F465153
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 573 | 300 | 573 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_101457762|Ga0070670_1014577622 |
| Length | 81 |
| Sequence | MAADLQELERMIAEALPGADVSVVDEGGGDHLRAIVTAPQFEGLTRIDQHRLVRTAVKPRMDDGTIHALSISTTAPGTQSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 157 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 168 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 169 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 170 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 180 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 181 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 184 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 244 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 283 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 285 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 286 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.9 |
| Nodule | 0 |
| Rhizoplane | 6.28 |
| Rhizosphere | 81.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10262304 | 3300001990 | Bacteria | 511 |
| 2 | JGI24750J21931_1009086 | 3300002070 | Bacteria | 1274 |
| 3 | JGI24748J21848_1000232 | 3300002074 | Bacteria | 6730 |
| 4 | JGI24738J21930_10050273 | 3300002075 | Bacteria | 850 |
| 5 | JGI24744J21845_10034710 | 3300002077 | Bacteria | 956 |
| 6 | JGI24034J26672_10000252 | 3300002239 | Bacteria | 7059 |
| 7 | JGI24742J22300_10004606 | 3300002244 | Bacteria | 2262 |
| 8 | JGI24751J29686_10066292 | 3300002459 | Bacteria | 743 |
| 9 | Ga0070658_10266364 | 3300005327 | Bacteria | 1456 |
| 10 | Ga0070676_10431105 | 3300005328 | Bacteria | 923 |
| 11 | Ga0070683_100085971 | 3300005329 | Bacteria | 2949 |
| 12 | Ga0070683_100098697 | 3300005329 | Bacteria | 2749 |
| 13 | Ga0070683_100154280 | 3300005329 | Bacteria | 2178 |
| 14 | Ga0070683_100202022 | 3300005329 | Bacteria | 1887 |
| 15 | Ga0070683_100301786 | 3300005329 | Bacteria | 1523 |
| 16 | Ga0070683_100510277 | 3300005329 | Bacteria | 1149 |
| 17 | Ga0070670_100560195 | 3300005331 | Bacteria | 1020 |
| 18 | Ga0070670_101457762 | 3300005331 | Bacteria | 628 |
| 19 | Ga0068869_100114315 | 3300005334 | Bacteria | 2057 |
| 20 | Ga0070666_10205807 | 3300005335 | Bacteria | 1385 |
| 21 | Ga0070666_10537017 | 3300005335 | Bacteria | 850 |
| 22 | Ga0070680_100386624 | 3300005336 | Bacteria | 1192 |
| 23 | Ga0070680_100435485 | 3300005336 | Bacteria | 1119 |
| 24 | Ga0070682_100875491 | 3300005337 | Bacteria | 736 |
| 25 | Ga0068868_100015021 | 3300005338 | Bacteria | 5720 |
| 26 | Ga0068868_100939604 | 3300005338 | Unclassified | 788 |
| 27 | Ga0070660_100001352 | 3300005339 | Bacteria | 16674 |
| 28 | Ga0070661_100000032 | 3300005344 | Bacteria | 112964 |
| 29 | Ga0070661_100117591 | 3300005344 | Bacteria | 1989 |
| 30 | Ga0070668_100179768 | 3300005347 | Bacteria | 1727 |
| 31 | Ga0070669_100098357 | 3300005353 | Bacteria | 2204 |
| 32 | Ga0070675_100026360 | 3300005354 | Bacteria | 4664 |
| 33 | Ga0070671_100156215 | 3300005355 | Bacteria | 1927 |
| 34 | Ga0070674_100010932 | 3300005356 | Bacteria | 5506 |
| 35 | Ga0070674_102088450 | 3300005356 | Unclassified | 517 |
| 36 | Ga0070673_100235373 | 3300005364 | Bacteria | 1590 |
| 37 | Ga0070688_100020472 | 3300005365 | Bacteria | 3848 |
| 38 | Ga0070659_100000396 | 3300005366 | Bacteria | 33083 |
| 39 | Ga0070659_101615099 | 3300005366 | Bacteria | 579 |
| 40 | Ga0070667_100022286 | 3300005367 | Bacteria | 5255 |
| 41 | Ga0070667_100088069 | 3300005367 | Bacteria | 2665 |
| 42 | Ga0070667_100437104 | 3300005367 | Bacteria | 1194 |
| 43 | Ga0070667_100902388 | 3300005367 | Bacteria | 823 |
| 44 | Ga0070713_100288337 | 3300005436 | Bacteria | 1508 |
| 45 | Ga0070700_100007039 | 3300005441 | Bacteria | 6044 |
| 46 | Ga0070700_100086449 | 3300005441 | Bacteria | 2036 |
| 47 | Ga0070663_100006561 | 3300005455 | Bacteria | 7012 |
| 48 | Ga0070663_100008130 | 3300005455 | Bacteria | 6436 |
| 49 | Ga0070663_100872213 | 3300005455 | Unclassified | 776 |
| 50 | Ga0070663_101999856 | 3300005455 | Unclassified | 521 |
| 51 | Ga0070678_100173196 | 3300005456 | Bacteria | 1760 |
| 52 | Ga0070678_101291094 | 3300005456 | Bacteria | 679 |
| 53 | Ga0070662_100202437 | 3300005457 | Bacteria | 1576 |
| 54 | Ga0070681_10081424 | 3300005458 | Bacteria | 3193 |
| 55 | Ga0070681_10649026 | 3300005458 | Bacteria | 970 |
| 56 | Ga0068867_100255425 | 3300005459 | Bacteria | 1427 |
| 57 | Ga0070685_10060155 | 3300005466 | Bacteria | 2220 |
| 58 | Ga0070679_100124752 | 3300005530 | Bacteria | 2558 |
| 59 | Ga0070684_100011898 | 3300005535 | Bacteria | 6949 |
| 60 | Ga0070684_100019500 | 3300005535 | Bacteria | 5611 |
| 61 | Ga0070684_100076934 | 3300005535 | Bacteria | 2946 |
| 62 | Ga0070684_100580022 | 3300005535 | Bacteria | 1042 |
| 63 | Ga0070684_100641265 | 3300005535 | Bacteria | 988 |
| 64 | Ga0070684_101802252 | 3300005535 | Bacteria | 577 |
| 65 | Ga0068853_100019034 | 3300005539 | Bacteria | 5689 |
| 66 | Ga0068853_100565379 | 3300005539 | Bacteria | 1078 |
| 67 | Ga0070672_100000013 | 3300005543 | Bacteria | 75650 |
| 68 | Ga0070672_100005703 | 3300005543 | Bacteria | 8294 |
| 69 | Ga0070686_100014046 | 3300005544 | Bacteria | 4605 |
| 70 | Ga0070686_101267196 | 3300005544 | Bacteria | 614 |
| 71 | Ga0070695_100340472 | 3300005545 | Bacteria | 1121 |
| 72 | Ga0070695_100401467 | 3300005545 | Bacteria | 1039 |
| 73 | Ga0070695_100496787 | 3300005545 | Bacteria | 943 |
| 74 | Ga0070693_100002496 | 3300005547 | Bacteria | 8477 |
| 75 | Ga0070693_100599430 | 3300005547 | Bacteria | 795 |
| 76 | Ga0070665_100236950 | 3300005548 | Bacteria | 1825 |
| 77 | Ga0070665_101621306 | 3300005548 | Bacteria | 655 |
| 78 | Ga0070704_100892637 | 3300005549 | Bacteria | 799 |
| 79 | Ga0068855_100443679 | 3300005563 | Bacteria | 1417 |
| 80 | Ga0068855_100727711 | 3300005563 | Bacteria | 1060 |
| 81 | Ga0068855_100992125 | 3300005563 | Bacteria | 883 |
| 82 | Ga0070664_101262018 | 3300005564 | Bacteria | 697 |
| 83 | Ga0068857_100326353 | 3300005577 | Bacteria | 1418 |
| 84 | Ga0068854_100007996 | 3300005578 | Bacteria | 6775 |
| 85 | Ga0068856_102682356 | 3300005614 | Bacteria | 504 |
| 86 | Ga0070702_100067036 | 3300005615 | Bacteria | 2107 |
| 87 | Ga0068852_100054777 | 3300005616 | Bacteria | 3439 |
| 88 | Ga0068859_100745703 | 3300005617 | Bacteria | 1068 |
| 89 | Ga0068859_102618168 | 3300005617 | Unclassified | 555 |
| 90 | Ga0068864_100000023 | 3300005618 | Bacteria | 257064 |
| 91 | Ga0068864_100081628 | 3300005618 | Bacteria | 2835 |
| 92 | Ga0068866_10000007 | 3300005718 | Bacteria | 121729 |
| 93 | Ga0068861_100172879 | 3300005719 | Bacteria | 1792 |
| 94 | Ga0068851_10117298 | 3300005834 | Bacteria | 1427 |
| 95 | Ga0068870_10845894 | 3300005840 | Bacteria | 642 |
| 96 | Ga0068863_100034844 | 3300005841 | Bacteria | 4794 |
| 97 | Ga0068863_100837911 | 3300005841 | Bacteria | 918 |
| 98 | Ga0068863_102758755 | 3300005841 | Unclassified | 500 |
| 99 | Ga0068858_100130044 | 3300005842 | Bacteria | 2360 |
| 100 | Ga0068858_102096783 | 3300005842 | Bacteria | 559 |
| 101 | Ga0068860_100152203 | 3300005843 | Bacteria | 2228 |
| 102 | Ga0068862_100192668 | 3300005844 | Bacteria | 1835 |
| 103 | Ga0081455_10017920 | 3300005937 | Bacteria | 6768 |
| 104 | Ga0081455_10248269 | 3300005937 | Bacteria | 1303 |
| 105 | Ga0081538_10000034 | 3300005981 | Bacteria | 120557 |
| 106 | Ga0081539_10001387 | 3300005985 | Bacteria | 41711 |
| 107 | Ga0075365_10008057 | 3300006038 | Bacteria | 5950 |
| 108 | Ga0075365_10020868 | 3300006038 | Bacteria | 4072 |
| 109 | Ga0075365_10070875 | 3300006038 | Bacteria | 2345 |
| 110 | Ga0075365_10679444 | 3300006038 | Bacteria | 727 |
| 111 | Ga0075365_10703749 | 3300006038 | Bacteria | 714 |
| 112 | Ga0075365_11068894 | 3300006038 | Bacteria | 568 |
| 113 | Ga0075365_11166064 | 3300006038 | Bacteria | 542 |
| 114 | Ga0075368_10246554 | 3300006042 | Bacteria | 763 |
| 115 | Ga0075368_10548280 | 3300006042 | Bacteria | 520 |
| 116 | Ga0075363_100016297 | 3300006048 | Bacteria | 3670 |
| 117 | Ga0075363_100048892 | 3300006048 | Bacteria | 2250 |
| 118 | Ga0075363_100123290 | 3300006048 | Bacteria | 1449 |
| 119 | Ga0075363_100167874 | 3300006048 | Bacteria | 1245 |
| 120 | Ga0075363_100332800 | 3300006048 | Bacteria | 885 |
| 121 | Ga0075363_100607847 | 3300006048 | Bacteria | 655 |
| 122 | Ga0075364_10032183 | 3300006051 | Bacteria | 3370 |
| 123 | Ga0075364_10125727 | 3300006051 | Bacteria | 1719 |
| 124 | Ga0075364_10146173 | 3300006051 | Bacteria | 1592 |
| 125 | Ga0075364_10188541 | 3300006051 | Bacteria | 1396 |
| 126 | Ga0075364_10202551 | 3300006051 | Bacteria | 1345 |
| 127 | Ga0075364_10304702 | 3300006051 | Bacteria | 1085 |
| 128 | Ga0075364_10517500 | 3300006051 | Bacteria | 816 |
| 129 | Ga0075364_10820870 | 3300006051 | Unclassified | 634 |
| 130 | Ga0070716_100115317 | 3300006173 | Bacteria | 1672 |
| 131 | Ga0075367_10064238 | 3300006178 | Bacteria | 2195 |
| 132 | Ga0075367_10083623 | 3300006178 | Bacteria | 1934 |
| 133 | Ga0075367_10181824 | 3300006178 | Bacteria | 1311 |
| 134 | Ga0075367_10664337 | 3300006178 | Bacteria | 663 |
| 135 | Ga0068871_100061386 | 3300006358 | Bacteria | 3070 |
| 136 | Ga0075430_100479094 | 3300006846 | Bacteria | 1027 |
| 137 | Ga0075433_10010741 | 3300006852 | Bacteria | 7364 |
| 138 | Ga0068865_100009350 | 3300006881 | Bacteria | 6073 |
| 139 | Ga0097620_100745738 | 3300006931 | Bacteria | 1068 |
| 140 | Ga0097620_102617496 | 3300006931 | Unclassified | 555 |
| 141 | Ga0097620_102823785 | 3300006931 | Bacteria | 533 |
| 142 | Ga0105244_10377939 | 3300009036 | Bacteria | 652 |
| 143 | Ga0105240_10386973 | 3300009093 | Bacteria | 1578 |
| 144 | Ga0105240_10666360 | 3300009093 | Bacteria | 1139 |
| 145 | Ga0105240_11383029 | 3300009093 | Bacteria | 740 |
| 146 | Ga0111539_10164631 | 3300009094 | Bacteria | 2593 |
| 147 | Ga0111539_11549256 | 3300009094 | Unclassified | 769 |
| 148 | Ga0105245_10014070 | 3300009098 | Bacteria | 6969 |
| 149 | Ga0105245_12043786 | 3300009098 | Archaea | 626 |
| 150 | Ga0105247_10045271 | 3300009101 | Bacteria | 2699 |
| 151 | Ga0105247_10561850 | 3300009101 | Bacteria | 840 |
| 152 | Ga0105243_10005110 | 3300009148 | Bacteria | 10296 |
| 153 | Ga0105243_10702326 | 3300009148 | Bacteria | 986 |
| 154 | Ga0105241_11649618 | 3300009174 | Bacteria | 621 |
| 155 | Ga0105242_10221747 | 3300009176 | Bacteria | 1690 |
| 156 | Ga0105248_10668591 | 3300009177 | Bacteria | 1172 |
| 157 | Ga0105248_12817424 | 3300009177 | Unclassified | 554 |
| 158 | Ga0105238_10000016 | 3300009551 | Bacteria | 236218 |
| 159 | Ga0105238_10333058 | 3300009551 | Bacteria | 1505 |
| 160 | Ga0105249_10000054 | 3300009553 | Bacteria | 162883 |
| 161 | Ga0105249_11260094 | 3300009553 | Bacteria | 811 |
| 162 | Ga0105249_13080808 | 3300009553 | Bacteria | 535 |
| 163 | Ga0099796_10266503 | 3300010159 | Bacteria | 716 |
| 164 | Ga0105239_10107435 | 3300010375 | Bacteria | 3092 |
| 165 | Ga0105239_10160569 | 3300010375 | Bacteria | 2511 |
| 166 | Ga0105246_10106248 | 3300011119 | Bacteria | 2053 |
| 167 | Ga0105246_10417416 | 3300011119 | Bacteria | 1119 |
| 168 | Ga0105246_11235258 | 3300011119 | Bacteria | 689 |
| 169 | Ga0157369_11307047 | 3300013105 | Bacteria | 739 |
| 170 | Ga0163162_11982905 | 3300013306 | Bacteria | 667 |
| 171 | Ga0157372_10414816 | 3300013307 | Bacteria | 1569 |
| 172 | Ga0157372_11635223 | 3300013307 | Bacteria | 741 |
| 173 | Ga0157375_10011718 | 3300013308 | Bacteria | 7750 |
| 174 | Ga0157375_12934149 | 3300013308 | Bacteria | 570 |
| 175 | Ga0163163_11572038 | 3300014325 | Bacteria | 719 |
| 176 | Ga0163163_11724678 | 3300014325 | Bacteria | 687 |
| 177 | Ga0163163_11879931 | 3300014325 | Unclassified | 659 |
| 178 | Ga0157380_10377504 | 3300014326 | Bacteria | 1337 |
| 179 | Ga0157380_11862098 | 3300014326 | Bacteria | 662 |
| 180 | Ga0157377_10010951 | 3300014745 | Bacteria | 4509 |
| 181 | Ga0157379_10017532 | 3300014968 | Bacteria | 6302 |
| 182 | Ga0157379_10019064 | 3300014968 | Bacteria | 6057 |
| 183 | Ga0157379_10713074 | 3300014968 | Bacteria | 942 |
| 184 | Ga0157379_11542306 | 3300014968 | Unclassified | 647 |
| 185 | Ga0163161_11556738 | 3300017792 | Bacteria | 582 |
| 186 | Ga0207642_10633627 | 3300025899 | Bacteria | 668 |
| 187 | Ga0207710_10026077 | 3300025900 | Bacteria | 2523 |
| 188 | Ga0207710_10184427 | 3300025900 | Bacteria | 1025 |
| 189 | Ga0207710_10540298 | 3300025900 | Bacteria | 607 |
| 190 | Ga0207688_10012452 | 3300025901 | Bacteria | 4628 |
| 191 | Ga0207680_10003987 | 3300025903 | Bacteria | 6975 |
| 192 | Ga0207680_10213958 | 3300025903 | Bacteria | 1319 |
| 193 | Ga0207680_10432596 | 3300025903 | Bacteria | 933 |
| 194 | Ga0207647_10103670 | 3300025904 | Bacteria | 1686 |
| 195 | Ga0207645_10168950 | 3300025907 | Bacteria | 1433 |
| 196 | Ga0207705_10019045 | 3300025909 | Bacteria | 4910 |
| 197 | Ga0207705_10035941 | 3300025909 | Bacteria | 3546 |
| 198 | Ga0207707_10114253 | 3300025912 | Bacteria | 2360 |
| 199 | Ga0207660_10213327 | 3300025917 | Bacteria | 1512 |
| 200 | Ga0207660_10387301 | 3300025917 | Bacteria | 1124 |
| 201 | Ga0207657_10001969 | 3300025919 | Bacteria | 22177 |
| 202 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 203 | Ga0207649_10061038 | 3300025920 | Bacteria | 2371 |
| 204 | Ga0207649_10134146 | 3300025920 | Bacteria | 1686 |
| 205 | Ga0207649_11683505 | 3300025920 | Bacteria | 502 |
| 206 | Ga0207652_10001670 | 3300025921 | Bacteria | 19427 |
| 207 | Ga0207652_10170366 | 3300025921 | Bacteria | 1954 |
| 208 | Ga0207681_10170726 | 3300025923 | Bacteria | 1648 |
| 209 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 210 | Ga0207694_10111639 | 3300025924 | Bacteria | 2175 |
| 211 | Ga0207650_11258382 | 3300025925 | Bacteria | 630 |
| 212 | Ga0207659_10017333 | 3300025926 | Bacteria | 4704 |
| 213 | Ga0207687_10053880 | 3300025927 | Bacteria | 2812 |
| 214 | Ga0207664_10956782 | 3300025929 | Bacteria | 768 |
| 215 | Ga0207644_10101551 | 3300025931 | Bacteria | 2162 |
| 216 | Ga0207690_10006166 | 3300025932 | Bacteria | 7100 |
| 217 | Ga0207690_11233393 | 3300025932 | Bacteria | 625 |
| 218 | Ga0207706_10000003 | 3300025933 | Bacteria | 345011 |
| 219 | Ga0207706_10026716 | 3300025933 | Bacteria | 5168 |
| 220 | Ga0207686_10054601 | 3300025934 | Bacteria | 2503 |
| 221 | Ga0207709_10006931 | 3300025935 | Bacteria | 6337 |
| 222 | Ga0207670_11405885 | 3300025936 | Bacteria | 592 |
| 223 | Ga0207669_10000010 | 3300025937 | Bacteria | 150070 |
| 224 | Ga0207669_10000475 | 3300025937 | Bacteria | 17506 |
| 225 | Ga0207669_10008523 | 3300025937 | Bacteria | 4820 |
| 226 | Ga0207704_10004361 | 3300025938 | Bacteria | 6470 |
| 227 | Ga0207665_10040308 | 3300025939 | Bacteria | 3115 |
| 228 | Ga0207691_10000095 | 3300025940 | Bacteria | 76860 |
| 229 | Ga0207691_10022999 | 3300025940 | Bacteria | 5871 |
| 230 | Ga0207711_10680059 | 3300025941 | Bacteria | 960 |
| 231 | Ga0207711_11699054 | 3300025941 | Unclassified | 575 |
| 232 | Ga0207689_10198651 | 3300025942 | Bacteria | 1655 |
| 233 | Ga0207661_10000666 | 3300025944 | Bacteria | 22202 |
| 234 | Ga0207661_10001606 | 3300025944 | Bacteria | 15376 |
| 235 | Ga0207661_10035852 | 3300025944 | Bacteria | 3868 |
| 236 | Ga0207661_10072408 | 3300025944 | Bacteria | 2819 |
| 237 | Ga0207661_10172133 | 3300025944 | Bacteria | 1885 |
| 238 | Ga0207661_10358845 | 3300025944 | Bacteria | 1316 |
| 239 | Ga0207679_10009210 | 3300025945 | Bacteria | 6313 |
| 240 | Ga0207679_10136725 | 3300025945 | Bacteria | 1974 |
| 241 | Ga0207679_11423370 | 3300025945 | Bacteria | 636 |
| 242 | Ga0207679_11900160 | 3300025945 | Bacteria | 543 |
| 243 | Ga0207667_10124115 | 3300025949 | Bacteria | 2660 |
| 244 | Ga0207651_10200198 | 3300025960 | Bacteria | 1600 |
| 245 | Ga0207712_11460808 | 3300025961 | Unclassified | 612 |
| 246 | Ga0207668_10074640 | 3300025972 | Bacteria | 2435 |
| 247 | Ga0207668_10108349 | 3300025972 | Bacteria | 2079 |
| 248 | Ga0207640_10315672 | 3300025981 | Bacteria | 1242 |
| 249 | Ga0207658_10011566 | 3300025986 | Bacteria | 6008 |
| 250 | Ga0207658_10048783 | 3300025986 | Bacteria | 3107 |
| 251 | Ga0207658_10502722 | 3300025986 | Unclassified | 1080 |
| 252 | Ga0207677_10079064 | 3300026023 | Bacteria | 2351 |
| 253 | Ga0207703_10293406 | 3300026035 | Bacteria | 1481 |
| 254 | Ga0207703_10524372 | 3300026035 | Bacteria | 1115 |
| 255 | Ga0207703_11317798 | 3300026035 | Bacteria | 694 |
| 256 | Ga0207639_10039552 | 3300026041 | Bacteria | 3515 |
| 257 | Ga0207639_10387112 | 3300026041 | Bacteria | 1257 |
| 258 | Ga0207678_10001730 | 3300026067 | Bacteria | 19988 |
| 259 | Ga0207678_10012092 | 3300026067 | Bacteria | 7578 |
| 260 | Ga0207708_10003752 | 3300026075 | Bacteria | 11196 |
| 261 | Ga0207708_10126034 | 3300026075 | Bacteria | 1999 |
| 262 | Ga0207708_11147744 | 3300026075 | Bacteria | 678 |
| 263 | Ga0207641_10000436 | 3300026088 | Bacteria | 47925 |
| 264 | Ga0207641_10085782 | 3300026088 | Bacteria | 2744 |
| 265 | Ga0207641_11055967 | 3300026088 | Bacteria | 810 |
| 266 | Ga0207648_10292820 | 3300026089 | Bacteria | 1458 |
| 267 | Ga0207676_10000025 | 3300026095 | Bacteria | 261714 |
| 268 | Ga0207676_12039162 | 3300026095 | Bacteria | 572 |
| 269 | Ga0207674_10136991 | 3300026116 | Bacteria | 2409 |
| 270 | Ga0207675_100485618 | 3300026118 | Bacteria | 1228 |
| 271 | Ga0207683_10656039 | 3300026121 | Bacteria | 972 |
| 272 | Ga0207683_10914525 | 3300026121 | Bacteria | 815 |
| 273 | Ga0207683_10982314 | 3300026121 | Bacteria | 784 |
| 274 | Ga0207698_10009935 | 3300026142 | Bacteria | 6087 |
| 275 | Ga0207698_10017583 | 3300026142 | Bacteria | 4857 |
| 276 | Ga0207428_10219707 | 3300027907 | Bacteria | 1425 |
| 277 | Ga0268266_10000422 | 3300028379 | Bacteria | 64158 |
| 278 | Ga0268266_10018593 | 3300028379 | Bacteria | 5922 |
| 279 | Ga0268266_10333384 | 3300028379 | Bacteria | 1422 |
| 280 | Ga0268266_10353696 | 3300028379 | Bacteria | 1381 |
| 281 | Ga0268266_11439928 | 3300028379 | Bacteria | 664 |
| 282 | Ga0268265_10283975 | 3300028380 | Bacteria | 1482 |
| 283 | Ga0268264_10227112 | 3300028381 | Bacteria | 1722 |
| 284 | Ga0268264_10361956 | 3300028381 | Bacteria | 1384 |
| 285 | Ga0265336_10117333 | 3300028666 | Bacteria | 793 |
| 286 | Ga0307408_101295541 | 3300031548 | Bacteria | 683 |
| 287 | Ga0316576_10003110 | 3300031727 | Bacteria | 9678 |
| 288 | Ga0316576_10819755 | 3300031727 | Unclassified | 669 |
| 289 | Ga0316578_10064066 | 3300031728 | Bacteria | 2169 |
| 290 | Ga0316578_10837317 | 3300031728 | Unclassified | 532 |
| 291 | Ga0307405_10760032 | 3300031731 | Bacteria | 808 |
| 292 | Ga0307413_10667263 | 3300031824 | Bacteria | 860 |
| 293 | Ga0307410_10092283 | 3300031852 | Bacteria | 2152 |
| 294 | Ga0307406_10144983 | 3300031901 | Bacteria | 1686 |
| 295 | Ga0307406_10991375 | 3300031901 | Bacteria | 720 |
| 296 | Ga0307406_11247738 | 3300031901 | Bacteria | 647 |
| 297 | Ga0307412_12078929 | 3300031911 | Bacteria | 527 |
| 298 | Ga0307409_100260999 | 3300031995 | Bacteria | 1590 |
| 299 | Ga0307416_100058138 | 3300032002 | Bacteria | 3133 |
| 300 | Ga0307416_100304174 | 3300032002 | Bacteria | 1587 |
| 301 | Ga0307416_100612735 | 3300032002 | Bacteria | 1170 |
| 302 | Ga0307411_10476037 | 3300032005 | Bacteria | 1050 |
| 303 | Ga0307415_100073325 | 3300032126 | Bacteria | 2415 |
| 304 | Ga0307415_102075585 | 3300032126 | Bacteria | 555 |
| 305 | Ga0316585_10222397 | 3300032137 | Bacteria | 625 |
| 306 | Ga0316574_0183892 | 3300035398 | Bacteria | 1344 |
| 307 | Ga0316574_0904020 | 3300035398 | Bacteria | 534 |
| 308 | Ga0316582_0816423 | 3300036647 | Bacteria | 639 |
| 309 | Ga0316584_0088082 | 3300036712 | Bacteria | 2324 |
| 310 | Ga0316584_0091236 | 3300036712 | Bacteria | 2281 |
| 311 | Ga0316584_0417167 | 3300036712 | Bacteria | 954 |
| 312 | Ga0395899_0461832 | 3300037312 | Bacteria | 830 |
| 313 | Ga0395898_0376567 | 3300037466 | Bacteria | 1354 |
| 314 | Ga0395905_0293159 | 3300037471 | Bacteria | 1514 |
| 315 | Ga0436364_1069239 | 3300037853 | Bacteria | 598 |
| 316 | Ga0395901_0567820 | 3300038443 | Bacteria | 1148 |
| 317 | Ga0395901_0787426 | 3300038443 | Bacteria | 941 |
| 318 | Ga0451791_0016531 | 3300041451 | Bacteria | 806 |
| 319 | Ga0451802_1111570 | 3300041460 | Bacteria | 720 |
| 320 | Ga0451807_1603377 | 3300041486 | Bacteria | 2158 |
| 321 | Ga0451837_0767587 | 3300041494 | Bacteria | 1463 |
| 322 | Ga0451853_2552138 | 3300041512 | Unclassified | 564 |
| 323 | Ga0451853_3962859 | 3300041512 | Bacteria | 2045 |
| 324 | Ga0450911_034913 | 3300042115 | Bacteria | 652 |
| 325 | Ga0466963_0000033 | 3300044694 | Bacteria | 45230 |
| 326 | Ga0466967_2383287 | 3300045976 | Unclassified | 525 |
| 327 | Ga0495592_0720553 | 3300046454 | Unclassified | 598 |
| 328 | Ga0495592_0830225 | 3300046454 | Unclassified | 547 |
| 329 | Ga0495603_0003650 | 3300046455 | Bacteria | 9158 |
| 330 | Ga0495629_0000489 | 3300046459 | Bacteria | 33145 |
| 331 | Ga0495629_0188950 | 3300046459 | Bacteria | 1426 |
| 332 | Ga0495629_0316513 | 3300046459 | Bacteria | 1067 |
| 333 | Ga0495641_0010101 | 3300046461 | Bacteria | 5527 |
| 334 | Ga0495653_0056155 | 3300046463 | Bacteria | 3002 |
| 335 | Ga0495653_0759289 | 3300046463 | Unclassified | 585 |
| 336 | Ga0495662_0279284 | 3300046476 | Bacteria | 822 |
| 337 | Ga0495596_0412129 | 3300046500 | Bacteria | 527 |
| 338 | Ga0495606_0000550 | 3300046507 | Bacteria | 60050 |
| 339 | Ga0495616_0430910 | 3300046513 | Bacteria | 537 |
| 340 | Ga0495618_0000053 | 3300046514 | Bacteria | 84115 |
| 341 | Ga0495620_0000782 | 3300046515 | Bacteria | 19484 |
| 342 | Ga0495628_0000628 | 3300046516 | Bacteria | 32247 |
| 343 | Ga0495628_0124881 | 3300046516 | Bacteria | 1972 |
| 344 | Ga0495628_0147720 | 3300046516 | Bacteria | 1791 |
| 345 | Ga0495630_0000599 | 3300046517 | Bacteria | 26251 |
| 346 | Ga0495630_0062591 | 3300046517 | Bacteria | 2795 |
| 347 | Ga0495630_0580467 | 3300046517 | Bacteria | 859 |
| 348 | Ga0495630_0600846 | 3300046517 | Bacteria | 843 |
| 349 | Ga0495632_0039815 | 3300046519 | Bacteria | 2370 |
| 350 | Ga0495644_0004542 | 3300046523 | Bacteria | 5455 |
| 351 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 352 | Ga0495652_0450761 | 3300046529 | Bacteria | 901 |
| 353 | Ga0495640_0844599 | 3300046533 | Bacteria | 544 |
| 354 | Ga0495586_0000500 | 3300046535 | Bacteria | 23110 |
| 355 | Ga0495587_0403700 | 3300046536 | Bacteria | 759 |
| 356 | Ga0495598_0000588 | 3300046537 | Bacteria | 6867 |
| 357 | Ga0495621_0006343 | 3300046539 | Bacteria | 3446 |
| 358 | Ga0495667_0000109 | 3300046559 | Bacteria | 59985 |
| 359 | Ga0495667_0273805 | 3300046559 | Bacteria | 1072 |
| 360 | Ga0495634_0005960 | 3300046642 | Bacteria | 9311 |
| 361 | Ga0495634_0360501 | 3300046642 | Bacteria | 869 |
| 362 | Ga0495634_0875243 | 3300046642 | Unclassified | 509 |
| 363 | Ga0495625_0000029 | 3300046660 | Bacteria | 244646 |
| 364 | Ga0495635_0577720 | 3300046663 | Bacteria | 735 |
| 365 | Ga0495635_0683226 | 3300046663 | Unclassified | 666 |
| 366 | Ga0495657_0097308 | 3300046675 | Bacteria | 1879 |
| 367 | Ga0495599_0431712 | 3300046678 | Bacteria | 782 |
| 368 | Ga0495646_0536753 | 3300046680 | Bacteria | 598 |
| 369 | Ga0495647_0000002 | 3300046681 | Bacteria | 174959 |
| 370 | Ga0495669_0015192 | 3300046684 | Bacteria | 3295 |
| 371 | Ga0495613_0000042 | 3300046689 | Bacteria | 130403 |
| 372 | Ga0495613_0778832 | 3300046689 | Bacteria | 625 |
| 373 | Ga0495670_0039028 | 3300046691 | Bacteria | 2368 |
| 374 | Ga0495589_0356352 | 3300046794 | Bacteria | 674 |
| 375 | Ga0495600_0000922 | 3300046809 | Bacteria | 15759 |
| 376 | Ga0495600_0511662 | 3300046809 | Bacteria | 737 |
| 377 | Ga0495600_0727324 | 3300046809 | Unclassified | 595 |
| 378 | Ga0495604_0000255 | 3300047317 | Bacteria | 47375 |
| 379 | Ga0495674_0172893 | 3300047319 | Bacteria | 1802 |
| 380 | Ga0495674_1181260 | 3300047319 | Bacteria | 579 |
| 381 | Ga0495672_0463218 | 3300047320 | Bacteria | 569 |
| 382 | Ga0495676_0302103 | 3300047321 | Bacteria | 1079 |
| 383 | Ga0495676_0599892 | 3300047321 | Bacteria | 717 |
| 384 | Ga0495676_0803760 | 3300047321 | Bacteria | 605 |
| 385 | Ga0495680_0001999 | 3300047322 | Bacteria | 21403 |
| 386 | Ga0495680_0285043 | 3300047322 | Bacteria | 1163 |
| 387 | Ga0495680_0501511 | 3300047322 | Bacteria | 824 |
| 388 | Ga0495679_011199 | 3300047446 | Bacteria | 3477 |
| 389 | Ga0495684_0133639 | 3300047471 | Bacteria | 1862 |
| 390 | Ga0495686_0198171 | 3300047472 | Bacteria | 1154 |
| 391 | Ga0495602_0003237 | 3300048088 | Bacteria | 16812 |
| 392 | Ga0496100_0189085 | 3300048903 | Bacteria | 1494 |
| 393 | Ga0496100_1501358 | 3300048903 | Archaea | 532 |
| 394 | Ga0496101_0108961 | 3300048904 | Bacteria | 2083 |
| 395 | Ga0496101_0113061 | 3300048904 | Bacteria | 2046 |
| 396 | Ga0496102_0038034 | 3300048905 | Bacteria | 4341 |
| 397 | Ga0496102_1722469 | 3300048905 | Bacteria | 544 |
| 398 | Ga0496103_0231951 | 3300048906 | Bacteria | 1187 |
| 399 | Ga0496104_0014119 | 3300048907 | Bacteria | 7210 |
| 400 | Ga0496105_0005224 | 3300048908 | Bacteria | 9841 |
| 401 | Ga0496106_0032804 | 3300048909 | Bacteria | 3872 |
| 402 | Ga0496107_0026865 | 3300048910 | Bacteria | 4085 |
| 403 | Ga0496107_0050049 | 3300048910 | Bacteria | 3012 |
| 404 | Ga0496107_0471312 | 3300048910 | Bacteria | 932 |
| 405 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 406 | Ga0496108_0030176 | 3300048911 | Bacteria | 4493 |
| 407 | Ga0496108_0059767 | 3300048911 | Bacteria | 3205 |
| 408 | Ga0496109_0000011 | 3300048912 | Bacteria | 234908 |
| 409 | Ga0496109_0000031 | 3300048912 | Bacteria | 163998 |
| 410 | Ga0496109_0000870 | 3300048912 | Bacteria | 25155 |
| 411 | Ga0496109_0784271 | 3300048912 | Unclassified | 891 |
| 412 | Ga0496109_1225261 | 3300048912 | Unclassified | 687 |
| 413 | Ga0496110_0063783 | 3300048913 | Bacteria | 3256 |
| 414 | Ga0496110_0805481 | 3300048913 | Unclassified | 844 |
| 415 | Ga0496110_0927459 | 3300048913 | Bacteria | 777 |
| 416 | Ga0496110_1345665 | 3300048913 | Bacteria | 623 |
| 417 | Ga0496111_0009546 | 3300048914 | Bacteria | 6484 |
| 418 | Ga0496111_0084449 | 3300048914 | Bacteria | 2321 |
| 419 | Ga0496111_0195835 | 3300048914 | Bacteria | 1502 |
| 420 | Ga0496111_0261394 | 3300048914 | Bacteria | 1284 |
| 421 | Ga0496113_0024494 | 3300048916 | Bacteria | 4290 |
| 422 | Ga0496114_0139373 | 3300048917 | Bacteria | 2099 |
| 423 | Ga0496114_0539560 | 3300048917 | Bacteria | 1031 |
| 424 | Ga0496115_0588877 | 3300048918 | Bacteria | 885 |
| 425 | Ga0496117_0002711 | 3300048920 | Bacteria | 21828 |
| 426 | Ga0496118_0001277 | 3300048921 | Bacteria | 38534 |
| 427 | Ga0496118_0348427 | 3300048921 | Bacteria | 790 |
| 428 | Ga0496118_0380061 | 3300048921 | Bacteria | 741 |
| 429 | Ga0496120_0015354 | 3300048923 | Bacteria | 5057 |
| 430 | Ga0496120_0192192 | 3300048923 | Unclassified | 994 |
| 431 | Ga0496121_0015047 | 3300048924 | Bacteria | 8142 |
| 432 | Ga0496121_0196325 | 3300048924 | Bacteria | 1442 |
| 433 | Ga0496124_0039181 | 3300048927 | Bacteria | 4110 |
| 434 | Ga0496124_0213778 | 3300048927 | Bacteria | 1457 |
| 435 | Ga0496125_0410968 | 3300048928 | Bacteria | 788 |
| 436 | Ga0496125_0569553 | 3300048928 | Bacteria | 624 |
| 437 | Ga0496126_0067719 | 3300048929 | Bacteria | 3189 |
| 438 | Ga0496126_0127017 | 3300048929 | Bacteria | 2206 |
| 439 | Ga0496126_0434541 | 3300048929 | Bacteria | 1059 |
| 440 | Ga0496126_1023474 | 3300048929 | Bacteria | 618 |
| 441 | Ga0501031_0006300 | 3300049568 | Bacteria | 7734 |
| 442 | Ga0501032_0008990 | 3300049569 | Bacteria | 7266 |
| 443 | Ga0501033_0008846 | 3300049570 | Bacteria | 7778 |
| 444 | Ga0501034_0013871 | 3300049571 | Bacteria | 8295 |
| 445 | Ga0501034_0059301 | 3300049571 | Bacteria | 3844 |
| 446 | Ga0501034_0694231 | 3300049571 | Bacteria | 917 |
| 447 | Ga0501036_0067783 | 3300049572 | Bacteria | 3019 |
| 448 | Ga0501037_0000525 | 3300049573 | Bacteria | 30723 |
| 449 | Ga0501038_0012367 | 3300049574 | Bacteria | 7800 |
| 450 | Ga0501039_0092346 | 3300049575 | Bacteria | 2359 |
| 451 | Ga0501039_1026433 | 3300049575 | Bacteria | 640 |
| 452 | Ga0501039_1235581 | 3300049575 | Unclassified | 577 |
| 453 | Ga0501040_0084637 | 3300049576 | Bacteria | 2200 |
| 454 | Ga0501040_0727388 | 3300049576 | Unclassified | 718 |
| 455 | Ga0501041_0400861 | 3300049577 | Bacteria | 869 |
| 456 | Ga0501042_0012990 | 3300049578 | Bacteria | 5658 |
| 457 | Ga0501042_0044138 | 3300049578 | Bacteria | 3176 |
| 458 | Ga0501042_0066461 | 3300049578 | Bacteria | 2577 |
| 459 | Ga0501042_0591487 | 3300049578 | Bacteria | 807 |
| 460 | Ga0501043_0009296 | 3300049579 | Bacteria | 7723 |
| 461 | Ga0501043_0304435 | 3300049579 | Bacteria | 1217 |
| 462 | Ga0501043_0494608 | 3300049579 | Unclassified | 914 |
| 463 | Ga0501046_0010383 | 3300049580 | Bacteria | 8001 |
| 464 | Ga0501047_0001574 | 3300049581 | Bacteria | 22284 |
| 465 | Ga0501047_0049098 | 3300049581 | Bacteria | 4074 |
| 466 | Ga0501047_1295068 | 3300049581 | Bacteria | 543 |
| 467 | Ga0501048_0008006 | 3300049582 | Bacteria | 8000 |
| 468 | Ga0501048_0130907 | 3300049582 | Bacteria | 1774 |
| 469 | Ga0501048_0161107 | 3300049582 | Bacteria | 1588 |
| 470 | Ga0501048_1359790 | 3300049582 | Bacteria | 510 |
| 471 | Ga0501067_0036828 | 3300049583 | Bacteria | 2716 |
| 472 | Ga0501067_0187431 | 3300049583 | Bacteria | 1152 |
| 473 | Ga0501067_0514880 | 3300049583 | Unclassified | 669 |
| 474 | Ga0501068_0147497 | 3300049584 | Bacteria | 1477 |
| 475 | Ga0501068_0172704 | 3300049584 | Bacteria | 1365 |
| 476 | Ga0501068_0264819 | 3300049584 | Bacteria | 1097 |
| 477 | Ga0501068_0304563 | 3300049584 | Bacteria | 1020 |
| 478 | Ga0501068_0997002 | 3300049584 | Bacteria | 553 |
| 479 | Ga0501069_0029178 | 3300049585 | Bacteria | 3027 |
| 480 | Ga0501069_0047338 | 3300049585 | Bacteria | 2387 |
| 481 | Ga0501069_0092800 | 3300049585 | Bacteria | 1708 |
| 482 | Ga0501069_0264043 | 3300049585 | Bacteria | 1005 |
| 483 | Ga0501070_0004676 | 3300049586 | Bacteria | 11728 |
| 484 | Ga0501070_0010080 | 3300049586 | Bacteria | 7995 |
| 485 | Ga0501070_0018917 | 3300049586 | Bacteria | 5778 |
| 486 | Ga0501070_0060100 | 3300049586 | Bacteria | 3150 |
| 487 | Ga0501070_0092725 | 3300049586 | Bacteria | 2499 |
| 488 | Ga0501070_0189759 | 3300049586 | Bacteria | 1689 |
| 489 | Ga0501070_0841871 | 3300049586 | Bacteria | 718 |
| 490 | Ga0501070_0984618 | 3300049586 | Bacteria | 654 |
| 491 | Ga0501071_0197812 | 3300049587 | Bacteria | 1509 |
| 492 | Ga0501071_0430007 | 3300049587 | Bacteria | 1009 |
| 493 | Ga0501071_0929582 | 3300049587 | Bacteria | 671 |
| 494 | Ga0501071_1267689 | 3300049587 | Bacteria | 569 |
| 495 | Ga0501072_0018431 | 3300049588 | Bacteria | 5375 |
| 496 | Ga0501072_0230061 | 3300049588 | Bacteria | 1477 |
| 497 | Ga0501072_0247691 | 3300049588 | Bacteria | 1419 |
| 498 | Ga0501072_0439462 | 3300049588 | Bacteria | 1033 |
| 499 | Ga0501073_0034514 | 3300049589 | Bacteria | 3600 |
| 500 | Ga0501073_0134353 | 3300049589 | Bacteria | 1714 |
| 501 | Ga0501074_0013122 | 3300049590 | Bacteria | 6023 |
| 502 | Ga0501074_0015911 | 3300049590 | Bacteria | 5471 |
| 503 | Ga0501074_0153190 | 3300049590 | Bacteria | 1647 |
| 504 | Ga0501074_0229951 | 3300049590 | Bacteria | 1320 |
| 505 | Ga0501074_0914190 | 3300049590 | Unclassified | 618 |
| 506 | Ga0501075_0017368 | 3300049591 | Bacteria | 5198 |
| 507 | Ga0501075_0180639 | 3300049591 | Bacteria | 1610 |
| 508 | Ga0501076_0117122 | 3300049592 | Bacteria | 2156 |
| 509 | Ga0501076_0288313 | 3300049592 | Bacteria | 1345 |
| 510 | Ga0501076_1025091 | 3300049592 | Bacteria | 680 |
| 511 | Ga0501077_0748187 | 3300049593 | Bacteria | 628 |
| 512 | Ga0501079_0302078 | 3300049741 | Bacteria | 1252 |
| 513 | Ga0501079_0455468 | 3300049741 | Bacteria | 1005 |
| 514 | Ga0501079_0790074 | 3300049741 | Bacteria | 747 |
| 515 | Ga0501079_1122569 | 3300049741 | Bacteria | 619 |
| 516 | Ga0501080_0111542 | 3300049742 | Bacteria | 2535 |
| 517 | Ga0501080_0135321 | 3300049742 | Bacteria | 2280 |
| 518 | Ga0501080_0379129 | 3300049742 | Bacteria | 1274 |
| 519 | Ga0501080_0381272 | 3300049742 | Bacteria | 1270 |
| 520 | Ga0501081_0139057 | 3300049743 | Bacteria | 1740 |
| 521 | Ga0501083_0007552 | 3300049744 | Bacteria | 7704 |
| 522 | Ga0501083_0018273 | 3300049744 | Bacteria | 4887 |
| 523 | Ga0501083_0799840 | 3300049744 | Bacteria | 613 |
| 524 | Ga0501035_0001973 | 3300049822 | Bacteria | 20540 |
| 525 | Ga0501035_0841852 | 3300049822 | Bacteria | 730 |
| 526 | Ga0501044_0016353 | 3300049823 | Bacteria | 7965 |
| 527 | Ga0501044_0049370 | 3300049823 | Bacteria | 4344 |
| 528 | Ga0501045_0092091 | 3300049824 | Bacteria | 2242 |
| 529 | Ga0501045_0224786 | 3300049824 | Bacteria | 1397 |
| 530 | nmdc:mga03n38_10548_c1 | 3300050490 | Bacteria | 3405 |
| 531 | nmdc:mga03n38_47681_c2 | 3300050490 | Bacteria | 1432 |
| 532 | nmdc:mga03n38_61430_c1 | 3300050490 | Bacteria | 1711 |
| 533 | nmdc:mga00v17_25448_c1 | 3300050491 | Bacteria | 3440 |
| 534 | nmdc:mga00v17_280485_c1 | 3300050491 | Bacteria | 1082 |
| 535 | nmdc:mga00v17_389347_c1 | 3300050491 | Bacteria | 906 |
| 536 | nmdc:mga00v17_444249_c1 | 3300050491 | Unclassified | 842 |
| 537 | nmdc:mga00v17_592550_c1 | 3300050491 | Bacteria | 715 |
| 538 | nmdc:mga00v17_624303_c1 | 3300050491 | Unclassified | 694 |
| 539 | nmdc:mga00v17_845273_c1 | 3300050491 | Bacteria | 581 |
| 540 | nmdc:mga00v17_996704_c1 | 3300050491 | Bacteria | 527 |
| 541 | nmdc:mga0yw44_269775_c1 | 3300050492 | Bacteria | 1136 |
| 542 | nmdc:mga0yw44_45033_c1 | 3300050492 | Bacteria | 2643 |
| 543 | nmdc:mga0yw44_6820_c1 | 3300050492 | Bacteria | 5552 |
| 544 | nmdc:mga0yw44_836809_c1 | 3300050492 | Unclassified | 625 |
| 545 | nmdc:mga0yw44_859794_c1 | 3300050492 | Unclassified | 615 |
| 546 | nmdc:mga0yw44_975110_c1 | 3300050492 | Bacteria | 574 |
| 547 | nmdc:mga06z11_207518_c1 | 3300050494 | Bacteria | 1140 |
| 548 | nmdc:mga06z11_415277_c1 | 3300050494 | Bacteria | 811 |
| 549 | nmdc:mga06z11_570550_c1 | 3300050494 | Bacteria | 688 |
| 550 | nmdc:mga06z11_710486_c1 | 3300050494 | Bacteria | 612 |
| 551 | nmdc:mga04h51_194572_c1 | 3300050495 | Bacteria | 794 |
| 552 | nmdc:mga09592_892729_c1 | 3300050508 | Bacteria | 747 |
| 553 | nmdc:mga0qj67_86299_c1 | 3300050509 | Bacteria | 2518 |
| 554 | nmdc:mga08y16_149057_c1 | 3300050511 | Bacteria | 2432 |
| 555 | nmdc:mga08x19_792644_c1 | 3300050514 | Bacteria | 673 |
| 556 | nmdc:mga0a205_2672_c1 | 3300050515 | Bacteria | 15769 |
| 557 | nmdc:mga0a205_352_c1 | 3300050515 | Bacteria | 34822 |
| 558 | Ga0495601_0000117 | 3300053077 | Bacteria | 43844 |
| 559 | Ga0495601_0094742 | 3300053077 | Bacteria | 1924 |
| 560 | Ga0495601_0240011 | 3300053077 | Unclassified | 1183 |
| 561 | Ga0495601_0306246 | 3300053077 | Bacteria | 1035 |
| 562 | Ga0495612_0002827 | 3300053078 | Bacteria | 7181 |
| 563 | Ga0495612_0007001 | 3300053078 | Bacteria | 4613 |
| 564 | Ga0495655_0171405 | 3300053083 | Bacteria | 695 |
| 565 | Ga0495595_0663927 | 3300053084 | Bacteria | 534 |
| 566 | Ga0495619_0011185 | 3300053085 | Bacteria | 5645 |
| 567 | Ga0495619_0157569 | 3300053085 | Bacteria | 1567 |
| 568 | Ga0500644_0068133 | 3300053088 | Bacteria | 1275 |
| 569 | Ga0500658_0016814 | 3300053134 | Bacteria | 2728 |
| 570 | Ga0501084_0271515 | 3300054114 | Bacteria | 1432 |
| 571 | Ga0501084_0589316 | 3300054114 | Bacteria | 939 |
| 572 | Ga0501084_1097573 | 3300054114 | Bacteria | 668 |
| 573 | Ga0501082_0011154 | 3300060353 | Bacteria | 7725 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005618 | Ga0068864_100000023 | Ga0068864_100000023116 | 66 |
| 2 | 3300025961 | Ga0207712_11460808 | Ga0207712_114608082 | 66 |
| 3 | 3300026095 | Ga0207676_10000025 | Ga0207676_10000025162 | 66 |
| 4 | 3300005338 | Ga0068868_100939604 | Ga0068868_1009396041 | 67 |
| 5 | 3300006038 | Ga0075365_10008057 | Ga0075365_100080572 | 67 |
| 6 | 3300006038 | Ga0075365_11068894 | Ga0075365_110688941 | 67 |
| 7 | 3300006048 | Ga0075363_100607847 | Ga0075363_1006078472 | 67 |
| 8 | 3300006051 | Ga0075364_10032183 | Ga0075364_100321833 | 67 |
| 9 | 3300006051 | Ga0075364_10188541 | Ga0075364_101885412 | 67 |
| 10 | 3300006051 | Ga0075364_10304702 | Ga0075364_103047022 | 67 |
| 11 | 3300006178 | Ga0075367_10064238 | Ga0075367_100642382 | 67 |
| 12 | 3300006846 | Ga0075430_100479094 | Ga0075430_1004790941 | 67 |
| 13 | 3300014968 | Ga0157379_11542306 | Ga0157379_115423062 | 67 |
| 14 | 3300025937 | Ga0207669_10000010 | Ga0207669_1000001027 | 67 |
| 15 | 3300026121 | Ga0207683_10914525 | Ga0207683_109145252 | 67 |
| 16 | 3300026121 | Ga0207683_10982314 | Ga0207683_109823141 | 67 |
| 17 | 3300028666 | Ga0265336_10117333 | Ga0265336_101173333 | 67 |
| 18 | 3300046533 | Ga0495640_0844599 | Ga0495640_0844599_21_230 | 67 |
| 19 | 3300050491 | nmdc:mga00v17_592550_c1 | nmdc:mga00v17_592550_c1_487_696 | 67 |
| 20 | 3300050492 | nmdc:mga0yw44_45033_c1 | nmdc:mga0yw44_45033_c1_1860_2063 | 67 |
| 21 | 3300050494 | nmdc:mga06z11_570550_c1 | nmdc:mga06z11_570550_c1_339_542 | 67 |
| 22 | 3300005547 | Ga0070693_100002496 | Ga0070693_1000024966 | 73 |
| 23 | 3300006048 | Ga0075363_100332800 | Ga0075363_1003328002 | 73 |
| 24 | 3300005329 | Ga0070683_100510277 | Ga0070683_1005102773 | 74 |
| 25 | 3300005356 | Ga0070674_102088450 | Ga0070674_1020884502 | 74 |
| 26 | 3300006038 | Ga0075365_10070875 | Ga0075365_100708752 | 74 |
| 27 | 3300006038 | Ga0075365_10679444 | Ga0075365_106794442 | 74 |
| 28 | 3300006042 | Ga0075368_10246554 | Ga0075368_102465542 | 74 |
| 29 | 3300006042 | Ga0075368_10548280 | Ga0075368_105482802 | 74 |
| 30 | 3300006048 | Ga0075363_100123290 | Ga0075363_1001232902 | 74 |
| 31 | 3300006051 | Ga0075364_10125727 | Ga0075364_101257272 | 74 |
| 32 | 3300006051 | Ga0075364_10202551 | Ga0075364_102025513 | 74 |
| 33 | 3300006051 | Ga0075364_10517500 | Ga0075364_105175001 | 74 |
| 34 | 3300006051 | Ga0075364_10820870 | Ga0075364_108208701 | 74 |
| 35 | 3300006178 | Ga0075367_10664337 | Ga0075367_106643372 | 74 |
| 36 | 3300006358 | Ga0068871_100061386 | Ga0068871_1000613864 | 74 |
| 37 | 3300025944 | Ga0207661_10358845 | Ga0207661_103588453 | 74 |
| 38 | 3300025945 | Ga0207679_10136725 | Ga0207679_101367253 | 74 |
| 39 | 3300031727 | Ga0316576_10003110 | Ga0316576_100031105 | 74 |
| 40 | 3300031728 | Ga0316578_10837317 | Ga0316578_108373172 | 74 |
| 41 | 3300032137 | Ga0316585_10222397 | Ga0316585_102223972 | 74 |
| 42 | 3300035398 | Ga0316574_0183892 | Ga0316574_0183892_445_675 | 74 |
| 43 | 3300036647 | Ga0316582_0816423 | Ga0316582_0816423_11_241 | 74 |
| 44 | 3300036712 | Ga0316584_0088082 | Ga0316584_0088082_644_874 | 74 |
| 45 | 3300041451 | Ga0451791_0016531 | Ga0451791_0016531_255_485 | 74 |
| 46 | 3300046476 | Ga0495662_0279284 | Ga0495662_0279284_74_301 | 74 |
| 47 | 3300046642 | Ga0495634_0005960 | Ga0495634_0005960_1160_1387 | 74 |
| 48 | 3300050491 | nmdc:mga00v17_280485_c1 | nmdc:mga00v17_280485_c1_605_835 | 74 |
| 49 | 3300050491 | nmdc:mga00v17_389347_c1 | nmdc:mga00v17_389347_c1_510_740 | 74 |
| 50 | 3300050491 | nmdc:mga00v17_444249_c1 | nmdc:mga00v17_444249_c1_446_676 | 74 |
| 51 | 3300050491 | nmdc:mga00v17_624303_c1 | nmdc:mga00v17_624303_c1_82_312 | 74 |
| 52 | 3300050491 | nmdc:mga00v17_845273_c1 | nmdc:mga00v17_845273_c1_155_385 | 74 |
| 53 | 3300050492 | nmdc:mga0yw44_269775_c1 | nmdc:mga0yw44_269775_c1_440_670 | 74 |
| 54 | 3300050492 | nmdc:mga0yw44_836809_c1 | nmdc:mga0yw44_836809_c1_267_497 | 74 |
| 55 | 3300050492 | nmdc:mga0yw44_859794_c1 | nmdc:mga0yw44_859794_c1_233_463 | 74 |
| 56 | 3300050492 | nmdc:mga0yw44_975110_c1 | nmdc:mga0yw44_975110_c1_150_380 | 74 |
| 57 | 3300050494 | nmdc:mga06z11_710486_c1 | nmdc:mga06z11_710486_c1_236_466 | 74 |
| 58 | 3300050495 | nmdc:mga04h51_194572_c1 | nmdc:mga04h51_194572_c1_336_566 | 74 |
| 59 | 3300053088 | Ga0500644_0068133 | Ga0500644_0068133_71_298 | 74 |
| 60 | 3300002074 | JGI24748J21848_1000232 | JGI24748J21848_10002323 | 75 |
| 61 | 3300002239 | JGI24034J26672_10000252 | JGI24034J26672_100002524 | 75 |
| 62 | 3300002244 | JGI24742J22300_10004606 | JGI24742J22300_100046064 | 75 |
| 63 | 3300005329 | Ga0070683_100098697 | Ga0070683_1000986972 | 75 |
| 64 | 3300005335 | Ga0070666_10537017 | Ga0070666_105370172 | 75 |
| 65 | 3300005336 | Ga0070680_100386624 | Ga0070680_1003866242 | 75 |
| 66 | 3300005337 | Ga0070682_100875491 | Ga0070682_1008754912 | 75 |
| 67 | 3300005355 | Ga0070671_100156215 | Ga0070671_1001562153 | 75 |
| 68 | 3300005367 | Ga0070667_100022286 | Ga0070667_1000222869 | 75 |
| 69 | 3300005367 | Ga0070667_100088069 | Ga0070667_1000880693 | 75 |
| 70 | 3300005367 | Ga0070667_100437104 | Ga0070667_1004371043 | 75 |
| 71 | 3300005367 | Ga0070667_100902388 | Ga0070667_1009023882 | 75 |
| 72 | 3300005455 | Ga0070663_100008130 | Ga0070663_1000081305 | 75 |
| 73 | 3300005455 | Ga0070663_101999856 | Ga0070663_1019998562 | 75 |
| 74 | 3300005458 | Ga0070681_10081424 | Ga0070681_100814244 | 75 |
| 75 | 3300005535 | Ga0070684_100580022 | Ga0070684_1005800222 | 75 |
| 76 | 3300005539 | Ga0068853_100565379 | Ga0068853_1005653793 | 75 |
| 77 | 3300005545 | Ga0070695_100496787 | Ga0070695_1004967872 | 75 |
| 78 | 3300005548 | Ga0070665_100236950 | Ga0070665_1002369502 | 75 |
| 79 | 3300005563 | Ga0068855_100992125 | Ga0068855_1009921252 | 75 |
| 80 | 3300005617 | Ga0068859_102618168 | Ga0068859_1026181682 | 75 |
| 81 | 3300005841 | Ga0068863_100034844 | Ga0068863_1000348443 | 75 |
| 82 | 3300005841 | Ga0068863_102758755 | Ga0068863_1027587551 | 75 |
| 83 | 3300005842 | Ga0068858_102096783 | Ga0068858_1020967832 | 75 |
| 84 | 3300005843 | Ga0068860_100152203 | Ga0068860_1001522034 | 75 |
| 85 | 3300005937 | Ga0081455_10248269 | Ga0081455_102482693 | 75 |
| 86 | 3300006931 | Ga0097620_102617496 | Ga0097620_1026174962 | 75 |
| 87 | 3300006931 | Ga0097620_102823785 | Ga0097620_1028237852 | 75 |
| 88 | 3300009093 | Ga0105240_10386973 | Ga0105240_103869732 | 75 |
| 89 | 3300009101 | Ga0105247_10045271 | Ga0105247_100452713 | 75 |
| 90 | 3300009101 | Ga0105247_10561850 | Ga0105247_105618503 | 75 |
| 91 | 3300009174 | Ga0105241_11649618 | Ga0105241_116496182 | 75 |
| 92 | 3300009177 | Ga0105248_10668591 | Ga0105248_106685913 | 75 |
| 93 | 3300009177 | Ga0105248_12817424 | Ga0105248_128174242 | 75 |
| 94 | 3300009551 | Ga0105238_10333058 | Ga0105238_103330581 | 75 |
| 95 | 3300009553 | Ga0105249_11260094 | Ga0105249_112600941 | 75 |
| 96 | 3300010375 | Ga0105239_10160569 | Ga0105239_101605692 | 75 |
| 97 | 3300011119 | Ga0105246_11235258 | Ga0105246_112352582 | 75 |
| 98 | 3300013105 | Ga0157369_11307047 | Ga0157369_113070472 | 75 |
| 99 | 3300013306 | Ga0163162_11982905 | Ga0163162_119829052 | 75 |
| 100 | 3300013307 | Ga0157372_11635223 | Ga0157372_116352232 | 75 |
| 101 | 3300014325 | Ga0163163_11572038 | Ga0163163_115720382 | 75 |
| 102 | 3300014325 | Ga0163163_11724678 | Ga0163163_117246782 | 75 |
| 103 | 3300014968 | Ga0157379_10019064 | Ga0157379_100190644 | 75 |
| 104 | 3300014968 | Ga0157379_10713074 | Ga0157379_107130742 | 75 |
| 105 | 3300025900 | Ga0207710_10184427 | Ga0207710_101844273 | 75 |
| 106 | 3300025900 | Ga0207710_10540298 | Ga0207710_105402982 | 75 |
| 107 | 3300025903 | Ga0207680_10003987 | Ga0207680_100039872 | 75 |
| 108 | 3300025903 | Ga0207680_10432596 | Ga0207680_104325962 | 75 |
| 109 | 3300025912 | Ga0207707_10114253 | Ga0207707_101142533 | 75 |
| 110 | 3300025917 | Ga0207660_10213327 | Ga0207660_102133272 | 75 |
| 111 | 3300025920 | Ga0207649_10134146 | Ga0207649_101341463 | 75 |
| 112 | 3300025921 | Ga0207652_10001670 | Ga0207652_1000167017 | 75 |
| 113 | 3300025924 | Ga0207694_10111639 | Ga0207694_101116394 | 75 |
| 114 | 3300025931 | Ga0207644_10101551 | Ga0207644_101015513 | 75 |
| 115 | 3300025936 | Ga0207670_11405885 | Ga0207670_114058852 | 75 |
| 116 | 3300025941 | Ga0207711_10680059 | Ga0207711_106800591 | 75 |
| 117 | 3300025941 | Ga0207711_11699054 | Ga0207711_116990542 | 75 |
| 118 | 3300025944 | Ga0207661_10072408 | Ga0207661_100724083 | 75 |
| 119 | 3300025986 | Ga0207658_10011566 | Ga0207658_100115665 | 75 |
| 120 | 3300025986 | Ga0207658_10048783 | Ga0207658_100487835 | 75 |
| 121 | 3300025986 | Ga0207658_10502722 | Ga0207658_105027223 | 75 |
| 122 | 3300026035 | Ga0207703_10293406 | Ga0207703_102934062 | 75 |
| 123 | 3300026035 | Ga0207703_11317798 | Ga0207703_113177982 | 75 |
| 124 | 3300026041 | Ga0207639_10387112 | Ga0207639_103871123 | 75 |
| 125 | 3300026067 | Ga0207678_10012092 | Ga0207678_100120925 | 75 |
| 126 | 3300026075 | Ga0207708_11147744 | Ga0207708_111477443 | 75 |
| 127 | 3300026088 | Ga0207641_10085782 | Ga0207641_100857823 | 75 |
| 128 | 3300028379 | Ga0268266_10000422 | Ga0268266_1000042234 | 75 |
| 129 | 3300028379 | Ga0268266_10333384 | Ga0268266_103333843 | 75 |
| 130 | 3300028381 | Ga0268264_10361956 | Ga0268264_103619562 | 75 |
| 131 | 3300031731 | Ga0307405_10760032 | Ga0307405_107600322 | 75 |
| 132 | 3300031852 | Ga0307410_10092283 | Ga0307410_100922832 | 75 |
| 133 | 3300032002 | Ga0307416_100058138 | Ga0307416_1000581382 | 75 |
| 134 | 3300032005 | Ga0307411_10476037 | Ga0307411_104760372 | 75 |
| 135 | 3300032126 | Ga0307415_100073325 | Ga0307415_1000733252 | 75 |
| 136 | 3300041494 | Ga0451837_0767587 | Ga0451837_0767587_48_281 | 75 |
| 137 | 3300041512 | Ga0451853_3962859 | Ga0451853_3962859_332_565 | 75 |
| 138 | 3300045976 | Ga0466967_2383287 | Ga0466967_2383287_76_306 | 75 |
| 139 | 3300046454 | Ga0495592_0830225 | Ga0495592_0830225_44_277 | 75 |
| 140 | 3300046519 | Ga0495632_0039815 | Ga0495632_0039815_244_477 | 75 |
| 141 | 3300046523 | Ga0495644_0004542 | Ga0495644_0004542_1846_2076 | 75 |
| 142 | 3300046535 | Ga0495586_0000500 | Ga0495586_0000500_20162_20392 | 75 |
| 143 | 3300046537 | Ga0495598_0000588 | Ga0495598_0000588_4335_4565 | 75 |
| 144 | 3300046539 | Ga0495621_0006343 | Ga0495621_0006343_1077_1310 | 75 |
| 145 | 3300046660 | Ga0495625_0000029 | Ga0495625_0000029_228524_228757 | 75 |
| 146 | 3300047320 | Ga0495672_0463218 | Ga0495672_0463218_101_331 | 75 |
| 147 | 3300047472 | Ga0495686_0198171 | Ga0495686_0198171_745_978 | 75 |
| 148 | 3300048903 | Ga0496100_1501358 | Ga0496100_1501358_222_455 | 75 |
| 149 | 3300048904 | Ga0496101_0108961 | Ga0496101_0108961_1710_1943 | 75 |
| 150 | 3300048905 | Ga0496102_0038034 | Ga0496102_0038034_963_1193 | 75 |
| 151 | 3300048906 | Ga0496103_0231951 | Ga0496103_0231951_640_873 | 75 |
| 152 | 3300048907 | Ga0496104_0014119 | Ga0496104_0014119_1530_1763 | 75 |
| 153 | 3300048908 | Ga0496105_0005224 | Ga0496105_0005224_8143_8376 | 75 |
| 154 | 3300048910 | Ga0496107_0050049 | Ga0496107_0050049_2582_2815 | 75 |
| 155 | 3300048910 | Ga0496107_0471312 | Ga0496107_0471312_276_509 | 75 |
| 156 | 3300048912 | Ga0496109_0784271 | Ga0496109_0784271_110_343 | 75 |
| 157 | 3300048913 | Ga0496110_0805481 | Ga0496110_0805481_334_567 | 75 |
| 158 | 3300048917 | Ga0496114_0539560 | Ga0496114_0539560_20_253 | 75 |
| 159 | 3300048918 | Ga0496115_0588877 | Ga0496115_0588877_362_595 | 75 |
| 160 | 3300048920 | Ga0496117_0002711 | Ga0496117_0002711_19508_19741 | 75 |
| 161 | 3300048921 | Ga0496118_0001277 | Ga0496118_0001277_27034_27267 | 75 |
| 162 | 3300048921 | Ga0496118_0348427 | Ga0496118_0348427_448_681 | 75 |
| 163 | 3300048921 | Ga0496118_0380061 | Ga0496118_0380061_123_353 | 75 |
| 164 | 3300048923 | Ga0496120_0015354 | Ga0496120_0015354_3548_3781 | 75 |
| 165 | 3300048923 | Ga0496120_0192192 | Ga0496120_0192192_77_310 | 75 |
| 166 | 3300048924 | Ga0496121_0015047 | Ga0496121_0015047_4714_4947 | 75 |
| 167 | 3300048924 | Ga0496121_0196325 | Ga0496121_0196325_848_1081 | 75 |
| 168 | 3300048927 | Ga0496124_0039181 | Ga0496124_0039181_968_1201 | 75 |
| 169 | 3300048928 | Ga0496125_0410968 | Ga0496125_0410968_511_744 | 75 |
| 170 | 3300048929 | Ga0496126_0067719 | Ga0496126_0067719_1978_2211 | 75 |
| 171 | 3300048929 | Ga0496126_0127017 | Ga0496126_0127017_954_1187 | 75 |
| 172 | 3300048929 | Ga0496126_0434541 | Ga0496126_0434541_599_832 | 75 |
| 173 | 3300048929 | Ga0496126_1023474 | Ga0496126_1023474_219_452 | 75 |
| 174 | 3300049568 | Ga0501031_0006300 | Ga0501031_0006300_929_1162 | 75 |
| 175 | 3300049569 | Ga0501032_0008990 | Ga0501032_0008990_494_727 | 75 |
| 176 | 3300049570 | Ga0501033_0008846 | Ga0501033_0008846_1006_1239 | 75 |
| 177 | 3300049571 | Ga0501034_0013871 | Ga0501034_0013871_6862_7095 | 75 |
| 178 | 3300049571 | Ga0501034_0059301 | Ga0501034_0059301_3314_3547 | 75 |
| 179 | 3300049571 | Ga0501034_0694231 | Ga0501034_0694231_502_747 | 75 |
| 180 | 3300049572 | Ga0501036_0067783 | Ga0501036_0067783_1041_1274 | 75 |
| 181 | 3300049573 | Ga0501037_0000525 | Ga0501037_0000525_23931_24164 | 75 |
| 182 | 3300049574 | Ga0501038_0012367 | Ga0501038_0012367_971_1204 | 75 |
| 183 | 3300049575 | Ga0501039_0092346 | Ga0501039_0092346_1207_1440 | 75 |
| 184 | 3300049575 | Ga0501039_1026433 | Ga0501039_1026433_45_272 | 75 |
| 185 | 3300049576 | Ga0501040_0084637 | Ga0501040_0084637_205_438 | 75 |
| 186 | 3300049578 | Ga0501042_0044138 | Ga0501042_0044138_1411_1644 | 75 |
| 187 | 3300049578 | Ga0501042_0066461 | Ga0501042_0066461_628_861 | 75 |
| 188 | 3300049579 | Ga0501043_0009296 | Ga0501043_0009296_953_1186 | 75 |
| 189 | 3300049579 | Ga0501043_0304435 | Ga0501043_0304435_759_998 | 75 |
| 190 | 3300049579 | Ga0501043_0494608 | Ga0501043_0494608_156_389 | 75 |
| 191 | 3300049580 | Ga0501046_0010383 | Ga0501046_0010383_6559_6792 | 75 |
| 192 | 3300049581 | Ga0501047_0001574 | Ga0501047_0001574_4953_5186 | 75 |
| 193 | 3300049581 | Ga0501047_0049098 | Ga0501047_0049098_2218_2451 | 75 |
| 194 | 3300049581 | Ga0501047_1295068 | Ga0501047_1295068_291_524 | 75 |
| 195 | 3300049582 | Ga0501048_0008006 | Ga0501048_0008006_1218_1451 | 75 |
| 196 | 3300049582 | Ga0501048_1359790 | Ga0501048_1359790_200_439 | 75 |
| 197 | 3300049583 | Ga0501067_0036828 | Ga0501067_0036828_1735_1968 | 75 |
| 198 | 3300049583 | Ga0501067_0187431 | Ga0501067_0187431_413_658 | 75 |
| 199 | 3300049583 | Ga0501067_0514880 | Ga0501067_0514880_356_589 | 75 |
| 200 | 3300049584 | Ga0501068_0147497 | Ga0501068_0147497_700_945 | 75 |
| 201 | 3300049584 | Ga0501068_0264819 | Ga0501068_0264819_630_869 | 75 |
| 202 | 3300049584 | Ga0501068_0304563 | Ga0501068_0304563_309_554 | 75 |
| 203 | 3300049584 | Ga0501068_0997002 | Ga0501068_0997002_188_415 | 75 |
| 204 | 3300049585 | Ga0501069_0029178 | Ga0501069_0029178_1124_1363 | 75 |
| 205 | 3300049585 | Ga0501069_0047338 | Ga0501069_0047338_1318_1551 | 75 |
| 206 | 3300049585 | Ga0501069_0092800 | Ga0501069_0092800_1136_1381 | 75 |
| 207 | 3300049585 | Ga0501069_0264043 | Ga0501069_0264043_375_620 | 75 |
| 208 | 3300049586 | Ga0501070_0004676 | Ga0501070_0004676_6902_7135 | 75 |
| 209 | 3300049586 | Ga0501070_0010080 | Ga0501070_0010080_6559_6792 | 75 |
| 210 | 3300049586 | Ga0501070_0018917 | Ga0501070_0018917_4090_4323 | 75 |
| 211 | 3300049586 | Ga0501070_0060100 | Ga0501070_0060100_2123_2368 | 75 |
| 212 | 3300049586 | Ga0501070_0092725 | Ga0501070_0092725_1794_2039 | 75 |
| 213 | 3300049586 | Ga0501070_0189759 | Ga0501070_0189759_433_672 | 75 |
| 214 | 3300049586 | Ga0501070_0841871 | Ga0501070_0841871_42_275 | 75 |
| 215 | 3300049587 | Ga0501071_0197812 | Ga0501071_0197812_622_867 | 75 |
| 216 | 3300049587 | Ga0501071_0430007 | Ga0501071_0430007_243_482 | 75 |
| 217 | 3300049588 | Ga0501072_0018431 | Ga0501072_0018431_1844_2089 | 75 |
| 218 | 3300049588 | Ga0501072_0230061 | Ga0501072_0230061_808_1041 | 75 |
| 219 | 3300049588 | Ga0501072_0247691 | Ga0501072_0247691_492_737 | 75 |
| 220 | 3300049589 | Ga0501073_0034514 | Ga0501073_0034514_1507_1752 | 75 |
| 221 | 3300049589 | Ga0501073_0134353 | Ga0501073_0134353_602_835 | 75 |
| 222 | 3300049590 | Ga0501074_0013122 | Ga0501074_0013122_3924_4169 | 75 |
| 223 | 3300049590 | Ga0501074_0015911 | Ga0501074_0015911_383_616 | 75 |
| 224 | 3300049590 | Ga0501074_0153190 | Ga0501074_0153190_564_803 | 75 |
| 225 | 3300049590 | Ga0501074_0229951 | Ga0501074_0229951_315_548 | 75 |
| 226 | 3300049590 | Ga0501074_0914190 | Ga0501074_0914190_184_417 | 75 |
| 227 | 3300049592 | Ga0501076_1025091 | Ga0501076_1025091_235_474 | 75 |
| 228 | 3300049741 | Ga0501079_0302078 | Ga0501079_0302078_298_537 | 75 |
| 229 | 3300049742 | Ga0501080_0111542 | Ga0501080_0111542_1680_1925 | 75 |
| 230 | 3300049742 | Ga0501080_0135321 | Ga0501080_0135321_902_1135 | 75 |
| 231 | 3300049742 | Ga0501080_0379129 | Ga0501080_0379129_891_1130 | 75 |
| 232 | 3300049743 | Ga0501081_0139057 | Ga0501081_0139057_848_1075 | 75 |
| 233 | 3300049744 | Ga0501083_0007552 | Ga0501083_0007552_924_1157 | 75 |
| 234 | 3300049744 | Ga0501083_0018273 | Ga0501083_0018273_3205_3450 | 75 |
| 235 | 3300049744 | Ga0501083_0799840 | Ga0501083_0799840_134_373 | 75 |
| 236 | 3300049822 | Ga0501035_0001973 | Ga0501035_0001973_13750_13983 | 75 |
| 237 | 3300049822 | Ga0501035_0841852 | Ga0501035_0841852_299_532 | 75 |
| 238 | 3300049823 | Ga0501044_0016353 | Ga0501044_0016353_1069_1302 | 75 |
| 239 | 3300049823 | Ga0501044_0049370 | Ga0501044_0049370_1958_2197 | 75 |
| 240 | 3300049824 | Ga0501045_0092091 | Ga0501045_0092091_232_465 | 75 |
| 241 | 3300050491 | nmdc:mga00v17_996704_c1 | nmdc:mga00v17_996704_c1_203_433 | 75 |
| 242 | 3300053134 | Ga0500658_0016814 | Ga0500658_0016814_555_788 | 75 |
| 243 | 3300054114 | Ga0501084_1097573 | Ga0501084_1097573_178_423 | 75 |
| 244 | 3300060353 | Ga0501082_0011154 | Ga0501082_0011154_952_1185 | 75 |
| 245 | 3300001990 | JGI24737J22298_10262304 | JGI24737J22298_102623042 | 76 |
| 246 | 3300002070 | JGI24750J21931_1009086 | JGI24750J21931_10090862 | 76 |
| 247 | 3300002075 | JGI24738J21930_10050273 | JGI24738J21930_100502732 | 76 |
| 248 | 3300002077 | JGI24744J21845_10034710 | JGI24744J21845_100347102 | 76 |
| 249 | 3300002459 | JGI24751J29686_10066292 | JGI24751J29686_100662921 | 76 |
| 250 | 3300005327 | Ga0070658_10266364 | Ga0070658_102663642 | 76 |
| 251 | 3300005328 | Ga0070676_10431105 | Ga0070676_104311052 | 76 |
| 252 | 3300005329 | Ga0070683_100085971 | Ga0070683_1000859713 | 76 |
| 253 | 3300005329 | Ga0070683_100154280 | Ga0070683_1001542801 | 76 |
| 254 | 3300005329 | Ga0070683_100202022 | Ga0070683_1002020222 | 76 |
| 255 | 3300005329 | Ga0070683_100301786 | Ga0070683_1003017862 | 76 |
| 256 | 3300005331 | Ga0070670_100560195 | Ga0070670_1005601952 | 76 |
| 257 | 3300005331 | Ga0070670_101457762 | Ga0070670_1014577622 | 76 |
| 258 | 3300005334 | Ga0068869_100114315 | Ga0068869_1001143151 | 76 |
| 259 | 3300005335 | Ga0070666_10205807 | Ga0070666_102058072 | 76 |
| 260 | 3300005336 | Ga0070680_100435485 | Ga0070680_1004354852 | 76 |
| 261 | 3300005338 | Ga0068868_100015021 | Ga0068868_1000150214 | 76 |
| 262 | 3300005339 | Ga0070660_100001352 | Ga0070660_10000135218 | 76 |
| 263 | 3300005344 | Ga0070661_100000032 | Ga0070661_10000003263 | 76 |
| 264 | 3300005344 | Ga0070661_100117591 | Ga0070661_1001175912 | 76 |
| 265 | 3300005347 | Ga0070668_100179768 | Ga0070668_1001797682 | 76 |
| 266 | 3300005353 | Ga0070669_100098357 | Ga0070669_1000983572 | 76 |
| 267 | 3300005354 | Ga0070675_100026360 | Ga0070675_1000263602 | 76 |
| 268 | 3300005356 | Ga0070674_100010932 | Ga0070674_1000109323 | 76 |
| 269 | 3300005364 | Ga0070673_100235373 | Ga0070673_1002353732 | 76 |
| 270 | 3300005365 | Ga0070688_100020472 | Ga0070688_1000204722 | 76 |
| 271 | 3300005366 | Ga0070659_100000396 | Ga0070659_1000003963 | 76 |
| 272 | 3300005366 | Ga0070659_101615099 | Ga0070659_1016150992 | 76 |
| 273 | 3300005436 | Ga0070713_100288337 | Ga0070713_1002883374 | 76 |
| 274 | 3300005441 | Ga0070700_100007039 | Ga0070700_1000070392 | 76 |
| 275 | 3300005441 | Ga0070700_100086449 | Ga0070700_1000864493 | 76 |
| 276 | 3300005455 | Ga0070663_100006561 | Ga0070663_1000065614 | 76 |
| 277 | 3300005455 | Ga0070663_100872213 | Ga0070663_1008722131 | 76 |
| 278 | 3300005456 | Ga0070678_100173196 | Ga0070678_1001731962 | 76 |
| 279 | 3300005456 | Ga0070678_101291094 | Ga0070678_1012910942 | 76 |
| 280 | 3300005457 | Ga0070662_100202437 | Ga0070662_1002024372 | 76 |
| 281 | 3300005458 | Ga0070681_10649026 | Ga0070681_106490262 | 76 |
| 282 | 3300005459 | Ga0068867_100255425 | Ga0068867_1002554252 | 76 |
| 283 | 3300005466 | Ga0070685_10060155 | Ga0070685_100601552 | 76 |
| 284 | 3300005530 | Ga0070679_100124752 | Ga0070679_1001247523 | 76 |
| 285 | 3300005535 | Ga0070684_100011898 | Ga0070684_1000118982 | 76 |
| 286 | 3300005535 | Ga0070684_100019500 | Ga0070684_1000195006 | 76 |
| 287 | 3300005535 | Ga0070684_100076934 | Ga0070684_1000769343 | 76 |
| 288 | 3300005535 | Ga0070684_100641265 | Ga0070684_1006412651 | 76 |
| 289 | 3300005535 | Ga0070684_101802252 | Ga0070684_1018022522 | 76 |
| 290 | 3300005539 | Ga0068853_100019034 | Ga0068853_1000190342 | 76 |
| 291 | 3300005543 | Ga0070672_100000013 | Ga0070672_10000001355 | 76 |
| 292 | 3300005543 | Ga0070672_100005703 | Ga0070672_1000057035 | 76 |
| 293 | 3300005544 | Ga0070686_100014046 | Ga0070686_1000140462 | 76 |
| 294 | 3300005544 | Ga0070686_101267196 | Ga0070686_1012671961 | 76 |
| 295 | 3300005545 | Ga0070695_100340472 | Ga0070695_1003404723 | 76 |
| 296 | 3300005545 | Ga0070695_100401467 | Ga0070695_1004014672 | 76 |
| 297 | 3300005547 | Ga0070693_100599430 | Ga0070693_1005994301 | 76 |
| 298 | 3300005548 | Ga0070665_101621306 | Ga0070665_1016213062 | 76 |
| 299 | 3300005549 | Ga0070704_100892637 | Ga0070704_1008926371 | 76 |
| 300 | 3300005563 | Ga0068855_100443679 | Ga0068855_1004436792 | 76 |
| 301 | 3300005563 | Ga0068855_100727711 | Ga0068855_1007277112 | 76 |
| 302 | 3300005564 | Ga0070664_101262018 | Ga0070664_1012620182 | 76 |
| 303 | 3300005577 | Ga0068857_100326353 | Ga0068857_1003263531 | 76 |
| 304 | 3300005578 | Ga0068854_100007996 | Ga0068854_1000079963 | 76 |
| 305 | 3300005614 | Ga0068856_102682356 | Ga0068856_1026823562 | 76 |
| 306 | 3300005615 | Ga0070702_100067036 | Ga0070702_1000670362 | 76 |
| 307 | 3300005616 | Ga0068852_100054777 | Ga0068852_1000547774 | 76 |
| 308 | 3300005617 | Ga0068859_100745703 | Ga0068859_1007457032 | 76 |
| 309 | 3300005618 | Ga0068864_100081628 | Ga0068864_1000816282 | 76 |
| 310 | 3300005718 | Ga0068866_10000007 | Ga0068866_10000007116 | 76 |
| 311 | 3300005719 | Ga0068861_100172879 | Ga0068861_1001728792 | 76 |
| 312 | 3300005834 | Ga0068851_10117298 | Ga0068851_101172982 | 76 |
| 313 | 3300005840 | Ga0068870_10845894 | Ga0068870_108458942 | 76 |
| 314 | 3300005841 | Ga0068863_100837911 | Ga0068863_1008379112 | 76 |
| 315 | 3300005842 | Ga0068858_100130044 | Ga0068858_1001300443 | 76 |
| 316 | 3300005844 | Ga0068862_100192668 | Ga0068862_1001926682 | 76 |
| 317 | 3300005937 | Ga0081455_10017920 | Ga0081455_100179203 | 76 |
| 318 | 3300005981 | Ga0081538_10000034 | Ga0081538_1000003447 | 76 |
| 319 | 3300005985 | Ga0081539_10001387 | Ga0081539_1000138718 | 76 |
| 320 | 3300006038 | Ga0075365_10020868 | Ga0075365_100208685 | 76 |
| 321 | 3300006038 | Ga0075365_10703749 | Ga0075365_107037491 | 76 |
| 322 | 3300006038 | Ga0075365_11166064 | Ga0075365_111660642 | 76 |
| 323 | 3300006048 | Ga0075363_100016297 | Ga0075363_1000162973 | 76 |
| 324 | 3300006048 | Ga0075363_100048892 | Ga0075363_1000488922 | 76 |
| 325 | 3300006048 | Ga0075363_100167874 | Ga0075363_1001678742 | 76 |
| 326 | 3300006051 | Ga0075364_10146173 | Ga0075364_101461732 | 76 |
| 327 | 3300006173 | Ga0070716_100115317 | Ga0070716_1001153174 | 76 |
| 328 | 3300006178 | Ga0075367_10083623 | Ga0075367_100836232 | 76 |
| 329 | 3300006178 | Ga0075367_10181824 | Ga0075367_101818242 | 76 |
| 330 | 3300006852 | Ga0075433_10010741 | Ga0075433_100107412 | 76 |
| 331 | 3300006881 | Ga0068865_100009350 | Ga0068865_1000093503 | 76 |
| 332 | 3300006931 | Ga0097620_100745738 | Ga0097620_1007457382 | 76 |
| 333 | 3300009036 | Ga0105244_10377939 | Ga0105244_103779391 | 76 |
| 334 | 3300009093 | Ga0105240_10666360 | Ga0105240_106663603 | 76 |
| 335 | 3300009093 | Ga0105240_11383029 | Ga0105240_113830292 | 76 |
| 336 | 3300009094 | Ga0111539_10164631 | Ga0111539_101646312 | 76 |
| 337 | 3300009094 | Ga0111539_11549256 | Ga0111539_115492562 | 76 |
| 338 | 3300009098 | Ga0105245_10014070 | Ga0105245_100140704 | 76 |
| 339 | 3300009098 | Ga0105245_12043786 | Ga0105245_120437862 | 76 |
| 340 | 3300009148 | Ga0105243_10005110 | Ga0105243_100051105 | 76 |
| 341 | 3300009148 | Ga0105243_10702326 | Ga0105243_107023263 | 76 |
| 342 | 3300009176 | Ga0105242_10221747 | Ga0105242_102217472 | 76 |
| 343 | 3300009551 | Ga0105238_10000016 | Ga0105238_1000001640 | 76 |
| 344 | 3300009553 | Ga0105249_10000054 | Ga0105249_10000054145 | 76 |
| 345 | 3300009553 | Ga0105249_13080808 | Ga0105249_130808082 | 76 |
| 346 | 3300010159 | Ga0099796_10266503 | Ga0099796_102665032 | 76 |
| 347 | 3300010375 | Ga0105239_10107435 | Ga0105239_101074353 | 76 |
| 348 | 3300011119 | Ga0105246_10106248 | Ga0105246_101062482 | 76 |
| 349 | 3300011119 | Ga0105246_10417416 | Ga0105246_104174161 | 76 |
| 350 | 3300013307 | Ga0157372_10414816 | Ga0157372_104148162 | 76 |
| 351 | 3300013308 | Ga0157375_10011718 | Ga0157375_100117184 | 76 |
| 352 | 3300013308 | Ga0157375_12934149 | Ga0157375_129341492 | 76 |
| 353 | 3300014325 | Ga0163163_11879931 | Ga0163163_118799312 | 76 |
| 354 | 3300014326 | Ga0157380_10377504 | Ga0157380_103775042 | 76 |
| 355 | 3300014326 | Ga0157380_11862098 | Ga0157380_118620982 | 76 |
| 356 | 3300014745 | Ga0157377_10010951 | Ga0157377_100109512 | 76 |
| 357 | 3300014968 | Ga0157379_10017532 | Ga0157379_100175328 | 76 |
| 358 | 3300017792 | Ga0163161_11556738 | Ga0163161_115567382 | 76 |
| 359 | 3300025899 | Ga0207642_10633627 | Ga0207642_106336271 | 76 |
| 360 | 3300025900 | Ga0207710_10026077 | Ga0207710_100260772 | 76 |
| 361 | 3300025901 | Ga0207688_10012452 | Ga0207688_100124524 | 76 |
| 362 | 3300025903 | Ga0207680_10213958 | Ga0207680_102139582 | 76 |
| 363 | 3300025904 | Ga0207647_10103670 | Ga0207647_101036702 | 76 |
| 364 | 3300025907 | Ga0207645_10168950 | Ga0207645_101689502 | 76 |
| 365 | 3300025909 | Ga0207705_10019045 | Ga0207705_100190459 | 76 |
| 366 | 3300025909 | Ga0207705_10035941 | Ga0207705_100359412 | 76 |
| 367 | 3300025917 | Ga0207660_10387301 | Ga0207660_103873012 | 76 |
| 368 | 3300025919 | Ga0207657_10001969 | Ga0207657_1000196918 | 76 |
| 369 | 3300025920 | Ga0207649_10000015 | Ga0207649_1000001531 | 76 |
| 370 | 3300025920 | Ga0207649_10061038 | Ga0207649_100610382 | 76 |
| 371 | 3300025920 | Ga0207649_11683505 | Ga0207649_116835052 | 76 |
| 372 | 3300025921 | Ga0207652_10170366 | Ga0207652_101703662 | 76 |
| 373 | 3300025923 | Ga0207681_10170726 | Ga0207681_101707262 | 76 |
| 374 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012381 | 76 |
| 375 | 3300025925 | Ga0207650_11258382 | Ga0207650_112583822 | 76 |
| 376 | 3300025926 | Ga0207659_10017333 | Ga0207659_100173334 | 76 |
| 377 | 3300025927 | Ga0207687_10053880 | Ga0207687_100538802 | 76 |
| 378 | 3300025929 | Ga0207664_10956782 | Ga0207664_109567822 | 76 |
| 379 | 3300025932 | Ga0207690_10006166 | Ga0207690_100061665 | 76 |
| 380 | 3300025932 | Ga0207690_11233393 | Ga0207690_112333932 | 76 |
| 381 | 3300025933 | Ga0207706_10000003 | Ga0207706_100000039 | 76 |
| 382 | 3300025933 | Ga0207706_10026716 | Ga0207706_100267162 | 76 |
| 383 | 3300025934 | Ga0207686_10054601 | Ga0207686_100546012 | 76 |
| 384 | 3300025935 | Ga0207709_10006931 | Ga0207709_100069313 | 76 |
| 385 | 3300025937 | Ga0207669_10000475 | Ga0207669_100004757 | 76 |
| 386 | 3300025937 | Ga0207669_10008523 | Ga0207669_100085234 | 76 |
| 387 | 3300025938 | Ga0207704_10004361 | Ga0207704_100043613 | 76 |
| 388 | 3300025939 | Ga0207665_10040308 | Ga0207665_100403086 | 76 |
| 389 | 3300025940 | Ga0207691_10000095 | Ga0207691_1000009529 | 76 |
| 390 | 3300025940 | Ga0207691_10022999 | Ga0207691_100229993 | 76 |
| 391 | 3300025942 | Ga0207689_10198651 | Ga0207689_101986512 | 76 |
| 392 | 3300025944 | Ga0207661_10000666 | Ga0207661_1000066617 | 76 |
| 393 | 3300025944 | Ga0207661_10001606 | Ga0207661_1000160618 | 76 |
| 394 | 3300025944 | Ga0207661_10035852 | Ga0207661_100358523 | 76 |
| 395 | 3300025944 | Ga0207661_10172133 | Ga0207661_101721334 | 76 |
| 396 | 3300025945 | Ga0207679_10009210 | Ga0207679_100092104 | 76 |
| 397 | 3300025945 | Ga0207679_11423370 | Ga0207679_114233701 | 76 |
| 398 | 3300025945 | Ga0207679_11900160 | Ga0207679_119001602 | 76 |
| 399 | 3300025949 | Ga0207667_10124115 | Ga0207667_101241154 | 76 |
| 400 | 3300025960 | Ga0207651_10200198 | Ga0207651_102001982 | 76 |
| 401 | 3300025972 | Ga0207668_10074640 | Ga0207668_100746404 | 76 |
| 402 | 3300025972 | Ga0207668_10108349 | Ga0207668_101083492 | 76 |
| 403 | 3300025981 | Ga0207640_10315672 | Ga0207640_103156721 | 76 |
| 404 | 3300026023 | Ga0207677_10079064 | Ga0207677_100790642 | 76 |
| 405 | 3300026035 | Ga0207703_10524372 | Ga0207703_105243722 | 76 |
| 406 | 3300026041 | Ga0207639_10039552 | Ga0207639_100395522 | 76 |
| 407 | 3300026067 | Ga0207678_10001730 | Ga0207678_100017306 | 76 |
| 408 | 3300026075 | Ga0207708_10003752 | Ga0207708_100037524 | 76 |
| 409 | 3300026075 | Ga0207708_10126034 | Ga0207708_101260343 | 76 |
| 410 | 3300026088 | Ga0207641_10000436 | Ga0207641_1000043615 | 76 |
| 411 | 3300026088 | Ga0207641_11055967 | Ga0207641_110559672 | 76 |
| 412 | 3300026089 | Ga0207648_10292820 | Ga0207648_102928202 | 76 |
| 413 | 3300026095 | Ga0207676_12039162 | Ga0207676_120391622 | 76 |
| 414 | 3300026116 | Ga0207674_10136991 | Ga0207674_101369912 | 76 |
| 415 | 3300026118 | Ga0207675_100485618 | Ga0207675_1004856182 | 76 |
| 416 | 3300026121 | Ga0207683_10656039 | Ga0207683_106560392 | 76 |
| 417 | 3300026142 | Ga0207698_10009935 | Ga0207698_100099357 | 76 |
| 418 | 3300026142 | Ga0207698_10017583 | Ga0207698_100175832 | 76 |
| 419 | 3300027907 | Ga0207428_10219707 | Ga0207428_102197072 | 76 |
| 420 | 3300028379 | Ga0268266_10018593 | Ga0268266_100185933 | 76 |
| 421 | 3300028379 | Ga0268266_10353696 | Ga0268266_103536962 | 76 |
| 422 | 3300028379 | Ga0268266_11439928 | Ga0268266_114399281 | 76 |
| 423 | 3300028380 | Ga0268265_10283975 | Ga0268265_102839752 | 76 |
| 424 | 3300028381 | Ga0268264_10227112 | Ga0268264_102271121 | 76 |
| 425 | 3300031548 | Ga0307408_101295541 | Ga0307408_1012955412 | 76 |
| 426 | 3300031727 | Ga0316576_10819755 | Ga0316576_108197552 | 76 |
| 427 | 3300031728 | Ga0316578_10064066 | Ga0316578_100640662 | 76 |
| 428 | 3300031824 | Ga0307413_10667263 | Ga0307413_106672631 | 76 |
| 429 | 3300031901 | Ga0307406_10144983 | Ga0307406_101449832 | 76 |
| 430 | 3300031901 | Ga0307406_10991375 | Ga0307406_109913751 | 76 |
| 431 | 3300031901 | Ga0307406_11247738 | Ga0307406_112477381 | 76 |
| 432 | 3300031911 | Ga0307412_12078929 | Ga0307412_120789292 | 76 |
| 433 | 3300031995 | Ga0307409_100260999 | Ga0307409_1002609992 | 76 |
| 434 | 3300032002 | Ga0307416_100304174 | Ga0307416_1003041742 | 76 |
| 435 | 3300032002 | Ga0307416_100612735 | Ga0307416_1006127352 | 76 |
| 436 | 3300032126 | Ga0307415_102075585 | Ga0307415_1020755851 | 76 |
| 437 | 3300035398 | Ga0316574_0904020 | Ga0316574_0904020_12_248 | 76 |
| 438 | 3300036712 | Ga0316584_0091236 | Ga0316584_0091236_1746_1982 | 76 |
| 439 | 3300036712 | Ga0316584_0417167 | Ga0316584_0417167_677_919 | 76 |
| 440 | 3300037312 | Ga0395899_0461832 | Ga0395899_0461832_211_444 | 76 |
| 441 | 3300037466 | Ga0395898_0376567 | Ga0395898_0376567_715_945 | 76 |
| 442 | 3300037471 | Ga0395905_0293159 | Ga0395905_0293159_568_798 | 76 |
| 443 | 3300037853 | Ga0436364_1069239 | Ga0436364_1069239_304_537 | 76 |
| 444 | 3300038443 | Ga0395901_0567820 | Ga0395901_0567820_759_992 | 76 |
| 445 | 3300038443 | Ga0395901_0787426 | Ga0395901_0787426_651_881 | 76 |
| 446 | 3300041460 | Ga0451802_1111570 | Ga0451802_1111570_315_548 | 76 |
| 447 | 3300041486 | Ga0451807_1603377 | Ga0451807_1603377_675_911 | 76 |
| 448 | 3300041512 | Ga0451853_2552138 | Ga0451853_2552138_271_504 | 76 |
| 449 | 3300042115 | Ga0450911_034913 | Ga0450911_034913_377_622 | 76 |
| 450 | 3300044694 | Ga0466963_0000033 | Ga0466963_0000033_40239_40475 | 76 |
| 451 | 3300046454 | Ga0495592_0720553 | Ga0495592_0720553_102_344 | 76 |
| 452 | 3300046455 | Ga0495603_0003650 | Ga0495603_0003650_6242_6475 | 76 |
| 453 | 3300046459 | Ga0495629_0000489 | Ga0495629_0000489_13216_13452 | 76 |
| 454 | 3300046459 | Ga0495629_0188950 | Ga0495629_0188950_259_501 | 76 |
| 455 | 3300046459 | Ga0495629_0316513 | Ga0495629_0316513_501_734 | 76 |
| 456 | 3300046461 | Ga0495641_0010101 | Ga0495641_0010101_564_800 | 76 |
| 457 | 3300046463 | Ga0495653_0056155 | Ga0495653_0056155_1312_1548 | 76 |
| 458 | 3300046463 | Ga0495653_0759289 | Ga0495653_0759289_308_544 | 76 |
| 459 | 3300046500 | Ga0495596_0412129 | Ga0495596_0412129_109_354 | 76 |
| 460 | 3300046507 | Ga0495606_0000550 | Ga0495606_0000550_40683_40919 | 76 |
| 461 | 3300046513 | Ga0495616_0430910 | Ga0495616_0430910_116_361 | 76 |
| 462 | 3300046514 | Ga0495618_0000053 | Ga0495618_0000053_76271_76504 | 76 |
| 463 | 3300046515 | Ga0495620_0000782 | Ga0495620_0000782_11668_11904 | 76 |
| 464 | 3300046516 | Ga0495628_0000628 | Ga0495628_0000628_4908_5144 | 76 |
| 465 | 3300046516 | Ga0495628_0124881 | Ga0495628_0124881_252_488 | 76 |
| 466 | 3300046516 | Ga0495628_0147720 | Ga0495628_0147720_1055_1291 | 76 |
| 467 | 3300046517 | Ga0495630_0000599 | Ga0495630_0000599_14954_15190 | 76 |
| 468 | 3300046517 | Ga0495630_0062591 | Ga0495630_0062591_418_651 | 76 |
| 469 | 3300046517 | Ga0495630_0580467 | Ga0495630_0580467_491_727 | 76 |
| 470 | 3300046517 | Ga0495630_0600846 | Ga0495630_0600846_170_406 | 76 |
| 471 | 3300046529 | Ga0495652_0000009 | Ga0495652_0000009_151164_151400 | 76 |
| 472 | 3300046529 | Ga0495652_0450761 | Ga0495652_0450761_219_455 | 76 |
| 473 | 3300046536 | Ga0495587_0403700 | Ga0495587_0403700_506_739 | 76 |
| 474 | 3300046559 | Ga0495667_0000109 | Ga0495667_0000109_52552_52788 | 76 |
| 475 | 3300046559 | Ga0495667_0273805 | Ga0495667_0273805_93_329 | 76 |
| 476 | 3300046642 | Ga0495634_0360501 | Ga0495634_0360501_461_697 | 76 |
| 477 | 3300046642 | Ga0495634_0875243 | Ga0495634_0875243_19_252 | 76 |
| 478 | 3300046663 | Ga0495635_0577720 | Ga0495635_0577720_367_600 | 76 |
| 479 | 3300046663 | Ga0495635_0683226 | Ga0495635_0683226_304_540 | 76 |
| 480 | 3300046675 | Ga0495657_0097308 | Ga0495657_0097308_440_676 | 76 |
| 481 | 3300046678 | Ga0495599_0431712 | Ga0495599_0431712_197_433 | 76 |
| 482 | 3300046680 | Ga0495646_0536753 | Ga0495646_0536753_197_439 | 76 |
| 483 | 3300046681 | Ga0495647_0000002 | Ga0495647_0000002_71019_71252 | 76 |
| 484 | 3300046684 | Ga0495669_0015192 | Ga0495669_0015192_581_817 | 76 |
| 485 | 3300046689 | Ga0495613_0000042 | Ga0495613_0000042_111163_111426 | 76 |
| 486 | 3300046689 | Ga0495613_0778832 | Ga0495613_0778832_240_473 | 76 |
| 487 | 3300046691 | Ga0495670_0039028 | Ga0495670_0039028_307_540 | 76 |
| 488 | 3300046794 | Ga0495589_0356352 | Ga0495589_0356352_372_617 | 76 |
| 489 | 3300046809 | Ga0495600_0000922 | Ga0495600_0000922_14471_14704 | 76 |
| 490 | 3300046809 | Ga0495600_0511662 | Ga0495600_0511662_330_566 | 76 |
| 491 | 3300046809 | Ga0495600_0727324 | Ga0495600_0727324_15_251 | 76 |
| 492 | 3300047317 | Ga0495604_0000255 | Ga0495604_0000255_12649_12885 | 76 |
| 493 | 3300047319 | Ga0495674_0172893 | Ga0495674_0172893_727_963 | 76 |
| 494 | 3300047319 | Ga0495674_1181260 | Ga0495674_1181260_184_447 | 76 |
| 495 | 3300047321 | Ga0495676_0302103 | Ga0495676_0302103_86_322 | 76 |
| 496 | 3300047321 | Ga0495676_0599892 | Ga0495676_0599892_293_526 | 76 |
| 497 | 3300047321 | Ga0495676_0803760 | Ga0495676_0803760_207_440 | 76 |
| 498 | 3300047322 | Ga0495680_0001999 | Ga0495680_0001999_7198_7434 | 76 |
| 499 | 3300047322 | Ga0495680_0285043 | Ga0495680_0285043_893_1126 | 76 |
| 500 | 3300047322 | Ga0495680_0501511 | Ga0495680_0501511_289_525 | 76 |
| 501 | 3300047446 | Ga0495679_011199 | Ga0495679_011199_2740_2976 | 76 |
| 502 | 3300047471 | Ga0495684_0133639 | Ga0495684_0133639_1610_1846 | 76 |
| 503 | 3300048088 | Ga0495602_0003237 | Ga0495602_0003237_367_603 | 76 |
| 504 | 3300048903 | Ga0496100_0189085 | Ga0496100_0189085_1210_1440 | 76 |
| 505 | 3300048904 | Ga0496101_0113061 | Ga0496101_0113061_1100_1330 | 76 |
| 506 | 3300048905 | Ga0496102_1722469 | Ga0496102_1722469_56_286 | 76 |
| 507 | 3300048909 | Ga0496106_0032804 | Ga0496106_0032804_3025_3255 | 76 |
| 508 | 3300048910 | Ga0496107_0026865 | Ga0496107_0026865_3199_3429 | 76 |
| 509 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_165218_165454 | 76 |
| 510 | 3300048911 | Ga0496108_0030176 | Ga0496108_0030176_3631_3861 | 76 |
| 511 | 3300048911 | Ga0496108_0059767 | Ga0496108_0059767_152_388 | 76 |
| 512 | 3300048912 | Ga0496109_0000011 | Ga0496109_0000011_225222_225458 | 76 |
| 513 | 3300048912 | Ga0496109_0000031 | Ga0496109_0000031_11431_11667 | 76 |
| 514 | 3300048912 | Ga0496109_0000870 | Ga0496109_0000870_12395_12625 | 76 |
| 515 | 3300048912 | Ga0496109_1225261 | Ga0496109_1225261_362_595 | 76 |
| 516 | 3300048913 | Ga0496110_0063783 | Ga0496110_0063783_2110_2355 | 76 |
| 517 | 3300048913 | Ga0496110_0927459 | Ga0496110_0927459_430_666 | 76 |
| 518 | 3300048913 | Ga0496110_1345665 | Ga0496110_1345665_170_406 | 76 |
| 519 | 3300048914 | Ga0496111_0009546 | Ga0496111_0009546_3332_3577 | 76 |
| 520 | 3300048914 | Ga0496111_0084449 | Ga0496111_0084449_1868_2098 | 76 |
| 521 | 3300048914 | Ga0496111_0195835 | Ga0496111_0195835_327_563 | 76 |
| 522 | 3300048914 | Ga0496111_0261394 | Ga0496111_0261394_170_406 | 76 |
| 523 | 3300048916 | Ga0496113_0024494 | Ga0496113_0024494_3290_3520 | 76 |
| 524 | 3300048917 | Ga0496114_0139373 | Ga0496114_0139373_137_373 | 76 |
| 525 | 3300048927 | Ga0496124_0213778 | Ga0496124_0213778_109_345 | 76 |
| 526 | 3300048928 | Ga0496125_0569553 | Ga0496125_0569553_329_565 | 76 |
| 527 | 3300049575 | Ga0501039_1235581 | Ga0501039_1235581_212_445 | 76 |
| 528 | 3300049576 | Ga0501040_0727388 | Ga0501040_0727388_227_460 | 76 |
| 529 | 3300049577 | Ga0501041_0400861 | Ga0501041_0400861_95_328 | 76 |
| 530 | 3300049578 | Ga0501042_0012990 | Ga0501042_0012990_1667_1900 | 76 |
| 531 | 3300049578 | Ga0501042_0591487 | Ga0501042_0591487_174_422 | 76 |
| 532 | 3300049582 | Ga0501048_0130907 | Ga0501048_0130907_1356_1589 | 76 |
| 533 | 3300049582 | Ga0501048_0161107 | Ga0501048_0161107_906_1145 | 76 |
| 534 | 3300049584 | Ga0501068_0172704 | Ga0501068_0172704_888_1130 | 76 |
| 535 | 3300049586 | Ga0501070_0984618 | Ga0501070_0984618_63_308 | 76 |
| 536 | 3300049587 | Ga0501071_0929582 | Ga0501071_0929582_398_628 | 76 |
| 537 | 3300049587 | Ga0501071_1267689 | Ga0501071_1267689_38_271 | 76 |
| 538 | 3300049588 | Ga0501072_0439462 | Ga0501072_0439462_301_540 | 76 |
| 539 | 3300049591 | Ga0501075_0017368 | Ga0501075_0017368_4107_4340 | 76 |
| 540 | 3300049591 | Ga0501075_0180639 | Ga0501075_0180639_856_1095 | 76 |
| 541 | 3300049592 | Ga0501076_0117122 | Ga0501076_0117122_687_917 | 76 |
| 542 | 3300049592 | Ga0501076_0288313 | Ga0501076_0288313_47_283 | 76 |
| 543 | 3300049593 | Ga0501077_0748187 | Ga0501077_0748187_295_531 | 76 |
| 544 | 3300049741 | Ga0501079_0455468 | Ga0501079_0455468_561_794 | 76 |
| 545 | 3300049741 | Ga0501079_0790074 | Ga0501079_0790074_450_689 | 76 |
| 546 | 3300049741 | Ga0501079_1122569 | Ga0501079_1122569_217_450 | 76 |
| 547 | 3300049742 | Ga0501080_0381272 | Ga0501080_0381272_252_485 | 76 |
| 548 | 3300049824 | Ga0501045_0224786 | Ga0501045_0224786_905_1144 | 76 |
| 549 | 3300050490 | nmdc:mga03n38_10548_c1 | nmdc:mga03n38_10548_c1_651_881 | 76 |
| 550 | 3300050490 | nmdc:mga03n38_47681_c2 | nmdc:mga03n38_47681_c2_806_1045 | 76 |
| 551 | 3300050490 | nmdc:mga03n38_61430_c1 | nmdc:mga03n38_61430_c1_1162_1401 | 76 |
| 552 | 3300050491 | nmdc:mga00v17_25448_c1 | nmdc:mga00v17_25448_c1_2570_2800 | 76 |
| 553 | 3300050492 | nmdc:mga0yw44_6820_c1 | nmdc:mga0yw44_6820_c1_1760_1990 | 76 |
| 554 | 3300050494 | nmdc:mga06z11_207518_c1 | nmdc:mga06z11_207518_c1_506_745 | 76 |
| 555 | 3300050494 | nmdc:mga06z11_415277_c1 | nmdc:mga06z11_415277_c1_267_497 | 76 |
| 556 | 3300050508 | nmdc:mga09592_892729_c1 | nmdc:mga09592_892729_c1_76_318 | 76 |
| 557 | 3300050509 | nmdc:mga0qj67_86299_c1 | nmdc:mga0qj67_86299_c1_733_966 | 76 |
| 558 | 3300050511 | nmdc:mga08y16_149057_c1 | nmdc:mga08y16_149057_c1_1092_1322 | 76 |
| 559 | 3300050514 | nmdc:mga08x19_792644_c1 | nmdc:mga08x19_792644_c1_314_559 | 76 |
| 560 | 3300050515 | nmdc:mga0a205_2672_c1 | nmdc:mga0a205_2672_c1_3278_3511 | 76 |
| 561 | 3300050515 | nmdc:mga0a205_352_c1 | nmdc:mga0a205_352_c1_26648_26881 | 76 |
| 562 | 3300053077 | Ga0495601_0000117 | Ga0495601_0000117_24528_24764 | 76 |
| 563 | 3300053077 | Ga0495601_0094742 | Ga0495601_0094742_52_288 | 76 |
| 564 | 3300053077 | Ga0495601_0240011 | Ga0495601_0240011_686_922 | 76 |
| 565 | 3300053077 | Ga0495601_0306246 | Ga0495601_0306246_678_911 | 76 |
| 566 | 3300053078 | Ga0495612_0002827 | Ga0495612_0002827_1941_2177 | 76 |
| 567 | 3300053078 | Ga0495612_0007001 | Ga0495612_0007001_944_1180 | 76 |
| 568 | 3300053083 | Ga0495655_0171405 | Ga0495655_0171405_140_385 | 76 |
| 569 | 3300053084 | Ga0495595_0663927 | Ga0495595_0663927_124_360 | 76 |
| 570 | 3300053085 | Ga0495619_0011185 | Ga0495619_0011185_4826_5059 | 76 |
| 571 | 3300053085 | Ga0495619_0157569 | Ga0495619_0157569_23_259 | 76 |
| 572 | 3300054114 | Ga0501084_0271515 | Ga0501084_0271515_782_1021 | 76 |
| 573 | 3300054114 | Ga0501084_0589316 | Ga0501084_0589316_313_546 | 76 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pui-assembly1.cif.gz_A | bola domain of sufe1 from arabidopsis thaliana | 0.8704 | 5 | 75 |
| 4pui-assembly2.cif.gz_B | bola domain of sufe1 from arabidopsis thaliana | 0.8688 | 4 | 75 |
| 3o2e-assembly1.cif.gz_A | crystal structure of a bol-like protein from babesia bovis | 0.8598 | 1 | 76 |
| 5nfl-assembly1.cif.gz_A | crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. | 0.8579 | 6 | 76 |
| 2mma-assembly1.cif.gz_B | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.8547 | 2 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9W6_1_84_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9397 | 2 | 75 | 3.30.300.90 |
| af_Q4DAW3_3_74_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9215 | 3 | 73 | 3.30.300.90 |
| af_Q67VQ4_70_166_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.9177 | 4 | 75 | 3.10.20.90 |
| af_Q53S33_27_107_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9108 | 4 | 76 | 3.30.300.90 |
| af_Q4DAW3_3_74_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.898 | 3 | 73 | 3.30.300.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838UW57-F1-model_v4 | BolA family transcriptional regulator | 0.9845 | 1 | 76 |
|
| AF-A0A838UW57-F1-model_v4 | BolA family transcriptional regulator | 0.9719 | 1 | 76 |
|
| AF-A0A2A5HRZ9-F1-model_v4 | Cell division protein BolA | 0.9688 | 2 | 75 |
GO:0051301
|
| AF-A0A3M1HI65-F1-model_v4 | BolA/IbaG family iron-sulfur metabolism protein | 0.9668 | 1 | 76 |
|
| AF-A0A2A4X5Y4-F1-model_v4 | BolA family transcriptional regulator | 0.9659 | 4 | 75 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar