F465097

General Info

Members Datasets Scaffolds Average Seq Length
572 198 1144 149

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0275510|Ga0436361_0275510_157_558
Length 133
Sequence MTQVLQGRCLCGAVRYQCHGRPLSVTYCYCKTCQLAAGAPVYLGALFAAGAVRWQGATTAYRSSPQGLRHFCPACGSTLFYECTDGSGRVEVTVATLEQPALLPPECHEWTASAIPWFHVEDDLPRHAQAGPD

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.02
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0275510 3300039447 Bacteria 1217
2 JGI24740J21852_10011126 3300001979 Bacteria 3436
3 JGI24735J21928_10047278 3300002067 Bacteria 1247
4 rootL2_10206110 3300003322 Bacteria 2194
5 rootH1_10009952 3300003323 Bacteria 1864
6 Ga0070658_10000089 3300005327 Bacteria 83791
7 Ga0070658_10001337 3300005327 Bacteria 21022
8 Ga0070658_10062626 3300005327 Bacteria 3031
9 Ga0070658_10082348 3300005327 Bacteria 2644
10 Ga0070658_10180103 3300005327 Bacteria 1778
11 Ga0070658_10239781 3300005327 Bacteria 1537
12 Ga0070658_10430416 3300005327 Bacteria 1136
13 Ga0070658_11182477 3300005327 Bacteria 665
14 Ga0070658_11245588 3300005327 Bacteria 646
15 Ga0070658_11632050 3300005327 Unclassified 558
16 Ga0070676_10139551 3300005328 Bacteria 1541
17 Ga0070683_100057584 3300005329 Bacteria 3610
18 Ga0070683_100140472 3300005329 Bacteria 2288
19 Ga0070683_100141471 3300005329 Bacteria 2280
20 Ga0070690_100006964 3300005330 Bacteria 6438
21 Ga0070670_100273794 3300005331 Bacteria 1473
22 Ga0070677_10035844 3300005333 Bacteria 1926
23 Ga0068869_100630038 3300005334 Bacteria 908
24 Ga0070666_10001385 3300005335 Bacteria 14676
25 Ga0070666_10040246 3300005335 Bacteria 3119
26 Ga0070666_10045851 3300005335 Bacteria 2930
27 Ga0070666_10304396 3300005335 Bacteria 1135
28 Ga0070680_100001656 3300005336 Bacteria 16289
29 Ga0070680_100002141 3300005336 Bacteria 14601
30 Ga0070680_100188582 3300005336 Bacteria 1737
31 Ga0070680_100432355 3300005336 Bacteria 1123
32 Ga0070680_100594076 3300005336 Bacteria 950
33 Ga0070680_101530251 3300005336 Bacteria 578
34 Ga0070682_101034620 3300005337 Unclassified 684
35 Ga0068868_100112955 3300005338 Bacteria 2208
36 Ga0068868_101059006 3300005338 Unclassified 744
37 Ga0070660_100000370 3300005339 Bacteria 30017
38 Ga0070660_100006802 3300005339 Bacteria 7935
39 Ga0070660_100008286 3300005339 Bacteria 7265
40 Ga0070660_100021588 3300005339 Bacteria 4750
41 Ga0070660_100044463 3300005339 Bacteria 3397
42 Ga0070660_100115980 3300005339 Bacteria 2135
43 Ga0070660_100137423 3300005339 Bacteria 1959
44 Ga0070660_100162775 3300005339 Bacteria 1798
45 Ga0070660_100634264 3300005339 Bacteria 894
46 Ga0070660_100703190 3300005339 Bacteria 847
47 Ga0070660_101369078 3300005339 Unclassified 601
48 Ga0070660_101524423 3300005339 Bacteria 568
49 Ga0070689_100248246 3300005340 Bacteria 1468
50 Ga0070689_100703186 3300005340 Bacteria 883
51 Ga0070687_100921413 3300005343 Bacteria 628
52 Ga0070661_100031071 3300005344 Bacteria 3861
53 Ga0070661_100066751 3300005344 Bacteria 2643
54 Ga0070661_100086827 3300005344 Bacteria 2313
55 Ga0070661_100118540 3300005344 Bacteria 1981
56 Ga0070661_100162314 3300005344 Bacteria 1693
57 Ga0070661_100331321 3300005344 Bacteria 1191
58 Ga0070661_100412398 3300005344 Bacteria 1070
59 Ga0070661_100597509 3300005344 Bacteria 892
60 Ga0070692_10019861 3300005345 Bacteria 3248
61 Ga0070692_10027855 3300005345 Bacteria 2805
62 Ga0070692_10033411 3300005345 Bacteria 2592
63 Ga0070692_10034904 3300005345 Bacteria 2543
64 Ga0070692_10083493 3300005345 Bacteria 1725
65 Ga0070668_101132481 3300005347 Bacteria 707
66 Ga0070675_100024944 3300005354 Bacteria 4792
67 Ga0070675_100235491 3300005354 Bacteria 1598
68 Ga0070671_100015288 3300005355 Bacteria 6198
69 Ga0070671_100019967 3300005355 Bacteria 5459
70 Ga0070671_100060140 3300005355 Bacteria 3163
71 Ga0070671_100774712 3300005355 Bacteria 834
72 Ga0070674_100125355 3300005356 Bacteria 1906
73 Ga0070674_100156556 3300005356 Bacteria 1725
74 Ga0070673_100023766 3300005364 Bacteria 4483
75 Ga0070673_100057526 3300005364 Bacteria 3072
76 Ga0070673_100063612 3300005364 Bacteria 2936
77 Ga0070688_100502509 3300005365 Bacteria 915
78 Ga0070659_100016083 3300005366 Bacteria 5613
79 Ga0070659_100020273 3300005366 Bacteria 5048
80 Ga0070659_100043164 3300005366 Bacteria 3526
81 Ga0070659_100053831 3300005366 Bacteria 3168
82 Ga0070659_100180466 3300005366 Bacteria 1732
83 Ga0070659_100287069 3300005366 Bacteria 1370
84 Ga0070659_100368678 3300005366 Bacteria 1208
85 Ga0070659_100517972 3300005366 Bacteria 1018
86 Ga0070659_100562534 3300005366 Bacteria 977
87 Ga0070659_101212071 3300005366 Unclassified 668
88 Ga0070667_100069075 3300005367 Bacteria 3006
89 Ga0070709_10127925 3300005434 Bacteria 1730
90 Ga0070714_100029637 3300005435 Bacteria 4549
91 Ga0070714_100084080 3300005435 Bacteria 2776
92 Ga0070714_100085756 3300005435 Bacteria 2751
93 Ga0070714_100222924 3300005435 Bacteria 1734
94 Ga0070713_100235553 3300005436 Bacteria 1665
95 Ga0070663_100016348 3300005455 Bacteria 4816
96 Ga0070663_100021475 3300005455 Bacteria 4294
97 Ga0070663_100116325 3300005455 Bacteria 2015
98 Ga0070663_100723866 3300005455 Bacteria 847
99 Ga0070678_100030137 3300005456 Bacteria 3725
100 Ga0070678_100121247 3300005456 Bacteria 2062
101 Ga0070678_100248484 3300005456 Bacteria 1490
102 Ga0070662_100022817 3300005457 Bacteria 4291
103 Ga0070662_100061797 3300005457 Bacteria 2735
104 Ga0070662_100072326 3300005457 Bacteria 2545
105 Ga0070662_100169956 3300005457 Bacteria 1711
106 Ga0070662_100202019 3300005457 Bacteria 1578
107 Ga0070681_10035858 3300005458 Bacteria 4982
108 Ga0070681_10043192 3300005458 Bacteria 4516
109 Ga0068867_100068699 3300005459 Bacteria 2644
110 Ga0068867_100127395 3300005459 Bacteria 1974
111 Ga0070685_10641212 3300005466 Unclassified 769
112 Ga0070679_100036536 3300005530 Bacteria 4875
113 Ga0070679_100038725 3300005530 Bacteria 4739
114 Ga0070679_100205012 3300005530 Bacteria 1936
115 Ga0070679_100508430 3300005530 Bacteria 1149
116 Ga0070679_100709405 3300005530 Bacteria 949
117 Ga0070679_100746291 3300005530 Bacteria 922
118 Ga0070679_100765542 3300005530 Bacteria 908
119 Ga0070684_100274134 3300005535 Bacteria 1545
120 Ga0070684_100867836 3300005535 Bacteria 845
121 Ga0068853_100115646 3300005539 Bacteria 2387
122 Ga0068853_100151790 3300005539 Bacteria 2086
123 Ga0068853_100539128 3300005539 Bacteria 1104
124 Ga0068853_101190892 3300005539 Bacteria 735
125 Ga0068853_101265897 3300005539 Bacteria 713
126 Ga0070672_100016896 3300005543 Bacteria 5236
127 Ga0070672_100115857 3300005543 Bacteria 2189
128 Ga0070672_100219463 3300005543 Bacteria 1594
129 Ga0070686_100139000 3300005544 Bacteria 1688
130 Ga0070693_100384747 3300005547 Bacteria 969
131 Ga0070665_100249504 3300005548 Bacteria 1776
132 Ga0070665_100602386 3300005548 Bacteria 1112
133 Ga0068855_100003774 3300005563 Bacteria 18527
134 Ga0068855_100057619 3300005563 Bacteria 4553
135 Ga0068855_100339628 3300005563 Bacteria 1656
136 Ga0068855_100686815 3300005563 Bacteria 1097
137 Ga0068855_100804786 3300005563 Bacteria 999
138 Ga0068855_101294666 3300005563 Bacteria 755
139 Ga0068855_102371888 3300005563 Bacteria 530
140 Ga0070664_100013131 3300005564 Bacteria 6741
141 Ga0070664_100038432 3300005564 Bacteria 4028
142 Ga0070664_100066409 3300005564 Bacteria 3080
143 Ga0070664_100151229 3300005564 Bacteria 2049
144 Ga0070664_100368229 3300005564 Bacteria 1309
145 Ga0068857_100330913 3300005577 Bacteria 1408
146 Ga0068854_100155884 3300005578 Bacteria 1764
147 Ga0068854_100190283 3300005578 Bacteria 1607
148 Ga0068854_100192047 3300005578 Bacteria 1600
149 Ga0068854_100199547 3300005578 Bacteria 1572
150 Ga0068854_100250908 3300005578 Bacteria 1413
151 Ga0068854_100252476 3300005578 Bacteria 1409
152 Ga0068856_100043406 3300005614 Bacteria 4424
153 Ga0068856_100104491 3300005614 Bacteria 2826
154 Ga0068856_100166096 3300005614 Bacteria 2218
155 Ga0068856_100338511 3300005614 Bacteria 1523
156 Ga0068856_100357177 3300005614 Bacteria 1480
157 Ga0068856_100444878 3300005614 Bacteria 1316
158 Ga0068856_100631484 3300005614 Bacteria 1092
159 Ga0068856_100749556 3300005614 Bacteria 996
160 Ga0070702_100238623 3300005615 Bacteria 1226
161 Ga0070702_101282897 3300005615 Unclassified 594
162 Ga0068852_100002941 3300005616 Bacteria 11835
163 Ga0068852_100028994 3300005616 Bacteria 4539
164 Ga0068852_100042361 3300005616 Bacteria 3854
165 Ga0068852_100042644 3300005616 Bacteria 3842
166 Ga0068852_100057607 3300005616 Bacteria 3362
167 Ga0068852_100111096 3300005616 Bacteria 2492
168 Ga0068852_100486783 3300005616 Bacteria 1227
169 Ga0068859_100031011 3300005617 Bacteria 5366
170 Ga0068864_100135679 3300005618 Bacteria 2216
171 Ga0068864_100149984 3300005618 Bacteria 2111
172 Ga0068864_100369092 3300005618 Bacteria 1358
173 Ga0068866_10040112 3300005718 Bacteria 2316
174 Ga0068866_10223436 3300005718 Bacteria 1138
175 Ga0068866_10529227 3300005718 Bacteria 785
176 Ga0068861_101379303 3300005719 Unclassified 688
177 Ga0068851_10042666 3300005834 Bacteria 2284
178 Ga0068851_10121754 3300005834 Bacteria 1403
179 Ga0068870_10270235 3300005840 Bacteria 1062
180 Ga0068863_100026068 3300005841 Bacteria 5578
181 Ga0068863_100335114 3300005841 Bacteria 1471
182 Ga0068858_100003616 3300005842 Bacteria 15296
183 Ga0068858_100127511 3300005842 Bacteria 2384
184 Ga0068860_100412385 3300005843 Bacteria 1338
185 Ga0070717_10086900 3300006028 Bacteria 2633
186 Ga0097621_100001731 3300006237 Bacteria 14928
187 Ga0068871_100010444 3300006358 Bacteria 6776
188 Ga0068871_100116058 3300006358 Bacteria 2257
189 Ga0068871_100605491 3300006358 Bacteria 997
190 Ga0068871_100817315 3300006358 Unclassified 860
191 Ga0068865_100184109 3300006881 Bacteria 1610
192 Ga0097620_100031010 3300006931 Bacteria 5366
193 Ga0105251_10183401 3300009011 Bacteria 943
194 Ga0105250_10159875 3300009092 Bacteria 940
195 Ga0105240_11358372 3300009093 Unclassified 748
196 Ga0105245_10122310 3300009098 Bacteria 2432
197 Ga0105245_10568627 3300009098 Bacteria 1157
198 Ga0105247_10163285 3300009101 Bacteria 1476
199 Ga0105247_10689261 3300009101 Bacteria 768
200 Ga0105243_10157559 3300009148 Bacteria 1954
201 Ga0105243_10335268 3300009148 Bacteria 1383
202 Ga0105242_10038073 3300009176 Bacteria 3865
203 Ga0105242_10480612 3300009176 Bacteria 1177
204 Ga0105248_10011252 3300009177 Bacteria 9867
205 Ga0105248_10016458 3300009177 Bacteria 8139
206 Ga0105248_10110406 3300009177 Bacteria 3101
207 Ga0105248_10169875 3300009177 Bacteria 2458
208 Ga0105248_10467434 3300009177 Bacteria 1422
209 Ga0105248_10543666 3300009177 Bacteria 1310
210 Ga0105237_10201268 3300009545 Bacteria 1991
211 Ga0105237_10427718 3300009545 Bacteria 1330
212 Ga0105238_10044539 3300009551 Bacteria 4485
213 Ga0105238_11219376 3300009551 Unclassified 777
214 Ga0105239_10407633 3300010375 Bacteria 1539
215 Ga0105246_10230910 3300011119 Bacteria 1457
216 Ga0105246_10722391 3300011119 Bacteria 875
217 Ga0157373_10015106 3300013100 Bacteria 5646
218 Ga0157373_10017114 3300013100 Bacteria 5278
219 Ga0157373_10054915 3300013100 Bacteria 2829
220 Ga0157373_10104334 3300013100 Bacteria 1994
221 Ga0157373_10113419 3300013100 Bacteria 1905
222 Ga0157373_10160137 3300013100 Bacteria 1584
223 Ga0157373_10435553 3300013100 Bacteria 942
224 Ga0157373_11159403 3300013100 Bacteria 581
225 Ga0157373_11201786 3300013100 Bacteria 571
226 Ga0157371_10001045 3300013102 Bacteria 30368
227 Ga0157371_10020077 3300013102 Bacteria 4920
228 Ga0157371_10056124 3300013102 Bacteria 2794
229 Ga0157371_10067683 3300013102 Bacteria 2527
230 Ga0157371_10067846 3300013102 Bacteria 2524
231 Ga0157371_10125533 3300013102 Bacteria 1825
232 Ga0157371_10139505 3300013102 Bacteria 1727
233 Ga0157371_10876445 3300013102 Bacteria 680
234 Ga0157370_10038666 3300013104 Bacteria 4615
235 Ga0157370_10168123 3300013104 Bacteria 2039
236 Ga0157370_10181930 3300013104 Bacteria 1953
237 Ga0157370_11146362 3300013104 Bacteria 702
238 Ga0157369_10558374 3300013105 Bacteria 1183
239 Ga0157369_11417845 3300013105 Bacteria 707
240 Ga0157374_10023300 3300013296 Bacteria 5536
241 Ga0157374_10299259 3300013296 Bacteria 1591
242 Ga0157378_10244644 3300013297 Bacteria 1715
243 Ga0157378_10516696 3300013297 Bacteria 1195
244 Ga0157378_11480096 3300013297 Bacteria 723
245 Ga0163162_10056677 3300013306 Bacteria 3946
246 Ga0163162_10145379 3300013306 Bacteria 2487
247 Ga0157372_10061275 3300013307 Bacteria 4212
248 Ga0157372_11668385 3300013307 Bacteria 733
249 Ga0157372_11973082 3300013307 Bacteria 671
250 Ga0157372_12879125 3300013307 Bacteria 551
251 Ga0157375_10128654 3300013308 Bacteria 2650
252 Ga0157375_10277654 3300013308 Bacteria 1838
253 Ga0157375_10600640 3300013308 Bacteria 1259
254 Ga0157375_10684039 3300013308 Bacteria 1180
255 Ga0157375_10969971 3300013308 Bacteria 991
256 Ga0157377_10185561 3300014745 Bacteria 1311
257 Ga0157377_10238316 3300014745 Bacteria 1173
258 Ga0157379_10048007 3300014968 Bacteria 3811
259 Ga0157379_10117707 3300014968 Bacteria 2390
260 Ga0157379_10529509 3300014968 Bacteria 1095
261 Ga0206355_1093801 3300020076 Bacteria 3230
262 Ga0213872_10107824 3300021361 Bacteria 1238
263 Ga0207673_1021131 3300025290 Bacteria 880
264 Ga0207697_10004028 3300025315 Bacteria 7119
265 Ga0207656_10202471 3300025321 Bacteria 959
266 Ga0207682_10021023 3300025893 Bacteria 2566
267 Ga0207692_10695358 3300025898 Unclassified 660
268 Ga0207642_10090712 3300025899 Bacteria 1509
269 Ga0207642_10575983 3300025899 Bacteria 698
270 Ga0207642_10670647 3300025899 Bacteria 651
271 Ga0207710_10051444 3300025900 Bacteria 1850
272 Ga0207688_10001582 3300025901 Bacteria 12004
273 Ga0207680_10002200 3300025903 Bacteria 9114
274 Ga0207680_10901957 3300025903 Bacteria 633
275 Ga0207647_10024949 3300025904 Bacteria 3936
276 Ga0207647_10106329 3300025904 Bacteria 1662
277 Ga0207647_10229107 3300025904 Bacteria 1069
278 Ga0207645_10006312 3300025907 Bacteria 8527
279 Ga0207645_10141939 3300025907 Bacteria 1565
280 Ga0207645_10415302 3300025907 Bacteria 906
281 Ga0207643_10015679 3300025908 Bacteria 4127
282 Ga0207705_10000140 3300025909 Bacteria 78223
283 Ga0207705_10000396 3300025909 Bacteria 38250
284 Ga0207705_10003020 3300025909 Bacteria 12827
285 Ga0207705_10004378 3300025909 Bacteria 10673
286 Ga0207705_10005699 3300025909 Bacteria 9306
287 Ga0207705_10005990 3300025909 Bacteria 9048
288 Ga0207705_10017467 3300025909 Bacteria 5138
289 Ga0207705_10033564 3300025909 Bacteria 3667
290 Ga0207705_10042597 3300025909 Bacteria 3259
291 Ga0207705_10052048 3300025909 Bacteria 2947
292 Ga0207705_10116261 3300025909 Bacteria 1980
293 Ga0207705_10117077 3300025909 Bacteria 1973
294 Ga0207705_10188012 3300025909 Bacteria 1561
295 Ga0207705_10201189 3300025909 Bacteria 1509
296 Ga0207705_10267183 3300025909 Bacteria 1307
297 Ga0207705_10499995 3300025909 Bacteria 944
298 Ga0207705_10807448 3300025909 Bacteria 728
299 Ga0207654_10299367 3300025911 Bacteria 1093
300 Ga0207654_10330010 3300025911 Bacteria 1045
301 Ga0207707_10052508 3300025912 Bacteria 3549
302 Ga0207707_10164004 3300025912 Bacteria 1942
303 Ga0207660_10042367 3300025917 Bacteria 3195
304 Ga0207660_10052158 3300025917 Bacteria 2911
305 Ga0207660_10057726 3300025917 Bacteria 2780
306 Ga0207660_10137881 3300025917 Bacteria 1863
307 Ga0207662_10478258 3300025918 Bacteria 855
308 Ga0207657_10000439 3300025919 Bacteria 44057
309 Ga0207657_10001011 3300025919 Bacteria 29944
310 Ga0207657_10001520 3300025919 Bacteria 24865
311 Ga0207657_10001550 3300025919 Bacteria 24636
312 Ga0207657_10001812 3300025919 Bacteria 23057
313 Ga0207657_10009941 3300025919 Bacteria 9520
314 Ga0207657_10013127 3300025919 Bacteria 8136
315 Ga0207657_10067811 3300025919 Bacteria 3032
316 Ga0207657_10101303 3300025919 Bacteria 2390
317 Ga0207657_10672078 3300025919 Bacteria 805
318 Ga0207657_10728745 3300025919 Viruses 769
319 Ga0207657_10738201 3300025919 Unclassified 763
320 Ga0207649_10032349 3300025920 Bacteria 3118
321 Ga0207649_10134809 3300025920 Bacteria 1682
322 Ga0207649_10136381 3300025920 Bacteria 1674
323 Ga0207649_10235982 3300025920 Bacteria 1310
324 Ga0207649_10248366 3300025920 Bacteria 1280
325 Ga0207649_10278043 3300025920 Bacteria 1216
326 Ga0207649_10687443 3300025920 Bacteria 793
327 Ga0207652_10005074 3300025921 Bacteria 10683
328 Ga0207652_10015650 3300025921 Bacteria 6174
329 Ga0207652_10283587 3300025921 Bacteria 1494
330 Ga0207652_10400695 3300025921 Bacteria 1238
331 Ga0207652_10743998 3300025921 Bacteria 873
332 Ga0207681_10730103 3300025923 Bacteria 825
333 Ga0207650_10200274 3300025925 Bacteria 1599
334 Ga0207650_10238756 3300025925 Bacteria 1468
335 Ga0207687_10216478 3300025927 Bacteria 1506
336 Ga0207687_10493376 3300025927 Bacteria 1021
337 Ga0207700_10226135 3300025928 Bacteria 1589
338 Ga0207664_10011978 3300025929 Bacteria 6190
339 Ga0207664_10016917 3300025929 Bacteria 5333
340 Ga0207664_10115241 3300025929 Bacteria 2240
341 Ga0207664_10338519 3300025929 Bacteria 1330
342 Ga0207644_10005765 3300025931 Bacteria 8057
343 Ga0207644_10011579 3300025931 Bacteria 5841
344 Ga0207644_10024947 3300025931 Bacteria 4107
345 Ga0207644_10120401 3300025931 Bacteria 1997
346 Ga0207690_10005824 3300025932 Bacteria 7291
347 Ga0207690_10029334 3300025932 Bacteria 3496
348 Ga0207690_10053410 3300025932 Bacteria 2711
349 Ga0207690_10089060 3300025932 Bacteria 2175
350 Ga0207690_10121860 3300025932 Bacteria 1896
351 Ga0207690_10210798 3300025932 Bacteria 1481
352 Ga0207690_10275730 3300025932 Bacteria 1308
353 Ga0207690_10305210 3300025932 Bacteria 1247
354 Ga0207706_10011796 3300025933 Bacteria 7959
355 Ga0207706_10074884 3300025933 Bacteria 2977
356 Ga0207706_10076213 3300025933 Bacteria 2950
357 Ga0207706_10080770 3300025933 Bacteria 2858
358 Ga0207706_10210874 3300025933 Bacteria 1703
359 Ga0207686_10064062 3300025934 Bacteria 2340
360 Ga0207670_10468118 3300025936 Bacteria 1019
361 Ga0207670_10478727 3300025936 Bacteria 1008
362 Ga0207669_10076550 3300025937 Bacteria 2124
363 Ga0207669_10488153 3300025937 Bacteria 983
364 Ga0207704_10086641 3300025938 Bacteria 2043
365 Ga0207665_10052776 3300025939 Bacteria 2739
366 Ga0207691_10007496 3300025940 Bacteria 10504
367 Ga0207691_10028898 3300025940 Bacteria 5188
368 Ga0207691_10033849 3300025940 Bacteria 4757
369 Ga0207711_10000174 3300025941 Bacteria 69263
370 Ga0207711_10030721 3300025941 Bacteria 4531
371 Ga0207711_10145277 3300025941 Bacteria 2137
372 Ga0207711_10419861 3300025941 Bacteria 1244
373 Ga0207711_10436432 3300025941 Bacteria 1219
374 Ga0207689_10051733 3300025942 Bacteria 3386
375 Ga0207661_10028488 3300025944 Bacteria 4278
376 Ga0207661_10126329 3300025944 Bacteria 2185
377 Ga0207661_10149301 3300025944 Bacteria 2019
378 Ga0207679_10030163 3300025945 Bacteria 3784
379 Ga0207679_10050240 3300025945 Bacteria 3046
380 Ga0207679_10059476 3300025945 Bacteria 2835
381 Ga0207667_10000237 3300025949 Bacteria 77017
382 Ga0207667_10020471 3300025949 Bacteria 7357
383 Ga0207667_10025506 3300025949 Bacteria 6468
384 Ga0207667_10408806 3300025949 Bacteria 1382
385 Ga0207667_10491865 3300025949 Bacteria 1245
386 Ga0207651_10036460 3300025960 Bacteria 3210
387 Ga0207651_10068598 3300025960 Bacteria 2500
388 Ga0207651_10432743 3300025960 Bacteria 1125
389 Ga0207640_10045362 3300025981 Bacteria 2822
390 Ga0207640_10107848 3300025981 Bacteria 1967
391 Ga0207640_10167439 3300025981 Bacteria 1633
392 Ga0207640_10540647 3300025981 Bacteria 977
393 Ga0207658_10016690 3300025986 Bacteria 5053
394 Ga0207658_10096730 3300025986 Bacteria 2303
395 Ga0207658_10344019 3300025986 Bacteria 1297
396 Ga0207677_10006756 3300026023 Bacteria 6301
397 Ga0207677_10067067 3300026023 Bacteria 2512
398 Ga0207677_10074646 3300026023 Bacteria 2407
399 Ga0207703_10002660 3300026035 Bacteria 15370
400 Ga0207703_10075535 3300026035 Bacteria 2793
401 Ga0207639_10054007 3300026041 Bacteria 3068
402 Ga0207639_10073460 3300026041 Bacteria 2681
403 Ga0207639_10079773 3300026041 Bacteria 2588
404 Ga0207639_10079962 3300026041 Bacteria 2585
405 Ga0207639_10475574 3300026041 Bacteria 1138
406 Ga0207678_10001296 3300026067 Bacteria 23150
407 Ga0207678_10002905 3300026067 Bacteria 15544
408 Ga0207678_10007675 3300026067 Bacteria 9531
409 Ga0207678_10011449 3300026067 Bacteria 7788
410 Ga0207678_10261136 3300026067 Bacteria 1484
411 Ga0207678_10306373 3300026067 Bacteria 1365
412 Ga0207678_10798388 3300026067 Bacteria 833
413 Ga0207678_10836837 3300026067 Unclassified 813
414 Ga0207702_10018639 3300026078 Bacteria 5742
415 Ga0207702_10200154 3300026078 Bacteria 1851
416 Ga0207702_10221789 3300026078 Bacteria 1762
417 Ga0207702_10362023 3300026078 Bacteria 1390
418 Ga0207702_10511209 3300026078 Bacteria 1172
419 Ga0207702_10586375 3300026078 Bacteria 1093
420 Ga0207648_10009271 3300026089 Bacteria 9456
421 Ga0207648_10015672 3300026089 Bacteria 6960
422 Ga0207648_10378766 3300026089 Bacteria 1279
423 Ga0207676_10108945 3300026095 Bacteria 2313
424 Ga0207676_10811457 3300026095 Bacteria 913
425 Ga0207674_10155024 3300026116 Bacteria 2246
426 Ga0207675_100401548 3300026118 Bacteria 1351
427 Ga0207683_10004702 3300026121 Bacteria 11769
428 Ga0207683_10006210 3300026121 Bacteria 10238
429 Ga0207698_10001748 3300026142 Bacteria 12668
430 Ga0207698_10024722 3300026142 Bacteria 4221
431 Ga0207698_10047850 3300026142 Bacteria 3243
432 Ga0207698_10103766 3300026142 Bacteria 2364
433 Ga0207698_10107742 3300026142 Bacteria 2327
434 Ga0207698_10189879 3300026142 Bacteria 1829
435 Ga0207698_10251285 3300026142 Bacteria 1618
436 Ga0207698_10263863 3300026142 Bacteria 1584
437 Ga0207698_11421994 3300026142 Unclassified 709
438 Ga0268266_10892891 3300028379 Bacteria 859
439 Ga0316182_1246566 3300030745 Bacteria 624
440 Ga0307408_101117075 3300031548 Bacteria 732
441 Ga0307413_10459782 3300031824 Bacteria 1012
442 Ga0307410_10670860 3300031852 Bacteria 871
443 Ga0307406_10444791 3300031901 Bacteria 1038
444 Ga0307409_100041443 3300031995 Bacteria 3439
445 Ga0307416_100803593 3300032002 Bacteria 1036
446 Ga0307416_101098746 3300032002 Bacteria 900
447 Ga0307415_100048806 3300032126 Bacteria 2858
448 Ga0307415_100210242 3300032126 Bacteria 1551
449 Ga0307415_100380076 3300032126 Bacteria 1199
450 Ga0373929_0044348 3300035085 Bacteria 998
451 Ga0373944_0104586 3300035089 Unclassified 960
452 Ga0373943_0000719 3300035170 Bacteria 14472
453 Ga0373946_0139674 3300035171 Bacteria 1122
454 Ga0373961_0059688 3300035241 Bacteria 1154
455 Ga0373931_0234158 3300035691 Bacteria 1111
456 Ga0373935_0013556 3300035692 Bacteria 4921
457 Ga0373935_0391095 3300035692 Bacteria 997
458 Ga0395899_0000261 3300037312 Bacteria 69173
459 Ga0395899_0001551 3300037312 Bacteria 19391
460 Ga0395899_0001565 3300037312 Bacteria 19264
461 Ga0395899_0007693 3300037312 Bacteria 8307
462 Ga0395899_0042684 3300037312 Bacteria 3384
463 Ga0395899_0045452 3300037312 Bacteria 3272
464 Ga0395899_0052173 3300037312 Bacteria 3033
465 Ga0395899_0216798 3300037312 Bacteria 1327
466 Ga0395899_0403728 3300037312 Bacteria 903
467 Ga0395899_0623234 3300037312 Bacteria 684
468 Ga0395900_0000036 3300037418 Bacteria 250619
469 Ga0395900_0001028 3300037418 Bacteria 35775
470 Ga0395900_0003248 3300037418 Bacteria 17598
471 Ga0395900_0010232 3300037418 Bacteria 9592
472 Ga0395900_0019624 3300037418 Bacteria 6892
473 Ga0395900_0022704 3300037418 Bacteria 6421
474 Ga0395900_0037975 3300037418 Bacteria 4965
475 Ga0395900_0089620 3300037418 Bacteria 3161
476 Ga0395900_0343895 3300037418 Bacteria 1466
477 Ga0395900_0364515 3300037418 Bacteria 1416
478 Ga0395900_0365484 3300037418 Bacteria 1413
479 Ga0395900_0616267 3300037418 Bacteria 1024
480 Ga0395900_0631041 3300037418 Bacteria 1010
481 Ga0395898_0003335 3300037466 Bacteria 18024
482 Ga0395898_0004926 3300037466 Bacteria 14492
483 Ga0395898_0007247 3300037466 Bacteria 11769
484 Ga0395898_0011855 3300037466 Bacteria 9029
485 Ga0395898_0060684 3300037466 Bacteria 3674
486 Ga0395898_0074580 3300037466 Bacteria 3277
487 Ga0395898_0107806 3300037466 Bacteria 2671
488 Ga0395898_0450738 3300037466 Bacteria 1225
489 Ga0395898_0962135 3300037466 Bacteria 790
490 Ga0395898_1483263 3300037466 Unclassified 604
491 Ga0395905_0000006 3300037471 Bacteria 549428
492 Ga0395905_0006062 3300037471 Bacteria 12239
493 Ga0395905_0015015 3300037471 Bacteria 7381
494 Ga0395905_0015607 3300037471 Bacteria 7217
495 Ga0395905_0023156 3300037471 Bacteria 5871
496 Ga0395905_0041889 3300037471 Bacteria 4297
497 Ga0395905_0086724 3300037471 Bacteria 2934
498 Ga0395905_0126564 3300037471 Bacteria 2402
499 Ga0395905_0208736 3300037471 Bacteria 1830
500 Ga0395905_0354896 3300037471 Bacteria 1358
501 Ga0395905_0376043 3300037471 Bacteria 1314
502 Ga0395905_0405953 3300037471 Bacteria 1257
503 Ga0395905_0412915 3300037471 Bacteria 1245
504 Ga0395905_0501787 3300037471 Bacteria 1113
505 Ga0395905_0608272 3300037471 Bacteria 995
506 Ga0395905_0962675 3300037471 Bacteria 756
507 Ga0436364_1251559 3300037853 Bacteria 595
508 Ga0395901_0000036 3300038443 Bacteria 214274
509 Ga0395901_0009605 3300038443 Bacteria 9814
510 Ga0395901_0011077 3300038443 Bacteria 9140
511 Ga0395901_0034798 3300038443 Bacteria 5203
512 Ga0395901_0044512 3300038443 Bacteria 4603
513 Ga0395901_0183054 3300038443 Bacteria 2197
514 Ga0395901_0373002 3300038443 Bacteria 1469
515 Ga0395901_0858341 3300038443 Bacteria 892
516 Ga0395901_0948036 3300038443 Bacteria 839
517 Ga0395901_1078271 3300038443 Bacteria 775
518 Ga0439445_0000729 3300042004 Bacteria 6885
519 Ga0439434_0030137 3300042435 Bacteria 1646
520 Ga0466969_0347480 3300044656 Bacteria 672
521 Ga0466972_0020610 3300044658 Bacteria 3294
522 Ga0466972_0030503 3300044658 Bacteria 2653
523 Ga0466972_0263777 3300044658 Bacteria 805
524 Ga0466972_0275366 3300044658 Bacteria 786
525 Ga0466966_0062150 3300044684 Bacteria 2355
526 Ga0466961_0012195 3300044693 Bacteria 5496
527 Ga0466961_0043794 3300044693 Bacteria 2866
528 Ga0466961_0045423 3300044693 Bacteria 2810
529 Ga0466963_0070286 3300044694 Bacteria 2354
530 Ga0466963_0083802 3300044694 Bacteria 2162
531 Ga0466963_0083946 3300044694 Bacteria 2160
532 Ga0466963_0689001 3300044694 Bacteria 721
533 Ga0466964_0021389 3300044706 Bacteria 2502
534 Ga0466971_0007665 3300044719 Bacteria 4708
535 Ga0466971_0266141 3300044719 Bacteria 819
536 Ga0466968_0053128 3300044735 Bacteria 1735
537 Ga0466968_0423082 3300044735 Bacteria 655
538 Ga0466957_0388315 3300044842 Bacteria 953
539 Ga0466960_0015650 3300044901 Bacteria 3275
540 Ga0466960_0087157 3300044901 Bacteria 1584
541 Ga0466959_0009838 3300045049 Bacteria 6813
542 Ga0466959_0091569 3300045049 Bacteria 2183
543 Ga0466958_0037286 3300045836 Bacteria 2913
544 Ga0466967_0173314 3300045976 Bacteria 2031
545 Ga0466967_0256257 3300045976 Bacteria 1673
546 Ga0495668_0431950 3300046616 Unclassified 724
547 Ga0496100_0004876 3300048903 Bacteria 7171
548 Ga0496101_0001582 3300048904 Bacteria 13660
549 Ga0496102_0227613 3300048905 Bacteria 1758
550 Ga0496103_0119795 3300048906 Bacteria 1676
551 Ga0496103_0211678 3300048906 Bacteria 1246
552 Ga0496104_0221970 3300048907 Bacteria 1802
553 Ga0496106_0021828 3300048909 Bacteria 4755
554 Ga0496106_0856682 3300048909 Bacteria 719
555 Ga0496107_0080163 3300048910 Bacteria 2380
556 Ga0496107_1353517 3300048910 Bacteria 508
557 Ga0496108_0015325 3300048911 Bacteria 6253
558 Ga0496108_0029288 3300048911 Bacteria 4557
559 Ga0496108_0545489 3300048911 Bacteria 1012
560 Ga0496109_0229920 3300048912 Bacteria 1744
561 Ga0496109_0264822 3300048912 Bacteria 1619
562 Ga0496110_0066108 3300048913 Bacteria 3197
563 Ga0496110_0074037 3300048913 Bacteria 3023
564 Ga0496111_0028439 3300048914 Bacteria 3961
565 Ga0496112_0038917 3300048915 Bacteria 4645
566 Ga0496112_0256084 3300048915 Bacteria 1700
567 Ga0496113_0009621 3300048916 Bacteria 6346
568 Ga0496113_0038916 3300048916 Bacteria 3498
569 Ga0496113_0999269 3300048916 Unclassified 659
570 Ga0501047_0268423 3300049581 Bacteria 1553
571 Ga0501079_0256506 3300049741 Bacteria 1367
572 Ga0466962_0051504 3300061719 Bacteria 1968
573 Ga0436361_0275510
574 JGI24740J21852_10011126
575 JGI24735J21928_10047278
576 rootL2_10206110
577 rootH1_10009952
578 Ga0070658_10000089
579 Ga0070658_10001337
580 Ga0070658_10062626
581 Ga0070658_10082348
582 Ga0070658_10180103
583 Ga0070658_10239781
584 Ga0070658_10430416
585 Ga0070658_11182477
586 Ga0070658_11245588
587 Ga0070658_11632050
588 Ga0070676_10139551
589 Ga0070683_100057584
590 Ga0070683_100140472
591 Ga0070683_100141471
592 Ga0070690_100006964
593 Ga0070670_100273794
594 Ga0070677_10035844
595 Ga0068869_100630038
596 Ga0070666_10001385
597 Ga0070666_10040246
598 Ga0070666_10045851
599 Ga0070666_10304396
600 Ga0070680_100001656
601 Ga0070680_100002141
602 Ga0070680_100188582
603 Ga0070680_100432355
604 Ga0070680_100594076
605 Ga0070680_101530251
606 Ga0070682_101034620
607 Ga0068868_100112955
608 Ga0068868_101059006
609 Ga0070660_100000370
610 Ga0070660_100006802
611 Ga0070660_100008286
612 Ga0070660_100021588
613 Ga0070660_100044463
614 Ga0070660_100115980
615 Ga0070660_100137423
616 Ga0070660_100162775
617 Ga0070660_100634264
618 Ga0070660_100703190
619 Ga0070660_101369078
620 Ga0070660_101524423
621 Ga0070689_100248246
622 Ga0070689_100703186
623 Ga0070687_100921413
624 Ga0070661_100031071
625 Ga0070661_100066751
626 Ga0070661_100086827
627 Ga0070661_100118540
628 Ga0070661_100162314
629 Ga0070661_100331321
630 Ga0070661_100412398
631 Ga0070661_100597509
632 Ga0070692_10019861
633 Ga0070692_10027855
634 Ga0070692_10033411
635 Ga0070692_10034904
636 Ga0070692_10083493
637 Ga0070668_101132481
638 Ga0070675_100024944
639 Ga0070675_100235491
640 Ga0070671_100015288
641 Ga0070671_100019967
642 Ga0070671_100060140
643 Ga0070671_100774712
644 Ga0070674_100125355
645 Ga0070674_100156556
646 Ga0070673_100023766
647 Ga0070673_100057526
648 Ga0070673_100063612
649 Ga0070688_100502509
650 Ga0070659_100016083
651 Ga0070659_100020273
652 Ga0070659_100043164
653 Ga0070659_100053831
654 Ga0070659_100180466
655 Ga0070659_100287069
656 Ga0070659_100368678
657 Ga0070659_100517972
658 Ga0070659_100562534
659 Ga0070659_101212071
660 Ga0070667_100069075
661 Ga0070709_10127925
662 Ga0070714_100029637
663 Ga0070714_100084080
664 Ga0070714_100085756
665 Ga0070714_100222924
666 Ga0070713_100235553
667 Ga0070663_100016348
668 Ga0070663_100021475
669 Ga0070663_100116325
670 Ga0070663_100723866
671 Ga0070678_100030137
672 Ga0070678_100121247
673 Ga0070678_100248484
674 Ga0070662_100022817
675 Ga0070662_100061797
676 Ga0070662_100072326
677 Ga0070662_100169956
678 Ga0070662_100202019
679 Ga0070681_10035858
680 Ga0070681_10043192
681 Ga0068867_100068699
682 Ga0068867_100127395
683 Ga0070685_10641212
684 Ga0070679_100036536
685 Ga0070679_100038725
686 Ga0070679_100205012
687 Ga0070679_100508430
688 Ga0070679_100709405
689 Ga0070679_100746291
690 Ga0070679_100765542
691 Ga0070684_100274134
692 Ga0070684_100867836
693 Ga0068853_100115646
694 Ga0068853_100151790
695 Ga0068853_100539128
696 Ga0068853_101190892
697 Ga0068853_101265897
698 Ga0070672_100016896
699 Ga0070672_100115857
700 Ga0070672_100219463
701 Ga0070686_100139000
702 Ga0070693_100384747
703 Ga0070665_100249504
704 Ga0070665_100602386
705 Ga0068855_100003774
706 Ga0068855_100057619
707 Ga0068855_100339628
708 Ga0068855_100686815
709 Ga0068855_100804786
710 Ga0068855_101294666
711 Ga0068855_102371888
712 Ga0070664_100013131
713 Ga0070664_100038432
714 Ga0070664_100066409
715 Ga0070664_100151229
716 Ga0070664_100368229
717 Ga0068857_100330913
718 Ga0068854_100155884
719 Ga0068854_100190283
720 Ga0068854_100192047
721 Ga0068854_100199547
722 Ga0068854_100250908
723 Ga0068854_100252476
724 Ga0068856_100043406
725 Ga0068856_100104491
726 Ga0068856_100166096
727 Ga0068856_100338511
728 Ga0068856_100357177
729 Ga0068856_100444878
730 Ga0068856_100631484
731 Ga0068856_100749556
732 Ga0070702_100238623
733 Ga0070702_101282897
734 Ga0068852_100002941
735 Ga0068852_100028994
736 Ga0068852_100042361
737 Ga0068852_100042644
738 Ga0068852_100057607
739 Ga0068852_100111096
740 Ga0068852_100486783
741 Ga0068859_100031011
742 Ga0068864_100135679
743 Ga0068864_100149984
744 Ga0068864_100369092
745 Ga0068866_10040112
746 Ga0068866_10223436
747 Ga0068866_10529227
748 Ga0068861_101379303
749 Ga0068851_10042666
750 Ga0068851_10121754
751 Ga0068870_10270235
752 Ga0068863_100026068
753 Ga0068863_100335114
754 Ga0068858_100003616
755 Ga0068858_100127511
756 Ga0068860_100412385
757 Ga0070717_10086900
758 Ga0097621_100001731
759 Ga0068871_100010444
760 Ga0068871_100116058
761 Ga0068871_100605491
762 Ga0068871_100817315
763 Ga0068865_100184109
764 Ga0097620_100031010
765 Ga0105251_10183401
766 Ga0105250_10159875
767 Ga0105240_11358372
768 Ga0105245_10122310
769 Ga0105245_10568627
770 Ga0105247_10163285
771 Ga0105247_10689261
772 Ga0105243_10157559
773 Ga0105243_10335268
774 Ga0105242_10038073
775 Ga0105242_10480612
776 Ga0105248_10011252
777 Ga0105248_10016458
778 Ga0105248_10110406
779 Ga0105248_10169875
780 Ga0105248_10467434
781 Ga0105248_10543666
782 Ga0105237_10201268
783 Ga0105237_10427718
784 Ga0105238_10044539
785 Ga0105238_11219376
786 Ga0105239_10407633
787 Ga0105246_10230910
788 Ga0105246_10722391
789 Ga0157373_10015106
790 Ga0157373_10017114
791 Ga0157373_10054915
792 Ga0157373_10104334
793 Ga0157373_10113419
794 Ga0157373_10160137
795 Ga0157373_10435553
796 Ga0157373_11159403
797 Ga0157373_11201786
798 Ga0157371_10001045
799 Ga0157371_10020077
800 Ga0157371_10056124
801 Ga0157371_10067683
802 Ga0157371_10067846
803 Ga0157371_10125533
804 Ga0157371_10139505
805 Ga0157371_10876445
806 Ga0157370_10038666
807 Ga0157370_10168123
808 Ga0157370_10181930
809 Ga0157370_11146362
810 Ga0157369_10558374
811 Ga0157369_11417845
812 Ga0157374_10023300
813 Ga0157374_10299259
814 Ga0157378_10244644
815 Ga0157378_10516696
816 Ga0157378_11480096
817 Ga0163162_10056677
818 Ga0163162_10145379
819 Ga0157372_10061275
820 Ga0157372_11668385
821 Ga0157372_11973082
822 Ga0157372_12879125
823 Ga0157375_10128654
824 Ga0157375_10277654
825 Ga0157375_10600640
826 Ga0157375_10684039
827 Ga0157375_10969971
828 Ga0157377_10185561
829 Ga0157377_10238316
830 Ga0157379_10048007
831 Ga0157379_10117707
832 Ga0157379_10529509
833 Ga0206355_1093801
834 Ga0213872_10107824
835 Ga0207673_1021131
836 Ga0207697_10004028
837 Ga0207656_10202471
838 Ga0207682_10021023
839 Ga0207692_10695358
840 Ga0207642_10090712
841 Ga0207642_10575983
842 Ga0207642_10670647
843 Ga0207710_10051444
844 Ga0207688_10001582
845 Ga0207680_10002200
846 Ga0207680_10901957
847 Ga0207647_10024949
848 Ga0207647_10106329
849 Ga0207647_10229107
850 Ga0207645_10006312
851 Ga0207645_10141939
852 Ga0207645_10415302
853 Ga0207643_10015679
854 Ga0207705_10000140
855 Ga0207705_10000396
856 Ga0207705_10003020
857 Ga0207705_10004378
858 Ga0207705_10005699
859 Ga0207705_10005990
860 Ga0207705_10017467
861 Ga0207705_10033564
862 Ga0207705_10042597
863 Ga0207705_10052048
864 Ga0207705_10116261
865 Ga0207705_10117077
866 Ga0207705_10188012
867 Ga0207705_10201189
868 Ga0207705_10267183
869 Ga0207705_10499995
870 Ga0207705_10807448
871 Ga0207654_10299367
872 Ga0207654_10330010
873 Ga0207707_10052508
874 Ga0207707_10164004
875 Ga0207660_10042367
876 Ga0207660_10052158
877 Ga0207660_10057726
878 Ga0207660_10137881
879 Ga0207662_10478258
880 Ga0207657_10000439
881 Ga0207657_10001011
882 Ga0207657_10001520
883 Ga0207657_10001550
884 Ga0207657_10001812
885 Ga0207657_10009941
886 Ga0207657_10013127
887 Ga0207657_10067811
888 Ga0207657_10101303
889 Ga0207657_10672078
890 Ga0207657_10728745
891 Ga0207657_10738201
892 Ga0207649_10032349
893 Ga0207649_10134809
894 Ga0207649_10136381
895 Ga0207649_10235982
896 Ga0207649_10248366
897 Ga0207649_10278043
898 Ga0207649_10687443
899 Ga0207652_10005074
900 Ga0207652_10015650
901 Ga0207652_10283587
902 Ga0207652_10400695
903 Ga0207652_10743998
904 Ga0207681_10730103
905 Ga0207650_10200274
906 Ga0207650_10238756
907 Ga0207687_10216478
908 Ga0207687_10493376
909 Ga0207700_10226135
910 Ga0207664_10011978
911 Ga0207664_10016917
912 Ga0207664_10115241
913 Ga0207664_10338519
914 Ga0207644_10005765
915 Ga0207644_10011579
916 Ga0207644_10024947
917 Ga0207644_10120401
918 Ga0207690_10005824
919 Ga0207690_10029334
920 Ga0207690_10053410
921 Ga0207690_10089060
922 Ga0207690_10121860
923 Ga0207690_10210798
924 Ga0207690_10275730
925 Ga0207690_10305210
926 Ga0207706_10011796
927 Ga0207706_10074884
928 Ga0207706_10076213
929 Ga0207706_10080770
930 Ga0207706_10210874
931 Ga0207686_10064062
932 Ga0207670_10468118
933 Ga0207670_10478727
934 Ga0207669_10076550
935 Ga0207669_10488153
936 Ga0207704_10086641
937 Ga0207665_10052776
938 Ga0207691_10007496
939 Ga0207691_10028898
940 Ga0207691_10033849
941 Ga0207711_10000174
942 Ga0207711_10030721
943 Ga0207711_10145277
944 Ga0207711_10419861
945 Ga0207711_10436432
946 Ga0207689_10051733
947 Ga0207661_10028488
948 Ga0207661_10126329
949 Ga0207661_10149301
950 Ga0207679_10030163
951 Ga0207679_10050240
952 Ga0207679_10059476
953 Ga0207667_10000237
954 Ga0207667_10020471
955 Ga0207667_10025506
956 Ga0207667_10408806
957 Ga0207667_10491865
958 Ga0207651_10036460
959 Ga0207651_10068598
960 Ga0207651_10432743
961 Ga0207640_10045362
962 Ga0207640_10107848
963 Ga0207640_10167439
964 Ga0207640_10540647
965 Ga0207658_10016690
966 Ga0207658_10096730
967 Ga0207658_10344019
968 Ga0207677_10006756
969 Ga0207677_10067067
970 Ga0207677_10074646
971 Ga0207703_10002660
972 Ga0207703_10075535
973 Ga0207639_10054007
974 Ga0207639_10073460
975 Ga0207639_10079773
976 Ga0207639_10079962
977 Ga0207639_10475574
978 Ga0207678_10001296
979 Ga0207678_10002905
980 Ga0207678_10007675
981 Ga0207678_10011449
982 Ga0207678_10261136
983 Ga0207678_10306373
984 Ga0207678_10798388
985 Ga0207678_10836837
986 Ga0207702_10018639
987 Ga0207702_10200154
988 Ga0207702_10221789
989 Ga0207702_10362023
990 Ga0207702_10511209
991 Ga0207702_10586375
992 Ga0207648_10009271
993 Ga0207648_10015672
994 Ga0207648_10378766
995 Ga0207676_10108945
996 Ga0207676_10811457
997 Ga0207674_10155024
998 Ga0207675_100401548
999 Ga0207683_10004702
1000 Ga0207683_10006210
1001 Ga0207698_10001748
1002 Ga0207698_10024722
1003 Ga0207698_10047850
1004 Ga0207698_10103766
1005 Ga0207698_10107742
1006 Ga0207698_10189879
1007 Ga0207698_10251285
1008 Ga0207698_10263863
1009 Ga0207698_11421994
1010 Ga0268266_10892891
1011 Ga0316182_1246566
1012 Ga0307408_101117075
1013 Ga0307413_10459782
1014 Ga0307410_10670860
1015 Ga0307406_10444791
1016 Ga0307409_100041443
1017 Ga0307416_100803593
1018 Ga0307416_101098746
1019 Ga0307415_100048806
1020 Ga0307415_100210242
1021 Ga0307415_100380076
1022 Ga0373929_0044348
1023 Ga0373944_0104586
1024 Ga0373943_0000719
1025 Ga0373946_0139674
1026 Ga0373961_0059688
1027 Ga0373931_0234158
1028 Ga0373935_0013556
1029 Ga0373935_0391095
1030 Ga0395899_0000261
1031 Ga0395899_0001551
1032 Ga0395899_0001565
1033 Ga0395899_0007693
1034 Ga0395899_0042684
1035 Ga0395899_0045452
1036 Ga0395899_0052173
1037 Ga0395899_0216798
1038 Ga0395899_0403728
1039 Ga0395899_0623234
1040 Ga0395900_0000036
1041 Ga0395900_0001028
1042 Ga0395900_0003248
1043 Ga0395900_0010232
1044 Ga0395900_0019624
1045 Ga0395900_0022704
1046 Ga0395900_0037975
1047 Ga0395900_0089620
1048 Ga0395900_0343895
1049 Ga0395900_0364515
1050 Ga0395900_0365484
1051 Ga0395900_0616267
1052 Ga0395900_0631041
1053 Ga0395898_0003335
1054 Ga0395898_0004926
1055 Ga0395898_0007247
1056 Ga0395898_0011855
1057 Ga0395898_0060684
1058 Ga0395898_0074580
1059 Ga0395898_0107806
1060 Ga0395898_0450738
1061 Ga0395898_0962135
1062 Ga0395898_1483263
1063 Ga0395905_0000006
1064 Ga0395905_0006062
1065 Ga0395905_0015015
1066 Ga0395905_0015607
1067 Ga0395905_0023156
1068 Ga0395905_0041889
1069 Ga0395905_0086724
1070 Ga0395905_0126564
1071 Ga0395905_0208736
1072 Ga0395905_0354896
1073 Ga0395905_0376043
1074 Ga0395905_0405953
1075 Ga0395905_0412915
1076 Ga0395905_0501787
1077 Ga0395905_0608272
1078 Ga0395905_0962675
1079 Ga0436364_1251559
1080 Ga0395901_0000036
1081 Ga0395901_0009605
1082 Ga0395901_0011077
1083 Ga0395901_0034798
1084 Ga0395901_0044512
1085 Ga0395901_0183054
1086 Ga0395901_0373002
1087 Ga0395901_0858341
1088 Ga0395901_0948036
1089 Ga0395901_1078271
1090 Ga0439445_0000729
1091 Ga0439434_0030137
1092 Ga0466969_0347480
1093 Ga0466972_0020610
1094 Ga0466972_0030503
1095 Ga0466972_0263777
1096 Ga0466972_0275366
1097 Ga0466966_0062150
1098 Ga0466961_0012195
1099 Ga0466961_0043794
1100 Ga0466961_0045423
1101 Ga0466963_0070286
1102 Ga0466963_0083802
1103 Ga0466963_0083946
1104 Ga0466963_0689001
1105 Ga0466964_0021389
1106 Ga0466971_0007665
1107 Ga0466971_0266141
1108 Ga0466968_0053128
1109 Ga0466968_0423082
1110 Ga0466957_0388315
1111 Ga0466960_0015650
1112 Ga0466960_0087157
1113 Ga0466959_0009838
1114 Ga0466959_0091569
1115 Ga0466958_0037286
1116 Ga0466967_0173314
1117 Ga0466967_0256257
1118 Ga0495668_0431950
1119 Ga0496100_0004876
1120 Ga0496101_0001582
1121 Ga0496102_0227613
1122 Ga0496103_0119795
1123 Ga0496103_0211678
1124 Ga0496104_0221970
1125 Ga0496106_0021828
1126 Ga0496106_0856682
1127 Ga0496107_0080163
1128 Ga0496107_1353517
1129 Ga0496108_0015325
1130 Ga0496108_0029288
1131 Ga0496108_0545489
1132 Ga0496109_0229920
1133 Ga0496109_0264822
1134 Ga0496110_0066108
1135 Ga0496110_0074037
1136 Ga0496111_0028439
1137 Ga0496112_0038917
1138 Ga0496112_0256084
1139 Ga0496113_0009621
1140 Ga0496113_0038916
1141 Ga0496113_0999269
1142 Ga0501047_0268423
1143 Ga0501079_0256506
1144 Ga0466962_0051504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

26

113

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8625 1 136
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.8201 1 134
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.815 1 136
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7958 4 107
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7632 4 107
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8814 3 129 3.90.1590.10
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.833 1 134 3.90.1590.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8264 3 129 3.90.1590.10
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8089 6 100 2.170.150.70
af_F1M344_111_368_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.776 57 86 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A0Q8XKR6-F1-model_v4 CENP-V/GFA domain-containing protein 0.9961 4 139 GO:0016846
GO:0046872
AF-A0A7Y3NJN1-F1-model_v4 GFA family protein 0.9932 1 133 GO:0016846
GO:0046872
AF-A0A0Q8XKR6-F1-model_v4 CENP-V/GFA domain-containing protein 0.9888 4 139 GO:0016846
GO:0046872
AF-A0A0F5PA94-F1-model_v4 Glutathione-dependent formaldehyde-activating protein 0.9875 2 134 GO:0016846
GO:0046872
AF-A0A8A5XH95-F1-model_v4 deleted 0.9849 4 134

Map