F465102

General Info

Members Datasets Scaffolds Average Seq Length
572 262 1144 138

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0586107|Ga0466972_0586107_16_483
Length 155
Sequence MKLEARLFLILAVFCWIAAGVYAYWTGTQNPYGTQVCAAAHSGSCGKVEPVGVAALILSGGLLGISGSFFWFVSRRIDARPEDRLDAEIAEAAGELGFFSPGSYWPIGIAGAATVIGLGLAFVQTWLVLVGVLFVLFTVGGLLFEYYIGGRRPIA

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
249 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
250 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
251 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
252 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 3.67
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.94
Rhizosphere 93.36
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0586107 3300044658 Bacteria 527
2 LJQas_1023484 3300000549 Bacteria 717
3 LJQas_1046954 3300000549 Bacteria 516
4 JGI25404J52841_10083000 3300003659 Bacteria 670
5 Ga0058860_11941878 3300004801 Bacteria 1198
6 Ga0070658_10091297 3300005327 Bacteria 2510
7 Ga0070658_11414144 3300005327 Bacteria 604
8 Ga0070658_11916538 3300005327 Bacteria 512
9 Ga0070676_10255921 3300005328 Bacteria 1170
10 Ga0070683_101019290 3300005329 Bacteria 795
11 Ga0070670_100036062 3300005331 Bacteria 4257
12 Ga0068869_100002657 3300005334 Bacteria 10799
13 Ga0070666_10130810 3300005335 Bacteria 1744
14 Ga0070666_10252082 3300005335 Bacteria 1250
15 Ga0070680_100081588 3300005336 Bacteria 2668
16 Ga0070680_101193996 3300005336 Bacteria 658
17 Ga0070682_100039241 3300005337 Bacteria 2909
18 Ga0070682_102080106 3300005337 Bacteria 501
19 Ga0068868_100009620 3300005338 Bacteria 6972
20 Ga0068868_100066865 3300005338 Bacteria 2859
21 Ga0068868_102429377 3300005338 Bacteria 501
22 Ga0070660_100594567 3300005339 Bacteria 925
23 Ga0070660_100878125 3300005339 Bacteria 756
24 Ga0070689_100031832 3300005340 Bacteria 4009
25 Ga0070689_101162435 3300005340 Unclassified 692
26 Ga0070691_10000786 3300005341 Bacteria 12615
27 Ga0070687_100060373 3300005343 Bacteria 2000
28 Ga0070687_100356173 3300005343 Bacteria 946
29 Ga0070692_10028956 3300005345 Bacteria 2758
30 Ga0070692_10158584 3300005345 Bacteria 1294
31 Ga0070668_100014874 3300005347 Bacteria 5817
32 Ga0070668_100044885 3300005347 Bacteria 3391
33 Ga0070668_100413138 3300005347 Bacteria 1154
34 Ga0070669_100105814 3300005353 Bacteria 2129
35 Ga0070671_100005593 3300005355 Bacteria 10006
36 Ga0070671_100073007 3300005355 Bacteria 2866
37 Ga0070674_100259006 3300005356 Bacteria 1370
38 Ga0070673_100945580 3300005364 Bacteria 800
39 Ga0070688_100191004 3300005365 Bacteria 1427
40 Ga0070667_100052322 3300005367 Bacteria 3446
41 Ga0070667_100193271 3300005367 Bacteria 1804
42 Ga0070667_100563597 3300005367 Bacteria 1048
43 Ga0070709_10015372 3300005434 Bacteria 4353
44 Ga0070709_10020142 3300005434 Bacteria 3866
45 Ga0070709_10963591 3300005434 Bacteria 677
46 Ga0070714_100191123 3300005435 Bacteria 1868
47 Ga0070714_100199880 3300005435 Bacteria 1828
48 Ga0070714_101066412 3300005435 Bacteria 787
49 Ga0070713_100057115 3300005436 Bacteria 3248
50 Ga0070713_100463629 3300005436 Bacteria 1191
51 Ga0070710_10323864 3300005437 Bacteria 1013
52 Ga0070701_10029936 3300005438 Bacteria 2689
53 Ga0070701_10092170 3300005438 Bacteria 1662
54 Ga0070711_100037619 3300005439 Bacteria 3248
55 Ga0070711_100494346 3300005439 Bacteria 1008
56 Ga0070705_100048656 3300005440 Bacteria 2457
57 Ga0070700_100081110 3300005441 Bacteria 2095
58 Ga0070700_100289495 3300005441 Bacteria 1191
59 Ga0070694_100083321 3300005444 Bacteria 2228
60 Ga0070663_100032659 3300005455 Bacteria 3589
61 Ga0070663_101338907 3300005455 Bacteria 633
62 Ga0070678_100004093 3300005456 Bacteria 8214
63 Ga0070662_100092378 3300005457 Bacteria 2275
64 Ga0070662_101176037 3300005457 Bacteria 659
65 Ga0070681_10010142 3300005458 Bacteria 9289
66 Ga0070681_11635161 3300005458 Bacteria 570
67 Ga0068867_101301914 3300005459 Bacteria 671
68 Ga0070685_10061728 3300005466 Bacteria 2196
69 Ga0070707_101284586 3300005468 Bacteria 698
70 Ga0070679_100023841 3300005530 Bacteria 5995
71 Ga0070679_100328087 3300005530 Bacteria 1479
72 Ga0070684_100111191 3300005535 Bacteria 2457
73 Ga0070684_100783295 3300005535 Bacteria 891
74 Ga0070697_101820540 3300005536 Bacteria 545
75 Ga0068853_100109628 3300005539 Bacteria 2451
76 Ga0068853_100130084 3300005539 Bacteria 2253
77 Ga0068853_100435977 3300005539 Bacteria 1231
78 Ga0070672_100784076 3300005543 Bacteria 838
79 Ga0070686_100142899 3300005544 Bacteria 1668
80 Ga0070686_100221005 3300005544 Bacteria 1369
81 Ga0070696_100101690 3300005546 Bacteria 2060
82 Ga0070696_100274470 3300005546 Bacteria 1283
83 Ga0070693_100001271 3300005547 Bacteria 11405
84 Ga0070693_100036453 3300005547 Bacteria 2734
85 Ga0070665_100003985 3300005548 Bacteria 15573
86 Ga0070665_100006442 3300005548 Bacteria 11946
87 Ga0070665_100067614 3300005548 Bacteria 3583
88 Ga0070704_100100886 3300005549 Bacteria 2174
89 Ga0068855_100076368 3300005563 Bacteria 3888
90 Ga0068855_100118928 3300005563 Bacteria 3025
91 Ga0068855_100335385 3300005563 Bacteria 1668
92 Ga0070664_100436020 3300005564 Bacteria 1201
93 Ga0068857_100556605 3300005577 Bacteria 1081
94 Ga0068854_100983998 3300005578 Bacteria 746
95 Ga0068854_101438022 3300005578 Bacteria 624
96 Ga0068856_100009445 3300005614 Bacteria 9471
97 Ga0068856_100168688 3300005614 Bacteria 2200
98 Ga0068856_100260539 3300005614 Bacteria 1749
99 Ga0070702_100000618 3300005615 Bacteria 13083
100 Ga0070702_100291094 3300005615 Bacteria 1125
101 Ga0068852_100028321 3300005616 Bacteria 4583
102 Ga0068852_100245435 3300005616 Bacteria 1713
103 Ga0068852_101267600 3300005616 Bacteria 759
104 Ga0068859_100044321 3300005617 Bacteria 4469
105 Ga0068864_100144319 3300005618 Bacteria 2150
106 Ga0068866_10008051 3300005718 Bacteria 4428
107 Ga0068861_100040623 3300005719 Bacteria 3480
108 Ga0068870_10003589 3300005840 Bacteria 6582
109 Ga0068863_100004334 3300005841 Bacteria 13978
110 Ga0068863_100010783 3300005841 Bacteria 8865
111 Ga0068863_100121880 3300005841 Bacteria 2487
112 Ga0068858_100013321 3300005842 Bacteria 7756
113 Ga0068858_100108390 3300005842 Bacteria 2593
114 Ga0068858_101210704 3300005842 Bacteria 742
115 Ga0068858_102039493 3300005842 Bacteria 567
116 Ga0068860_100000043 3300005843 Bacteria 225862
117 Ga0068860_100177017 3300005843 Bacteria 2061
118 Ga0081455_10001264 3300005937 Bacteria 31592
119 Ga0081540_1000865 3300005983 Bacteria 27386
120 Ga0070717_10037835 3300006028 Bacteria 3919
121 Ga0070717_10059998 3300006028 Bacteria 3149
122 Ga0070717_10635485 3300006028 Bacteria 969
123 Ga0075432_10013154 3300006058 Bacteria 2811
124 Ga0075432_10315416 3300006058 Bacteria 653
125 Ga0070715_10269604 3300006163 Bacteria 898
126 Ga0070716_100039603 3300006173 Bacteria 2617
127 Ga0070716_100123863 3300006173 Bacteria 1623
128 Ga0070716_101549395 3300006173 Bacteria 543
129 Ga0070712_100021463 3300006175 Bacteria 4242
130 Ga0070712_100035940 3300006175 Bacteria 3367
131 Ga0070712_100924126 3300006175 Bacteria 753
132 Ga0070712_101111810 3300006175 Bacteria 686
133 Ga0097621_100223488 3300006237 Bacteria 1641
134 Ga0068871_100021881 3300006358 Bacteria 4923
135 Ga0068871_100092904 3300006358 Bacteria 2517
136 Ga0075428_100390522 3300006844 Bacteria 1492
137 Ga0075433_10004134 3300006852 Bacteria 11257
138 Ga0075433_10089680 3300006852 Bacteria 2717
139 Ga0075434_100034457 3300006871 Bacteria 4999
140 Ga0075434_100164923 3300006871 Bacteria 2235
141 Ga0068865_100052413 3300006881 Bacteria 2828
142 Ga0075436_100007449 3300006914 Bacteria 7485
143 Ga0097620_100044320 3300006931 Bacteria 4469
144 Ga0075435_100006974 3300007076 Bacteria 8021
145 Ga0075435_100468362 3300007076 Bacteria 1087
146 Ga0105251_10070574 3300009011 Bacteria 1627
147 Ga0105251_10108939 3300009011 Bacteria 1263
148 Ga0105240_10007675 3300009093 Bacteria 15616
149 Ga0105240_10074967 3300009093 Bacteria 4174
150 Ga0111539_10305120 3300009094 Bacteria 1852
151 Ga0111539_11716280 3300009094 Bacteria 728
152 Ga0105245_10015393 3300009098 Bacteria 6668
153 Ga0105245_10028224 3300009098 Bacteria 4947
154 Ga0105245_10191282 3300009098 Bacteria 1960
155 Ga0105245_12016066 3300009098 Bacteria 631
156 Ga0105247_10010522 3300009101 Bacteria 5590
157 Ga0105247_10041859 3300009101 Bacteria 2803
158 Ga0105243_10130338 3300009148 Bacteria 2132
159 Ga0105243_11124631 3300009148 Bacteria 795
160 Ga0105241_10006484 3300009174 Bacteria 8629
161 Ga0105241_10103501 3300009174 Bacteria 2267
162 Ga0105241_10233795 3300009174 Bacteria 1550
163 Ga0105241_11146830 3300009174 Bacteria 734
164 Ga0105242_10013872 3300009176 Bacteria 6234
165 Ga0105248_10007727 3300009177 Bacteria 11808
166 Ga0105248_10023874 3300009177 Bacteria 6796
167 Ga0105237_10041300 3300009545 Bacteria 4652
168 Ga0105237_10047800 3300009545 Bacteria 4302
169 Ga0105237_10198208 3300009545 Bacteria 2007
170 Ga0105237_11541147 3300009545 Bacteria 671
171 Ga0105237_12509740 3300009545 Bacteria 526
172 Ga0105238_10024646 3300009551 Bacteria 6132
173 Ga0105238_10355687 3300009551 Bacteria 1454
174 Ga0105238_10463196 3300009551 Bacteria 1265
175 Ga0105238_10505704 3300009551 Bacteria 1209
176 Ga0105238_10839192 3300009551 Bacteria 936
177 Ga0105249_10006110 3300009553 Bacteria 10443
178 Ga0105249_10700771 3300009553 Bacteria 1073
179 Ga0105239_10046044 3300010375 Bacteria 4779
180 Ga0105239_10081769 3300010375 Bacteria 3556
181 Ga0105239_10292288 3300010375 Bacteria 1835
182 Ga0105239_11661818 3300010375 Bacteria 739
183 Ga0105246_10002547 3300011119 Bacteria 11013
184 Ga0105246_10016176 3300011119 Bacteria 4720
185 Ga0157373_10070200 3300013100 Bacteria 2476
186 Ga0157373_10344591 3300013100 Bacteria 1062
187 Ga0157370_10029832 3300013104 Bacteria 5347
188 Ga0157370_10030547 3300013104 Bacteria 5278
189 Ga0157370_10052245 3300013104 Bacteria 3902
190 Ga0157369_10046164 3300013105 Bacteria 4735
191 Ga0157369_10113984 3300013105 Bacteria 2871
192 Ga0157369_10392457 3300013105 Bacteria 1440
193 Ga0157374_10235031 3300013296 Bacteria 1801
194 Ga0157378_10458735 3300013297 Bacteria 1266
195 Ga0163162_10592681 3300013306 Bacteria 1235
196 Ga0157372_10038120 3300013307 Bacteria 5303
197 Ga0157372_10289512 3300013307 Bacteria 1905
198 Ga0157372_10956821 3300013307 Bacteria 992
199 Ga0157372_12388060 3300013307 Bacteria 607
200 Ga0157375_10029533 3300013308 Bacteria 5157
201 Ga0157375_10158134 3300013308 Bacteria 2406
202 Ga0163163_10650541 3300014325 Bacteria 1117
203 Ga0163163_10718017 3300014325 Bacteria 1063
204 Ga0157380_10301526 3300014326 Bacteria 1476
205 Ga0157380_10901249 3300014326 Bacteria 910
206 Ga0157380_13116489 3300014326 Bacteria 529
207 Ga0182008_10236604 3300014497 Bacteria 938
208 Ga0157377_10008989 3300014745 Bacteria 4893
209 Ga0157377_10855383 3300014745 Bacteria 676
210 Ga0157379_10015459 3300014968 Bacteria 6697
211 Ga0157379_10108478 3300014968 Bacteria 2493
212 Ga0157379_10132864 3300014968 Bacteria 2241
213 Ga0157376_10080405 3300014969 Bacteria 2796
214 Ga0157376_10101832 3300014969 Bacteria 2511
215 Ga0157376_10115898 3300014969 Bacteria 2366
216 Ga0163161_10002128 3300017792 Bacteria 14298
217 Ga0197907_10136829 3300020069 Bacteria 1629
218 Ga0197907_11368393 3300020069 Bacteria 1879
219 Ga0206356_10222995 3300020070 Bacteria 3294
220 Ga0206356_11403114 3300020070 Bacteria 1289
221 Ga0206349_1227090 3300020075 Bacteria 995
222 Ga0206355_1444867 3300020076 Bacteria 934
223 Ga0206351_10955366 3300020077 Bacteria 1561
224 Ga0206352_10913702 3300020078 Bacteria 947
225 Ga0206350_10217387 3300020080 Bacteria 861
226 Ga0206354_10588150 3300020081 Bacteria 3497
227 Ga0206354_11043254 3300020081 Bacteria 1328
228 Ga0206354_11315285 3300020081 Bacteria 831
229 Ga0206353_10072159 3300020082 Bacteria 1791
230 Ga0206353_10200072 3300020082 Bacteria 1250
231 Ga0206353_11720015 3300020082 Bacteria 5779
232 Ga0206353_11798364 3300020082 Bacteria 569
233 Ga0154015_1460873 3300020610 Bacteria 521
234 Ga0224712_10031712 3300022467 Bacteria 1920
235 Ga0224712_10043142 3300022467 Bacteria 1713
236 Ga0224712_10194016 3300022467 Bacteria 920
237 Ga0207653_10055794 3300025885 Bacteria 1323
238 Ga0207642_10216137 3300025899 Bacteria 1068
239 Ga0207710_10029061 3300025900 Bacteria 2403
240 Ga0207710_10067517 3300025900 Bacteria 1633
241 Ga0207688_10001013 3300025901 Bacteria 14332
242 Ga0207688_10005075 3300025901 Bacteria 7158
243 Ga0207680_10002697 3300025903 Bacteria 8294
244 Ga0207680_10168218 3300025903 Bacteria 1475
245 Ga0207680_10199887 3300025903 Bacteria 1361
246 Ga0207647_10075363 3300025904 Bacteria 2031
247 Ga0207699_10074008 3300025906 Bacteria 2091
248 Ga0207645_10059576 3300025907 Bacteria 2438
249 Ga0207643_10000266 3300025908 Bacteria 36491
250 Ga0207705_10015216 3300025909 Bacteria 5527
251 Ga0207705_10571590 3300025909 Bacteria 879
252 Ga0207705_11541370 3300025909 Bacteria 502
253 Ga0207654_10007745 3300025911 Bacteria 5421
254 Ga0207654_10071472 3300025911 Bacteria 2063
255 Ga0207654_10084292 3300025911 Bacteria 1921
256 Ga0207707_10060948 3300025912 Bacteria 3282
257 Ga0207695_10226596 3300025913 Bacteria 1775
258 Ga0207671_10046662 3300025914 Bacteria 3206
259 Ga0207671_10079236 3300025914 Bacteria 2461
260 Ga0207693_10000246 3300025915 Bacteria 50005
261 Ga0207693_10019109 3300025915 Bacteria 5453
262 Ga0207693_10875748 3300025915 Bacteria 690
263 Ga0207663_10041971 3300025916 Bacteria 2792
264 Ga0207663_10079718 3300025916 Bacteria 2139
265 Ga0207660_10067291 3300025917 Bacteria 2594
266 Ga0207662_10273635 3300025918 Bacteria 1115
267 Ga0207657_10085619 3300025919 Bacteria 2640
268 Ga0207657_10329852 3300025919 Bacteria 1205
269 Ga0207657_10395771 3300025919 Bacteria 1087
270 Ga0207649_10500275 3300025920 Bacteria 924
271 Ga0207652_10098544 3300025921 Bacteria 2578
272 Ga0207652_10496984 3300025921 Bacteria 1098
273 Ga0207652_10565270 3300025921 Bacteria 1021
274 Ga0207681_10202853 3300025923 Bacteria 1524
275 Ga0207694_10093792 3300025924 Bacteria 2371
276 Ga0207694_10593317 3300025924 Bacteria 931
277 Ga0207650_10037484 3300025925 Bacteria 3533
278 Ga0207659_10031412 3300025926 Bacteria 3635
279 Ga0207687_10061763 3300025927 Bacteria 2647
280 Ga0207687_10090896 3300025927 Bacteria 2226
281 Ga0207700_10166187 3300025928 Bacteria 1836
282 Ga0207664_10377100 3300025929 Bacteria 1259
283 Ga0207664_10581914 3300025929 Bacteria 1005
284 Ga0207664_11255620 3300025929 Bacteria 660
285 Ga0207664_11546501 3300025929 Bacteria 585
286 Ga0207644_10016941 3300025931 Bacteria 4910
287 Ga0207644_10068239 3300025931 Bacteria 2594
288 Ga0207644_10309246 3300025931 Bacteria 1275
289 Ga0207690_10096136 3300025932 Bacteria 2105
290 Ga0207706_10746075 3300025933 Bacteria 834
291 Ga0207686_10023531 3300025934 Bacteria 3560
292 Ga0207709_10742386 3300025935 Bacteria 788
293 Ga0207669_10161620 3300025937 Bacteria 1583
294 Ga0207669_10795883 3300025937 Bacteria 784
295 Ga0207704_10162630 3300025938 Bacteria 1590
296 Ga0207665_10000632 3300025939 Bacteria 23648
297 Ga0207665_10022786 3300025939 Bacteria 4122
298 Ga0207665_10496309 3300025939 Bacteria 942
299 Ga0207691_10378073 3300025940 Bacteria 1209
300 Ga0207711_10056954 3300025941 Bacteria 3359
301 Ga0207711_10098042 3300025941 Bacteria 2589
302 Ga0207689_10003430 3300025942 Bacteria 14473
303 Ga0207689_10003585 3300025942 Bacteria 14187
304 Ga0207661_10003241 3300025944 Bacteria 11278
305 Ga0207679_10004435 3300025945 Bacteria 8743
306 Ga0207667_10100431 3300025949 Bacteria 2984
307 Ga0207667_10129300 3300025949 Bacteria 2601
308 Ga0207667_10729630 3300025949 Bacteria 991
309 Ga0207651_10045479 3300025960 Bacteria 2945
310 Ga0207668_10083749 3300025972 Bacteria 2322
311 Ga0207668_10769912 3300025972 Bacteria 850
312 Ga0207640_10038272 3300025981 Bacteria 3025
313 Ga0207640_10591217 3300025981 Bacteria 938
314 Ga0207658_10224108 3300025986 Bacteria 1583
315 Ga0207677_10047684 3300026023 Bacteria 2878
316 Ga0207703_10011577 3300026035 Bacteria 6859
317 Ga0207703_10539152 3300026035 Bacteria 1099
318 Ga0207703_11748470 3300026035 Bacteria 598
319 Ga0207639_10064300 3300026041 Bacteria 2844
320 Ga0207639_10262888 3300026041 Bacteria 1510
321 Ga0207639_10470287 3300026041 Bacteria 1144
322 Ga0207639_10855503 3300026041 Bacteria 849
323 Ga0207678_10000359 3300026067 Bacteria 41383
324 Ga0207678_10008420 3300026067 Bacteria 9098
325 Ga0207678_10365985 3300026067 Bacteria 1245
326 Ga0207708_10007985 3300026075 Bacteria 7841
327 Ga0207702_10007229 3300026078 Bacteria 9497
328 Ga0207702_10010668 3300026078 Bacteria 7677
329 Ga0207702_10031472 3300026078 Bacteria 4421
330 Ga0207641_10002792 3300026088 Bacteria 15898
331 Ga0207641_10073560 3300026088 Bacteria 2945
332 Ga0207641_10140706 3300026088 Bacteria 2177
333 Ga0207641_10743113 3300026088 Bacteria 968
334 Ga0207648_11774559 3300026089 Bacteria 579
335 Ga0207676_10002781 3300026095 Bacteria 12441
336 Ga0207674_10294789 3300026116 Bacteria 1571
337 Ga0207674_10385335 3300026116 Bacteria 1355
338 Ga0207675_100121235 3300026118 Bacteria 2474
339 Ga0207675_100227421 3300026118 Bacteria 1799
340 Ga0207683_10003259 3300026121 Bacteria 14153
341 Ga0207683_10005481 3300026121 Bacteria 10872
342 Ga0207698_10019825 3300026142 Bacteria 4615
343 Ga0207698_11103438 3300026142 Bacteria 806
344 Ga0207428_10039547 3300027907 Bacteria 3830
345 Ga0207428_10755604 3300027907 Bacteria 693
346 Ga0268266_10021788 3300028379 Bacteria 5460
347 Ga0268266_10029320 3300028379 Bacteria 4678
348 Ga0268266_10071801 3300028379 Bacteria 3001
349 Ga0268264_10000027 3300028381 Bacteria 440852
350 Ga0307408_100172001 3300031548 Bacteria 1730
351 Ga0307408_100433895 3300031548 Bacteria 1136
352 Ga0307405_10634285 3300031731 Bacteria 876
353 Ga0307405_10789659 3300031731 Bacteria 794
354 Ga0307405_11160813 3300031731 Bacteria 666
355 Ga0307405_11443064 3300031731 Bacteria 603
356 Ga0307413_10698438 3300031824 Bacteria 842
357 Ga0307413_11042569 3300031824 Bacteria 703
358 Ga0307410_10070198 3300031852 Bacteria 2426
359 Ga0307410_10332669 3300031852 Bacteria 1208
360 Ga0307410_11032693 3300031852 Bacteria 710
361 Ga0307410_11148692 3300031852 Bacteria 675
362 Ga0307410_11305342 3300031852 Bacteria 635
363 Ga0307410_11622219 3300031852 Bacteria 572
364 Ga0307406_10050253 3300031901 Bacteria 2642
365 Ga0307406_10085718 3300031901 Bacteria 2107
366 Ga0307406_10184709 3300031901 Bacteria 1521
367 Ga0307406_10207636 3300031901 Bacteria 1447
368 Ga0307406_10479086 3300031901 Bacteria 1004
369 Ga0307406_10509528 3300031901 Bacteria 977
370 Ga0307407_10031605 3300031903 Bacteria 2869
371 Ga0307407_10053671 3300031903 Bacteria 2320
372 Ga0307407_10148038 3300031903 Bacteria 1522
373 Ga0307407_10167735 3300031903 Bacteria 1443
374 Ga0307407_10908504 3300031903 Bacteria 676
375 Ga0307407_10945035 3300031903 Bacteria 664
376 Ga0307407_11385841 3300031903 Bacteria 553
377 Ga0307412_10913276 3300031911 Bacteria 770
378 Ga0307412_11153679 3300031911 Bacteria 692
379 Ga0307409_100000443 3300031995 Bacteria 17564
380 Ga0307409_100086004 3300031995 Bacteria 2558
381 Ga0307409_100109900 3300031995 Bacteria 2309
382 Ga0307409_100118210 3300031995 Bacteria 2238
383 Ga0307409_100172096 3300031995 Bacteria 1907
384 Ga0307409_100225773 3300031995 Bacteria 1694
385 Ga0307409_100412392 3300031995 Bacteria 1293
386 Ga0307409_100476267 3300031995 Bacteria 1210
387 Ga0307409_100809187 3300031995 Bacteria 945
388 Ga0307409_100946815 3300031995 Bacteria 877
389 Ga0307409_101247441 3300031995 Bacteria 767
390 Ga0307409_102440389 3300031995 Bacteria 552
391 Ga0307416_100066989 3300032002 Bacteria 2959
392 Ga0307416_100120616 3300032002 Bacteria 2335
393 Ga0307416_100239256 3300032002 Bacteria 1757
394 Ga0307416_100295551 3300032002 Bacteria 1606
395 Ga0307416_100642420 3300032002 Bacteria 1145
396 Ga0307416_100846472 3300032002 Bacteria 1012
397 Ga0307416_100856376 3300032002 Bacteria 1007
398 Ga0307416_100948607 3300032002 Bacteria 962
399 Ga0307416_101629054 3300032002 Bacteria 750
400 Ga0307416_102272902 3300032002 Bacteria 643
401 Ga0307416_103158372 3300032002 Bacteria 551
402 Ga0307414_10086686 3300032004 Bacteria 2311
403 Ga0307414_10097320 3300032004 Bacteria 2204
404 Ga0307414_11026405 3300032004 Bacteria 760
405 Ga0307414_11073231 3300032004 Bacteria 743
406 Ga0307414_11378786 3300032004 Bacteria 655
407 Ga0307414_11482260 3300032004 Bacteria 631
408 Ga0307411_10407802 3300032005 Bacteria 1125
409 Ga0307411_10536156 3300032005 Bacteria 996
410 Ga0307411_10628006 3300032005 Bacteria 927
411 Ga0307411_10646637 3300032005 Bacteria 915
412 Ga0307411_11039866 3300032005 Bacteria 735
413 Ga0307411_11178948 3300032005 Bacteria 694
414 Ga0307411_11424093 3300032005 Bacteria 635
415 Ga0307411_11686970 3300032005 Bacteria 586
416 Ga0307415_100007385 3300032126 Bacteria 6009
417 Ga0307415_100055899 3300032126 Bacteria 2703
418 Ga0307415_100159901 3300032126 Bacteria 1745
419 Ga0307415_100208713 3300032126 Bacteria 1556
420 Ga0307415_100732915 3300032126 Bacteria 895
421 Ga0307415_100758643 3300032126 Bacteria 881
422 Ga0307415_100899609 3300032126 Bacteria 816
423 Ga0307415_101048208 3300032126 Bacteria 761
424 Ga0373928_0007626 3300035084 Bacteria 2090
425 Ga0373960_0008067 3300035121 Bacteria 2513
426 Ga0373942_0042244 3300035207 Bacteria 1249
427 Ga0373961_0047518 3300035241 Bacteria 1261
428 Ga0373962_0128426 3300035242 Bacteria 814
429 Ga0373931_0029563 3300035691 Bacteria 2814
430 Ga0373927_0028983 3300035695 Bacteria 3609
431 Ga0373925_0730040 3300037068 Bacteria 817
432 Ga0373925_0853018 3300037068 Unclassified 751
433 Ga0395899_0656641 3300037312 Bacteria 662
434 Ga0395900_0140995 3300037418 Bacteria 2468
435 Ga0395900_0509765 3300037418 Bacteria 1152
436 Ga0395898_0026620 3300037466 Bacteria 5817
437 Ga0395898_0946107 3300037466 Bacteria 799
438 Ga0395901_0010220 3300038443 Bacteria 9506
439 Ga0395901_0169526 3300038443 Bacteria 2291
440 Ga0395901_0398762 3300038443 Bacteria 1414
441 Ga0395901_1385511 3300038443 Bacteria 662
442 Ga0395901_2091754 3300038443 Bacteria 511
443 Ga0451855_2028803 3300041511 Bacteria 571
444 Ga0466972_0145623 3300044658 Bacteria 1115
445 Ga0466972_0242815 3300044658 Bacteria 842
446 Ga0466965_0032709 3300044683 Bacteria 2540
447 Ga0466965_0372204 3300044683 Bacteria 785
448 Ga0466965_0872550 3300044683 Bacteria 524
449 Ga0466966_0061218 3300044684 Bacteria 2375
450 Ga0466966_0069404 3300044684 Bacteria 2211
451 Ga0466966_0391520 3300044684 Bacteria 835
452 Ga0466966_0645369 3300044684 Bacteria 637
453 Ga0466961_0001008 3300044693 Bacteria 17382
454 Ga0466961_0045096 3300044693 Bacteria 2821
455 Ga0466961_0055989 3300044693 Bacteria 2513
456 Ga0466961_0063237 3300044693 Bacteria 2351
457 Ga0466961_0124682 3300044693 Bacteria 1616
458 Ga0466963_0006621 3300044694 Bacteria 6873
459 Ga0466963_0061641 3300044694 Bacteria 2508
460 Ga0466963_0182830 3300044694 Bacteria 1464
461 Ga0466963_0190104 3300044694 Bacteria 1434
462 Ga0466963_0315849 3300044694 Bacteria 1099
463 Ga0466963_0669457 3300044694 Bacteria 732
464 Ga0466963_0955186 3300044694 Bacteria 604
465 Ga0466964_0132315 3300044706 Bacteria 1137
466 Ga0466964_0295298 3300044706 Bacteria 815
467 Ga0466971_0079608 3300044719 Bacteria 1493
468 Ga0466971_0167370 3300044719 Bacteria 1030
469 Ga0466971_0198738 3300044719 Bacteria 946
470 Ga0466971_0219783 3300044719 Bacteria 900
471 Ga0466971_0334485 3300044719 Bacteria 731
472 Ga0466971_0422059 3300044719 Bacteria 652
473 Ga0466968_0289791 3300044735 Bacteria 785
474 Ga0466968_0623713 3300044735 Bacteria 546
475 Ga0466970_0082387 3300044765 Bacteria 1740
476 Ga0466970_0554590 3300044765 Bacteria 664
477 Ga0466970_0604601 3300044765 Bacteria 636
478 Ga0466957_0095068 3300044842 Bacteria 1871
479 Ga0466957_0263419 3300044842 Bacteria 1149
480 Ga0466957_0653243 3300044842 Bacteria 740
481 Ga0466960_0011938 3300044901 Bacteria 3654
482 Ga0466960_0047838 3300044901 Bacteria 2053
483 Ga0466960_0137819 3300044901 Bacteria 1293
484 Ga0466960_0198963 3300044901 Bacteria 1094
485 Ga0466960_0281110 3300044901 Bacteria 933
486 Ga0466960_0298556 3300044901 Bacteria 907
487 Ga0466960_0542251 3300044901 Bacteria 685
488 Ga0466959_0083999 3300045049 Bacteria 2292
489 Ga0466959_0218253 3300045049 Bacteria 1323
490 Ga0466959_0441686 3300045049 Bacteria 882
491 Ga0466959_0764440 3300045049 Bacteria 646
492 Ga0466959_0914148 3300045049 Bacteria 585
493 Ga0466959_1056196 3300045049 Bacteria 540
494 Ga0466958_0017753 3300045836 Bacteria 4119
495 Ga0466958_0072686 3300045836 Bacteria 2106
496 Ga0466958_0144619 3300045836 Bacteria 1498
497 Ga0466958_0290550 3300045836 Bacteria 1049
498 Ga0466967_0007555 3300045976 Bacteria 7852
499 Ga0466967_0057436 3300045976 Bacteria 3435
500 Ga0466967_0058737 3300045976 Bacteria 3401
501 Ga0466967_0069423 3300045976 Bacteria 3149
502 Ga0466967_0190217 3300045976 Bacteria 1939
503 Ga0466967_0219187 3300045976 Bacteria 1807
504 Ga0466967_0280291 3300045976 Bacteria 1599
505 Ga0466967_0363675 3300045976 Bacteria 1402
506 Ga0466967_0463131 3300045976 Bacteria 1240
507 Ga0466967_1404114 3300045976 Bacteria 695
508 Ga0466967_1630324 3300045976 Bacteria 642
509 Ga0466967_2508681 3300045976 Bacteria 510
510 Ga0495639_0546015 3300046475 Unclassified 594
511 Ga0495594_0014665 3300046499 Bacteria 4111
512 Ga0495631_0165103 3300046518 Bacteria 950
513 Ga0495654_0277087 3300046530 Bacteria 691
514 Ga0495656_0522576 3300046615 Bacteria 631
515 Ga0495624_0307712 3300046690 Bacteria 955
516 Ga0495615_0193142 3300048090 Bacteria 625
517 Ga0496100_0121439 3300048903 Bacteria 1828
518 Ga0496100_0149706 3300048903 Bacteria 1663
519 Ga0496100_1138533 3300048903 Bacteria 615
520 Ga0496100_1300153 3300048903 Bacteria 574
521 Ga0496101_0206692 3300048904 Bacteria 1520
522 Ga0496101_0788298 3300048904 Bacteria 750
523 Ga0496102_0057841 3300048905 Bacteria 3542
524 Ga0496102_0102290 3300048905 Bacteria 2663
525 Ga0496102_0472633 3300048905 Bacteria 1175
526 Ga0496102_0864249 3300048905 Bacteria 826
527 Ga0496103_0033003 3300048906 Bacteria 3162
528 Ga0496104_0019910 3300048907 Bacteria 6145
529 Ga0496104_0021901 3300048907 Bacteria 5869
530 Ga0496105_0015637 3300048908 Bacteria 6052
531 Ga0496105_0169795 3300048908 Bacteria 1788
532 Ga0496106_0020524 3300048909 Bacteria 4904
533 Ga0496106_0241477 3300048909 Bacteria 1443
534 Ga0496106_0855151 3300048909 Bacteria 720
535 Ga0496107_0114507 3300048910 Bacteria 1984
536 Ga0496108_0097626 3300048911 Bacteria 2503
537 Ga0496108_0479571 3300048911 Bacteria 1087
538 Ga0496109_0092433 3300048912 Bacteria 2798
539 Ga0496109_1637149 3300048912 Bacteria 578
540 Ga0496110_0010183 3300048913 Bacteria 7639
541 Ga0496110_0027386 3300048913 Bacteria 4885
542 Ga0496110_1881530 3300048913 Bacteria 508
543 Ga0496111_0057427 3300048914 Bacteria 2818
544 Ga0496111_0079692 3300048914 Bacteria 2389
545 Ga0496112_0396818 3300048915 Bacteria 1319
546 Ga0496113_0007120 3300048916 Bacteria 7162
547 Ga0496113_0025090 3300048916 Bacteria 4245
548 Ga0496114_0967230 3300048917 Bacteria 734
549 Ga0496115_0292652 3300048918 Bacteria 1335
550 Ga0496115_1291273 3300048918 Bacteria 544
551 Ga0496121_0018389 3300048924 Bacteria 7049
552 Ga0496126_0000072 3300048929 Bacteria 238130
553 Ga0501294_038099 3300049517 Bacteria 585
554 Ga0501207_116982 3300049654 Bacteria 550
555 Ga0501243_119492 3300049675 Bacteria 545
556 Ga0501253_066368 3300049683 Bacteria 789
557 Ga0501268_144525 3300049765 Bacteria 545
558 Ga0501035_0420570 3300049822 Bacteria 1109
559 Ga0501212_015407 3300049851 Bacteria 1140
560 Ga0501212_059607 3300049851 Bacteria 659
561 nmdc:mga06r32_1959702_c1 3300050510 Bacteria 520
562 nmdc:mga08y16_4458_c1 3300050511 Bacteria 14639
563 nmdc:mga08y16_904470_c1 3300050511 Bacteria 868
564 nmdc:mga0n895_18733_c1 3300050512 Bacteria 6415
565 nmdc:mga0n895_68858_c1 3300050512 Bacteria 3506
566 nmdc:mga0rr50_43898_c1 3300050513 Bacteria 3275
567 nmdc:mga08x19_7722_c1 3300050514 Bacteria 6388
568 nmdc:mga0a205_79151_c1 3300050515 Bacteria 3176
569 Ga0466962_0032869 3300061719 Bacteria 2482
570 Ga0466962_0074861 3300061719 Bacteria 1618
571 Ga0466962_0522108 3300061719 Bacteria 602
572 2623498522 2622736605 Bacteria 4992138
573 Ga0466972_0586107
574 LJQas_1023484
575 LJQas_1046954
576 JGI25404J52841_10083000
577 Ga0058860_11941878
578 Ga0070658_10091297
579 Ga0070658_11414144
580 Ga0070658_11916538
581 Ga0070676_10255921
582 Ga0070683_101019290
583 Ga0070670_100036062
584 Ga0068869_100002657
585 Ga0070666_10130810
586 Ga0070666_10252082
587 Ga0070680_100081588
588 Ga0070680_101193996
589 Ga0070682_100039241
590 Ga0070682_102080106
591 Ga0068868_100009620
592 Ga0068868_100066865
593 Ga0068868_102429377
594 Ga0070660_100594567
595 Ga0070660_100878125
596 Ga0070689_100031832
597 Ga0070689_101162435
598 Ga0070691_10000786
599 Ga0070687_100060373
600 Ga0070687_100356173
601 Ga0070692_10028956
602 Ga0070692_10158584
603 Ga0070668_100014874
604 Ga0070668_100044885
605 Ga0070668_100413138
606 Ga0070669_100105814
607 Ga0070671_100005593
608 Ga0070671_100073007
609 Ga0070674_100259006
610 Ga0070673_100945580
611 Ga0070688_100191004
612 Ga0070667_100052322
613 Ga0070667_100193271
614 Ga0070667_100563597
615 Ga0070709_10015372
616 Ga0070709_10020142
617 Ga0070709_10963591
618 Ga0070714_100191123
619 Ga0070714_100199880
620 Ga0070714_101066412
621 Ga0070713_100057115
622 Ga0070713_100463629
623 Ga0070710_10323864
624 Ga0070701_10029936
625 Ga0070701_10092170
626 Ga0070711_100037619
627 Ga0070711_100494346
628 Ga0070705_100048656
629 Ga0070700_100081110
630 Ga0070700_100289495
631 Ga0070694_100083321
632 Ga0070663_100032659
633 Ga0070663_101338907
634 Ga0070678_100004093
635 Ga0070662_100092378
636 Ga0070662_101176037
637 Ga0070681_10010142
638 Ga0070681_11635161
639 Ga0068867_101301914
640 Ga0070685_10061728
641 Ga0070707_101284586
642 Ga0070679_100023841
643 Ga0070679_100328087
644 Ga0070684_100111191
645 Ga0070684_100783295
646 Ga0070697_101820540
647 Ga0068853_100109628
648 Ga0068853_100130084
649 Ga0068853_100435977
650 Ga0070672_100784076
651 Ga0070686_100142899
652 Ga0070686_100221005
653 Ga0070696_100101690
654 Ga0070696_100274470
655 Ga0070693_100001271
656 Ga0070693_100036453
657 Ga0070665_100003985
658 Ga0070665_100006442
659 Ga0070665_100067614
660 Ga0070704_100100886
661 Ga0068855_100076368
662 Ga0068855_100118928
663 Ga0068855_100335385
664 Ga0070664_100436020
665 Ga0068857_100556605
666 Ga0068854_100983998
667 Ga0068854_101438022
668 Ga0068856_100009445
669 Ga0068856_100168688
670 Ga0068856_100260539
671 Ga0070702_100000618
672 Ga0070702_100291094
673 Ga0068852_100028321
674 Ga0068852_100245435
675 Ga0068852_101267600
676 Ga0068859_100044321
677 Ga0068864_100144319
678 Ga0068866_10008051
679 Ga0068861_100040623
680 Ga0068870_10003589
681 Ga0068863_100004334
682 Ga0068863_100010783
683 Ga0068863_100121880
684 Ga0068858_100013321
685 Ga0068858_100108390
686 Ga0068858_101210704
687 Ga0068858_102039493
688 Ga0068860_100000043
689 Ga0068860_100177017
690 Ga0081455_10001264
691 Ga0081540_1000865
692 Ga0070717_10037835
693 Ga0070717_10059998
694 Ga0070717_10635485
695 Ga0075432_10013154
696 Ga0075432_10315416
697 Ga0070715_10269604
698 Ga0070716_100039603
699 Ga0070716_100123863
700 Ga0070716_101549395
701 Ga0070712_100021463
702 Ga0070712_100035940
703 Ga0070712_100924126
704 Ga0070712_101111810
705 Ga0097621_100223488
706 Ga0068871_100021881
707 Ga0068871_100092904
708 Ga0075428_100390522
709 Ga0075433_10004134
710 Ga0075433_10089680
711 Ga0075434_100034457
712 Ga0075434_100164923
713 Ga0068865_100052413
714 Ga0075436_100007449
715 Ga0097620_100044320
716 Ga0075435_100006974
717 Ga0075435_100468362
718 Ga0105251_10070574
719 Ga0105251_10108939
720 Ga0105240_10007675
721 Ga0105240_10074967
722 Ga0111539_10305120
723 Ga0111539_11716280
724 Ga0105245_10015393
725 Ga0105245_10028224
726 Ga0105245_10191282
727 Ga0105245_12016066
728 Ga0105247_10010522
729 Ga0105247_10041859
730 Ga0105243_10130338
731 Ga0105243_11124631
732 Ga0105241_10006484
733 Ga0105241_10103501
734 Ga0105241_10233795
735 Ga0105241_11146830
736 Ga0105242_10013872
737 Ga0105248_10007727
738 Ga0105248_10023874
739 Ga0105237_10041300
740 Ga0105237_10047800
741 Ga0105237_10198208
742 Ga0105237_11541147
743 Ga0105237_12509740
744 Ga0105238_10024646
745 Ga0105238_10355687
746 Ga0105238_10463196
747 Ga0105238_10505704
748 Ga0105238_10839192
749 Ga0105249_10006110
750 Ga0105249_10700771
751 Ga0105239_10046044
752 Ga0105239_10081769
753 Ga0105239_10292288
754 Ga0105239_11661818
755 Ga0105246_10002547
756 Ga0105246_10016176
757 Ga0157373_10070200
758 Ga0157373_10344591
759 Ga0157370_10029832
760 Ga0157370_10030547
761 Ga0157370_10052245
762 Ga0157369_10046164
763 Ga0157369_10113984
764 Ga0157369_10392457
765 Ga0157374_10235031
766 Ga0157378_10458735
767 Ga0163162_10592681
768 Ga0157372_10038120
769 Ga0157372_10289512
770 Ga0157372_10956821
771 Ga0157372_12388060
772 Ga0157375_10029533
773 Ga0157375_10158134
774 Ga0163163_10650541
775 Ga0163163_10718017
776 Ga0157380_10301526
777 Ga0157380_10901249
778 Ga0157380_13116489
779 Ga0182008_10236604
780 Ga0157377_10008989
781 Ga0157377_10855383
782 Ga0157379_10015459
783 Ga0157379_10108478
784 Ga0157379_10132864
785 Ga0157376_10080405
786 Ga0157376_10101832
787 Ga0157376_10115898
788 Ga0163161_10002128
789 Ga0197907_10136829
790 Ga0197907_11368393
791 Ga0206356_10222995
792 Ga0206356_11403114
793 Ga0206349_1227090
794 Ga0206355_1444867
795 Ga0206351_10955366
796 Ga0206352_10913702
797 Ga0206350_10217387
798 Ga0206354_10588150
799 Ga0206354_11043254
800 Ga0206354_11315285
801 Ga0206353_10072159
802 Ga0206353_10200072
803 Ga0206353_11720015
804 Ga0206353_11798364
805 Ga0154015_1460873
806 Ga0224712_10031712
807 Ga0224712_10043142
808 Ga0224712_10194016
809 Ga0207653_10055794
810 Ga0207642_10216137
811 Ga0207710_10029061
812 Ga0207710_10067517
813 Ga0207688_10001013
814 Ga0207688_10005075
815 Ga0207680_10002697
816 Ga0207680_10168218
817 Ga0207680_10199887
818 Ga0207647_10075363
819 Ga0207699_10074008
820 Ga0207645_10059576
821 Ga0207643_10000266
822 Ga0207705_10015216
823 Ga0207705_10571590
824 Ga0207705_11541370
825 Ga0207654_10007745
826 Ga0207654_10071472
827 Ga0207654_10084292
828 Ga0207707_10060948
829 Ga0207695_10226596
830 Ga0207671_10046662
831 Ga0207671_10079236
832 Ga0207693_10000246
833 Ga0207693_10019109
834 Ga0207693_10875748
835 Ga0207663_10041971
836 Ga0207663_10079718
837 Ga0207660_10067291
838 Ga0207662_10273635
839 Ga0207657_10085619
840 Ga0207657_10329852
841 Ga0207657_10395771
842 Ga0207649_10500275
843 Ga0207652_10098544
844 Ga0207652_10496984
845 Ga0207652_10565270
846 Ga0207681_10202853
847 Ga0207694_10093792
848 Ga0207694_10593317
849 Ga0207650_10037484
850 Ga0207659_10031412
851 Ga0207687_10061763
852 Ga0207687_10090896
853 Ga0207700_10166187
854 Ga0207664_10377100
855 Ga0207664_10581914
856 Ga0207664_11255620
857 Ga0207664_11546501
858 Ga0207644_10016941
859 Ga0207644_10068239
860 Ga0207644_10309246
861 Ga0207690_10096136
862 Ga0207706_10746075
863 Ga0207686_10023531
864 Ga0207709_10742386
865 Ga0207669_10161620
866 Ga0207669_10795883
867 Ga0207704_10162630
868 Ga0207665_10000632
869 Ga0207665_10022786
870 Ga0207665_10496309
871 Ga0207691_10378073
872 Ga0207711_10056954
873 Ga0207711_10098042
874 Ga0207689_10003430
875 Ga0207689_10003585
876 Ga0207661_10003241
877 Ga0207679_10004435
878 Ga0207667_10100431
879 Ga0207667_10129300
880 Ga0207667_10729630
881 Ga0207651_10045479
882 Ga0207668_10083749
883 Ga0207668_10769912
884 Ga0207640_10038272
885 Ga0207640_10591217
886 Ga0207658_10224108
887 Ga0207677_10047684
888 Ga0207703_10011577
889 Ga0207703_10539152
890 Ga0207703_11748470
891 Ga0207639_10064300
892 Ga0207639_10262888
893 Ga0207639_10470287
894 Ga0207639_10855503
895 Ga0207678_10000359
896 Ga0207678_10008420
897 Ga0207678_10365985
898 Ga0207708_10007985
899 Ga0207702_10007229
900 Ga0207702_10010668
901 Ga0207702_10031472
902 Ga0207641_10002792
903 Ga0207641_10073560
904 Ga0207641_10140706
905 Ga0207641_10743113
906 Ga0207648_11774559
907 Ga0207676_10002781
908 Ga0207674_10294789
909 Ga0207674_10385335
910 Ga0207675_100121235
911 Ga0207675_100227421
912 Ga0207683_10003259
913 Ga0207683_10005481
914 Ga0207698_10019825
915 Ga0207698_11103438
916 Ga0207428_10039547
917 Ga0207428_10755604
918 Ga0268266_10021788
919 Ga0268266_10029320
920 Ga0268266_10071801
921 Ga0268264_10000027
922 Ga0307408_100172001
923 Ga0307408_100433895
924 Ga0307405_10634285
925 Ga0307405_10789659
926 Ga0307405_11160813
927 Ga0307405_11443064
928 Ga0307413_10698438
929 Ga0307413_11042569
930 Ga0307410_10070198
931 Ga0307410_10332669
932 Ga0307410_11032693
933 Ga0307410_11148692
934 Ga0307410_11305342
935 Ga0307410_11622219
936 Ga0307406_10050253
937 Ga0307406_10085718
938 Ga0307406_10184709
939 Ga0307406_10207636
940 Ga0307406_10479086
941 Ga0307406_10509528
942 Ga0307407_10031605
943 Ga0307407_10053671
944 Ga0307407_10148038
945 Ga0307407_10167735
946 Ga0307407_10908504
947 Ga0307407_10945035
948 Ga0307407_11385841
949 Ga0307412_10913276
950 Ga0307412_11153679
951 Ga0307409_100000443
952 Ga0307409_100086004
953 Ga0307409_100109900
954 Ga0307409_100118210
955 Ga0307409_100172096
956 Ga0307409_100225773
957 Ga0307409_100412392
958 Ga0307409_100476267
959 Ga0307409_100809187
960 Ga0307409_100946815
961 Ga0307409_101247441
962 Ga0307409_102440389
963 Ga0307416_100066989
964 Ga0307416_100120616
965 Ga0307416_100239256
966 Ga0307416_100295551
967 Ga0307416_100642420
968 Ga0307416_100846472
969 Ga0307416_100856376
970 Ga0307416_100948607
971 Ga0307416_101629054
972 Ga0307416_102272902
973 Ga0307416_103158372
974 Ga0307414_10086686
975 Ga0307414_10097320
976 Ga0307414_11026405
977 Ga0307414_11073231
978 Ga0307414_11378786
979 Ga0307414_11482260
980 Ga0307411_10407802
981 Ga0307411_10536156
982 Ga0307411_10628006
983 Ga0307411_10646637
984 Ga0307411_11039866
985 Ga0307411_11178948
986 Ga0307411_11424093
987 Ga0307411_11686970
988 Ga0307415_100007385
989 Ga0307415_100055899
990 Ga0307415_100159901
991 Ga0307415_100208713
992 Ga0307415_100732915
993 Ga0307415_100758643
994 Ga0307415_100899609
995 Ga0307415_101048208
996 Ga0373928_0007626
997 Ga0373960_0008067
998 Ga0373942_0042244
999 Ga0373961_0047518
1000 Ga0373962_0128426
1001 Ga0373931_0029563
1002 Ga0373927_0028983
1003 Ga0373925_0730040
1004 Ga0373925_0853018
1005 Ga0395899_0656641
1006 Ga0395900_0140995
1007 Ga0395900_0509765
1008 Ga0395898_0026620
1009 Ga0395898_0946107
1010 Ga0395901_0010220
1011 Ga0395901_0169526
1012 Ga0395901_0398762
1013 Ga0395901_1385511
1014 Ga0395901_2091754
1015 Ga0451855_2028803
1016 Ga0466972_0145623
1017 Ga0466972_0242815
1018 Ga0466965_0032709
1019 Ga0466965_0372204
1020 Ga0466965_0872550
1021 Ga0466966_0061218
1022 Ga0466966_0069404
1023 Ga0466966_0391520
1024 Ga0466966_0645369
1025 Ga0466961_0001008
1026 Ga0466961_0045096
1027 Ga0466961_0055989
1028 Ga0466961_0063237
1029 Ga0466961_0124682
1030 Ga0466963_0006621
1031 Ga0466963_0061641
1032 Ga0466963_0182830
1033 Ga0466963_0190104
1034 Ga0466963_0315849
1035 Ga0466963_0669457
1036 Ga0466963_0955186
1037 Ga0466964_0132315
1038 Ga0466964_0295298
1039 Ga0466971_0079608
1040 Ga0466971_0167370
1041 Ga0466971_0198738
1042 Ga0466971_0219783
1043 Ga0466971_0334485
1044 Ga0466971_0422059
1045 Ga0466968_0289791
1046 Ga0466968_0623713
1047 Ga0466970_0082387
1048 Ga0466970_0554590
1049 Ga0466970_0604601
1050 Ga0466957_0095068
1051 Ga0466957_0263419
1052 Ga0466957_0653243
1053 Ga0466960_0011938
1054 Ga0466960_0047838
1055 Ga0466960_0137819
1056 Ga0466960_0198963
1057 Ga0466960_0281110
1058 Ga0466960_0298556
1059 Ga0466960_0542251
1060 Ga0466959_0083999
1061 Ga0466959_0218253
1062 Ga0466959_0441686
1063 Ga0466959_0764440
1064 Ga0466959_0914148
1065 Ga0466959_1056196
1066 Ga0466958_0017753
1067 Ga0466958_0072686
1068 Ga0466958_0144619
1069 Ga0466958_0290550
1070 Ga0466967_0007555
1071 Ga0466967_0057436
1072 Ga0466967_0058737
1073 Ga0466967_0069423
1074 Ga0466967_0190217
1075 Ga0466967_0219187
1076 Ga0466967_0280291
1077 Ga0466967_0363675
1078 Ga0466967_0463131
1079 Ga0466967_1404114
1080 Ga0466967_1630324
1081 Ga0466967_2508681
1082 Ga0495639_0546015
1083 Ga0495594_0014665
1084 Ga0495631_0165103
1085 Ga0495654_0277087
1086 Ga0495656_0522576
1087 Ga0495624_0307712
1088 Ga0495615_0193142
1089 Ga0496100_0121439
1090 Ga0496100_0149706
1091 Ga0496100_1138533
1092 Ga0496100_1300153
1093 Ga0496101_0206692
1094 Ga0496101_0788298
1095 Ga0496102_0057841
1096 Ga0496102_0102290
1097 Ga0496102_0472633
1098 Ga0496102_0864249
1099 Ga0496103_0033003
1100 Ga0496104_0019910
1101 Ga0496104_0021901
1102 Ga0496105_0015637
1103 Ga0496105_0169795
1104 Ga0496106_0020524
1105 Ga0496106_0241477
1106 Ga0496106_0855151
1107 Ga0496107_0114507
1108 Ga0496108_0097626
1109 Ga0496108_0479571
1110 Ga0496109_0092433
1111 Ga0496109_1637149
1112 Ga0496110_0010183
1113 Ga0496110_0027386
1114 Ga0496110_1881530
1115 Ga0496111_0057427
1116 Ga0496111_0079692
1117 Ga0496112_0396818
1118 Ga0496113_0007120
1119 Ga0496113_0025090
1120 Ga0496114_0967230
1121 Ga0496115_0292652
1122 Ga0496115_1291273
1123 Ga0496121_0018389
1124 Ga0496126_0000072
1125 Ga0501294_038099
1126 Ga0501207_116982
1127 Ga0501243_119492
1128 Ga0501253_066368
1129 Ga0501268_144525
1130 Ga0501035_0420570
1131 Ga0501212_015407
1132 Ga0501212_059607
1133 nmdc:mga06r32_1959702_c1
1134 nmdc:mga08y16_4458_c1
1135 nmdc:mga08y16_904470_c1
1136 nmdc:mga0n895_18733_c1
1137 nmdc:mga0n895_68858_c1
1138 nmdc:mga0rr50_43898_c1
1139 nmdc:mga08x19_7722_c1
1140 nmdc:mga0a205_79151_c1
1141 Ga0466962_0032869
1142 Ga0466962_0074861
1143 Ga0466962_0522108
1144 2623498522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12270

Cyt_c_ox_IV

Cytochrome c oxidase subunit IV

1

152

0.99

Map