0403700_506_739 76
474 3300046559 Ga0495667_0000109 Ga0495667_0000109_52552_52788 76
475 3300046559 Ga0495667_0273805 Ga0495667_0273805_93_329 76
476 3300046642 Ga0495634_0360501 Ga0495634_0360501_461_697 76
477 3300046642 Ga0495634_0875243 Ga0495634_0875243_19_252 76
478 3300046663 Ga0495635_0577720 Ga0495635_0577720_367_600 76
479 3300046663 Ga0495635_0683226 Ga0495635_0683226_304_540 76
480 3300046675 Ga0495657_0097308 Ga0495657_0097308_440_676 76
481 3300046678 Ga0495599_0431712 Ga0495599_0431712_197_433 76
482 3300046680 Ga0495646_0536753 Ga0495646_0536753_197_439 76
483 3300046681 Ga0495647_0000002 Ga0495647_0000002_71019_71252 76
484 3300046684 Ga0495669_0015192 Ga0495669_0015192_581_817 76
485 3300046689 Ga0495613_0000042 Ga0495613_0000042_111163_111426 76
486 3300046689 Ga0495613_0778832 Ga0495613_0778832_240_473 76
487 3300046691 Ga0495670_0039028 Ga0495670_0039028_307_540 76
488 3300046794 Ga0495589_0356352 Ga0495589_0356352_372_617 76
489 3300046809 Ga0495600_0000922 Ga0495600_0000922_14471_14704 76
490 3300046809 Ga0495600_0511662 Ga0495600_0511662_330_566 76
491 3300046809 Ga0495600_0727324 Ga0495600_0727324_15_251 76
492 3300047317 Ga0495604_0000255 Ga0495604_0000255_12649_12885 76
493 3300047319 Ga0495674_0172893 Ga0495674_0172893_727_963 76
494 3300047319 Ga0495674_1181260 Ga0495674_1181260_184_447 76
495 3300047321 Ga0495676_0302103 Ga0495676_0302103_86_322 76
496 3300047321 Ga0495676_0599892 Ga0495676_0599892_293_526 76
497 3300047321 Ga0495676_0803760 Ga0495676_0803760_207_440 76
498 3300047322 Ga0495680_0001999 Ga0495680_0001999_7198_7434 76
499 3300047322 Ga0495680_0285043 Ga0495680_0285043_893_1126 76
500 3300047322 Ga0495680_0501511 Ga0495680_0501511_289_525 76
501 3300047446 Ga0495679_011199 Ga0495679_011199_2740_2976 76
502 3300047471 Ga0495684_0133639 Ga0495684_0133639_1610_1846 76
503 3300048088 Ga0495602_0003237 Ga0495602_0003237_367_603 76
504 3300048903 Ga0496100_0189085 Ga0496100_0189085_1210_1440 76
505 3300048904 Ga0496101_0113061 Ga0496101_0113061_1100_1330 76
506 3300048905 Ga0496102_1722469 Ga0496102_1722469_56_286 76
507 3300048909 Ga0496106_0032804 Ga0496106_0032804_3025_3255 76
508 3300048910 Ga0496107_0026865 Ga0496107_0026865_3199_3429 76
509 3300048911 Ga0496108_0000004 Ga0496108_0000004_165218_165454 76
510 3300048911 Ga0496108_0030176 Ga0496108_0030176_3631_3861 76
511 3300048911 Ga0496108_0059767 Ga0496108_0059767_152_388 76
512 3300048912 Ga0496109_0000011 Ga0496109_0000011_225222_225458 76
513 3300048912 Ga0496109_0000031 Ga0496109_0000031_11431_11667 76
514 3300048912 Ga0496109_0000870 Ga0496109_0000870_12395_12625 76
515 3300048912 Ga0496109_1225261 Ga0496109_1225261_362_595 76
516 3300048913 Ga0496110_0063783 Ga0496110_0063783_2110_2355 76
517 3300048913 Ga0496110_0927459 Ga0496110_0927459_430_666 76
518 3300048913 Ga0496110_1345665 Ga0496110_1345665_170_406 76
519 3300048914 Ga0496111_0009546 Ga0496111_0009546_3332_3577 76
520 3300048914 Ga0496111_0084449 Ga0496111_0084449_1868_2098 76
521 3300048914 Ga0496111_0195835 Ga0496111_0195835_327_563 76
522 3300048914 Ga0496111_0261394 Ga0496111_0261394_170_406 76
523 3300048916 Ga0496113_0024494 Ga0496113_0024494_3290_3520 76
524 3300048917 Ga0496114_0139373 Ga0496114_0139373_137_373 76
525 3300048927 Ga0496124_0213778 Ga0496124_0213778_109_345 76
526 3300048928 Ga0496125_0569553 Ga0496125_0569553_329_565 76
527 3300049575 Ga0501039_1235581 Ga0501039_1235581_212_445 76
528 3300049576 Ga0501040_0727388 Ga0501040_0727388_227_460 76
529 3300049577 Ga0501041_0400861 Ga0501041_0400861_95_328 76
530 3300049578 Ga0501042_0012990 Ga0501042_0012990_1667_1900 76
531 3300049578 Ga0501042_0591487 Ga0501042_0591487_174_422 76
532 3300049582 Ga0501048_0130907 Ga0501048_0130907_1356_1589 76
533 3300049582 Ga0501048_0161107 Ga0501048_0161107_906_1145 76
534 3300049584 Ga0501068_0172704 Ga0501068_0172704_888_1130 76
535 3300049586 Ga0501070_0984618 Ga0501070_0984618_63_308 76
536 3300049587 Ga0501071_0929582 Ga0501071_0929582_398_628 76
537 3300049587 Ga0501071_1267689 Ga0501071_1267689_38_271 76
538 3300049588 Ga0501072_0439462 Ga0501072_0439462_301_540 76
539 3300049591 Ga0501075_0017368 Ga0501075_0017368_4107_4340 76
540 3300049591 Ga0501075_0180639 Ga0501075_0180639_856_1095 76
541 3300049592 Ga0501076_0117122 Ga0501076_0117122_687_917 76
542 3300049592 Ga0501076_0288313 Ga0501076_0288313_47_283 76
543 3300049593 Ga0501077_0748187 Ga0501077_0748187_295_531 76
544 3300049741 Ga0501079_0455468 Ga0501079_0455468_561_794 76
545 3300049741 Ga0501079_0790074 Ga0501079_0790074_450_689 76
546 3300049741 Ga0501079_1122569 Ga0501079_1122569_217_450 76
547 3300049742 Ga0501080_0381272 Ga0501080_0381272_252_485 76
548 3300049824 Ga0501045_0224786 Ga0501045_0224786_905_1144 76
549 3300050490 nmdc:mga03n38_10548_c1 nmdc:mga03n38_10548_c1_651_881 76
550 3300050490 nmdc:mga03n38_47681_c2 nmdc:mga03n38_47681_c2_806_1045 76
551 3300050490 nmdc:mga03n38_61430_c1 nmdc:mga03n38_61430_c1_1162_1401 76
552 3300050491 nmdc:mga00v17_25448_c1 nmdc:mga00v17_25448_c1_2570_2800 76
553 3300050492 nmdc:mga0yw44_6820_c1 nmdc:mga0yw44_6820_c1_1760_1990 76
554 3300050494 nmdc:mga06z11_207518_c1 nmdc:mga06z11_207518_c1_506_745 76
555 3300050494 nmdc:mga06z11_415277_c1 nmdc:mga06z11_415277_c1_267_497 76
556 3300050508 nmdc:mga09592_892729_c1 nmdc:mga09592_892729_c1_76_318 76
557 3300050509 nmdc:mga0qj67_86299_c1 nmdc:mga0qj67_86299_c1_733_966 76
558 3300050511 nmdc:mga08y16_149057_c1 nmdc:mga08y16_149057_c1_1092_1322 76
559 3300050514 nmdc:mga08x19_792644_c1 nmdc:mga08x19_792644_c1_314_559 76
560 3300050515 nmdc:mga0a205_2672_c1 nmdc:mga0a205_2672_c1_3278_3511 76
561 3300050515 nmdc:mga0a205_352_c1 nmdc:mga0a205_352_c1_26648_26881 76
562 3300053077 Ga0495601_0000117 Ga0495601_0000117_24528_24764 76
563 3300053077 Ga0495601_0094742 Ga0495601_0094742_52_288 76
564 3300053077 Ga0495601_0240011 Ga0495601_0240011_686_922 76
565 3300053077 Ga0495601_0306246 Ga0495601_0306246_678_911 76
566 3300053078 Ga0495612_0002827 Ga0495612_0002827_1941_2177 76
567 3300053078 Ga0495612_0007001 Ga0495612_0007001_944_1180 76
568 3300053083 Ga0495655_0171405 Ga0495655_0171405_140_385 76
569 3300053084 Ga0495595_0663927 Ga0495595_0663927_124_360 76
570 3300053085 Ga0495619_0011185 Ga0495619_0011185_4826_5059 76
571 3300053085 Ga0495619_0157569 Ga0495619_0157569_23_259 76
572 3300054114 Ga0501084_0271515 Ga0501084_0271515_782_1021 76
573 3300054114 Ga0501084_0589316 Ga0501084_0589316_313_546 76

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

12

78

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.8704 5 75
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.8688 4 75
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8598 1 76
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8579 6 76
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8547 2 75
ID Description Score Start End Superfamily
af_P0A9W6_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9397 2 75 3.30.300.90
af_Q4DAW3_3_74_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9215 3 73 3.30.300.90
af_Q67VQ4_70_166_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9177 4 75 3.10.20.90
af_Q53S33_27_107_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9108 4 76 3.30.300.90
af_Q4DAW3_3_74_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.898 3 73 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A838UW57-F1-model_v4 BolA family transcriptional regulator 0.9845 1 76
AF-A0A838UW57-F1-model_v4 BolA family transcriptional regulator 0.9719 1 76
AF-A0A2A5HRZ9-F1-model_v4 Cell division protein BolA 0.9688 2 75 GO:0051301
AF-A0A3M1HI65-F1-model_v4 BolA/IbaG family iron-sulfur metabolism protein 0.9668 1 76
AF-A0A2A4X5Y4-F1-model_v4 BolA family transcriptional regulator 0.9659 4 75

Feature Viewer

pLDDT pTM Quality
93.83 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map