F465046
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 572 | 285 | 570 | 647 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100000656|Ga0068853_10000065612 |
| Length | 698 |
| Sequence | MSSYNDFSFAAQAEVPSSSSGPDSQVPIPPSALLPPEHRGHRKRKTTAGGLEQKSLWNAQIVRQAAIYSLKKLNPRWMIKNPVMFVVEVGSLLTTSLLITDAIHNRQGFFTVLFANFAEAMAEGRGKXXXDTLRKAKGETIAQRYTVSGALEQVTSGQLRAGDVIYVPAGHYIAGDGEVTEGVASVDESAITGESAPVIREGGGDRSAVTGGTKVLSDWIKVRITSNPGETFLDRMIALVEGATRQKTPNEIALSILLSGLTIVFLLAVVTLQPFAIYSKAPQTIFVLVSLLVCLIPTTIGGLLSAIGIAGMDRLVQYNVLAMSGRAVEAAGDVNTLLLDKTGTITLGNRQATEFIPAPDVTAERLADAAQFASLSDETPEGRSIVVLAKEKYNLRGRDLGGVHAEFVPFSAQTRMSGVNLPGMRIRKGSAAAIARFLEDQGSALPKKVREAVEEISRAGGTPLVVAENSTALGVIYLKDIVKGGLKERLARLRAMGIRTVMITGDNPLTAAVIAREAGVDDFLAEAKPKDKMDLIKREQAKGKLVAMTGDGTNDAPALAQADVGVAMNSGTQAAKEAGNMVDLDSNPTKLIEIVEIGKQLLMTRGALTTFSIANDVAKYFAIIPAMFAGAFPVLNALNIMHLATPQSAILSRGVKYEPKAAEALLRQNLLIYGVGGVIIPFIGIKAIDVLLVAAHLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 2 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 67 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 92 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 93 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 94 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 95 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 168 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 176 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 188 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 189 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 190 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 248 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 249 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 250 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 277 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 278 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 279 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 280 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 281 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 282 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 283 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.78 |
| Metatranscriptomes | 0.87 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.4 |
| Nodule | 0 |
| Rhizoplane | 3.5 |
| Rhizosphere | 93.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10000234 | 3300001991 | Bacteria | 5878 |
| 2 | Ga0065715_10008447 | 3300005293 | Bacteria | 5652 |
| 3 | Ga0070676_10002079 | 3300005328 | Bacteria | 10189 |
| 4 | Ga0070683_100000388 | 3300005329 | Bacteria | 30404 |
| 5 | Ga0070690_100015851 | 3300005330 | Bacteria | 4502 |
| 6 | Ga0070670_100000733 | 3300005331 | Bacteria | 25485 |
| 7 | Ga0068869_100001749 | 3300005334 | Bacteria | 12983 |
| 8 | Ga0070666_10000667 | 3300005335 | Bacteria | 20738 |
| 9 | Ga0070682_100014018 | 3300005337 | Bacteria | 4626 |
| 10 | Ga0068868_100001390 | 3300005338 | Bacteria | 16686 |
| 11 | Ga0068868_100029772 | 3300005338 | Bacteria | 4183 |
| 12 | Ga0068868_100038498 | 3300005338 | Bacteria | 3712 |
| 13 | Ga0070687_100000839 | 3300005343 | Bacteria | 10248 |
| 14 | Ga0070661_100001681 | 3300005344 | Bacteria | 15317 |
| 15 | Ga0070668_100000213 | 3300005347 | Bacteria | 37697 |
| 16 | Ga0070675_100009772 | 3300005354 | Bacteria | 7473 |
| 17 | Ga0070688_100000493 | 3300005365 | Bacteria | 19999 |
| 18 | Ga0070659_100028963 | 3300005366 | Bacteria | 4278 |
| 19 | Ga0070667_100000267 | 3300005367 | Bacteria | 59181 |
| 20 | Ga0070667_100000914 | 3300005367 | Bacteria | 27251 |
| 21 | Ga0070667_100004192 | 3300005367 | Bacteria | 12173 |
| 22 | Ga0070667_100051802 | 3300005367 | Bacteria | 3461 |
| 23 | Ga0070709_10036570 | 3300005434 | Bacteria | 2992 |
| 24 | Ga0070714_100019566 | 3300005435 | Bacteria | 5518 |
| 25 | Ga0070713_100014865 | 3300005436 | Bacteria | 5794 |
| 26 | Ga0070713_100024867 | 3300005436 | Bacteria | 4674 |
| 27 | Ga0070713_100028764 | 3300005436 | Bacteria | 4392 |
| 28 | Ga0070713_100044937 | 3300005436 | Bacteria | 3617 |
| 29 | Ga0070713_100115143 | 3300005436 | Bacteria | 2350 |
| 30 | Ga0070710_10000042 | 3300005437 | Bacteria | 58499 |
| 31 | Ga0070711_100000334 | 3300005439 | Bacteria | 24165 |
| 32 | Ga0070711_100001289 | 3300005439 | Bacteria | 13617 |
| 33 | Ga0070711_100014418 | 3300005439 | Bacteria | 4981 |
| 34 | Ga0070711_100014425 | 3300005439 | Bacteria | 4980 |
| 35 | Ga0070708_100001790 | 3300005445 | Bacteria | 16493 |
| 36 | Ga0070708_100016018 | 3300005445 | Bacteria | 6209 |
| 37 | Ga0070663_100001078 | 3300005455 | Bacteria | 14951 |
| 38 | Ga0070663_100027398 | 3300005455 | Bacteria | 3870 |
| 39 | Ga0070678_100010083 | 3300005456 | Bacteria | 5752 |
| 40 | Ga0068867_100001057 | 3300005459 | Bacteria | 18773 |
| 41 | Ga0070706_100001640 | 3300005467 | Bacteria | 23302 |
| 42 | Ga0070706_100007511 | 3300005467 | Bacteria | 10218 |
| 43 | Ga0070707_100006661 | 3300005468 | Bacteria | 10701 |
| 44 | Ga0070707_100032149 | 3300005468 | Bacteria | 4998 |
| 45 | Ga0070707_100064733 | 3300005468 | Bacteria | 3511 |
| 46 | Ga0070698_100001127 | 3300005471 | Bacteria | 29533 |
| 47 | Ga0070698_100005177 | 3300005471 | Bacteria | 14261 |
| 48 | Ga0070698_100009333 | 3300005471 | Bacteria | 10521 |
| 49 | Ga0070698_100011068 | 3300005471 | Bacteria | 9585 |
| 50 | Ga0070699_100001183 | 3300005518 | Bacteria | 24159 |
| 51 | Ga0070699_100006840 | 3300005518 | Bacteria | 9925 |
| 52 | Ga0070699_100042930 | 3300005518 | Bacteria | 3914 |
| 53 | Ga0070699_100078123 | 3300005518 | Bacteria | 2882 |
| 54 | Ga0070679_100037285 | 3300005530 | Bacteria | 4828 |
| 55 | Ga0070684_100000706 | 3300005535 | Bacteria | 23068 |
| 56 | Ga0070697_100000208 | 3300005536 | Bacteria | 48156 |
| 57 | Ga0070697_100004240 | 3300005536 | Bacteria | 10985 |
| 58 | Ga0070697_100004353 | 3300005536 | Bacteria | 10861 |
| 59 | Ga0070697_100011182 | 3300005536 | Bacteria | 7014 |
| 60 | Ga0070697_100011602 | 3300005536 | Bacteria | 6886 |
| 61 | Ga0070697_100059857 | 3300005536 | Bacteria | 3103 |
| 62 | Ga0068853_100000656 | 3300005539 | Bacteria | 23758 |
| 63 | Ga0068853_100052976 | 3300005539 | Bacteria | 3494 |
| 64 | Ga0070686_100004422 | 3300005544 | Bacteria | 7756 |
| 65 | Ga0070665_100000024 | 3300005548 | Bacteria | 374559 |
| 66 | Ga0070665_100012368 | 3300005548 | Bacteria | 8600 |
| 67 | Ga0070665_100037493 | 3300005548 | Bacteria | 4875 |
| 68 | Ga0070665_100051893 | 3300005548 | Bacteria | 4113 |
| 69 | Ga0068855_100001962 | 3300005563 | Bacteria | 25558 |
| 70 | Ga0068855_100002483 | 3300005563 | Bacteria | 22740 |
| 71 | Ga0068855_100003923 | 3300005563 | Bacteria | 18151 |
| 72 | Ga0068855_100117050 | 3300005563 | Bacteria | 3054 |
| 73 | Ga0068855_100128847 | 3300005563 | Bacteria | 2891 |
| 74 | Ga0070664_100004044 | 3300005564 | Bacteria | 11780 |
| 75 | Ga0068857_100002324 | 3300005577 | Bacteria | 15456 |
| 76 | Ga0068854_100012992 | 3300005578 | Bacteria | 5457 |
| 77 | Ga0068854_100026268 | 3300005578 | Bacteria | 4001 |
| 78 | Ga0068856_100000241 | 3300005614 | Bacteria | 59474 |
| 79 | Ga0068856_100000382 | 3300005614 | Bacteria | 48530 |
| 80 | Ga0068856_100002267 | 3300005614 | Bacteria | 19847 |
| 81 | Ga0068856_100003704 | 3300005614 | Bacteria | 15336 |
| 82 | Ga0068856_100009954 | 3300005614 | Bacteria | 9232 |
| 83 | Ga0068856_100035650 | 3300005614 | Bacteria | 4876 |
| 84 | Ga0068856_100069313 | 3300005614 | Bacteria | 3487 |
| 85 | Ga0070702_100016981 | 3300005615 | Bacteria | 3746 |
| 86 | Ga0068852_100000361 | 3300005616 | Bacteria | 30684 |
| 87 | Ga0068852_100035459 | 3300005616 | Bacteria | 4162 |
| 88 | Ga0068852_100046974 | 3300005616 | Bacteria | 3681 |
| 89 | Ga0068859_100001218 | 3300005617 | Bacteria | 26254 |
| 90 | Ga0068864_100000506 | 3300005618 | Bacteria | 33582 |
| 91 | Ga0068864_100107938 | 3300005618 | Bacteria | 2477 |
| 92 | Ga0068866_10002202 | 3300005718 | Bacteria | 8112 |
| 93 | Ga0068851_10001335 | 3300005834 | Bacteria | 10766 |
| 94 | Ga0068863_100000182 | 3300005841 | Bacteria | 67022 |
| 95 | Ga0068863_100000898 | 3300005841 | Bacteria | 29914 |
| 96 | Ga0068863_100007234 | 3300005841 | Bacteria | 10880 |
| 97 | Ga0068858_100021531 | 3300005842 | Bacteria | 6025 |
| 98 | Ga0068860_100001223 | 3300005843 | Bacteria | 27966 |
| 99 | Ga0068860_100001482 | 3300005843 | Bacteria | 25349 |
| 100 | Ga0068862_100046011 | 3300005844 | Bacteria | 3724 |
| 101 | Ga0081540_1009521 | 3300005983 | Bacteria | 6688 |
| 102 | Ga0081539_10001024 | 3300005985 | Bacteria | 51459 |
| 103 | Ga0081539_10007203 | 3300005985 | Bacteria | 10244 |
| 104 | Ga0070717_10001525 | 3300006028 | Bacteria | 16044 |
| 105 | Ga0070717_10001711 | 3300006028 | Bacteria | 15291 |
| 106 | Ga0070717_10010782 | 3300006028 | Bacteria | 6917 |
| 107 | Ga0070717_10011163 | 3300006028 | Bacteria | 6808 |
| 108 | Ga0070717_10026871 | 3300006028 | Bacteria | 4596 |
| 109 | Ga0070717_10039262 | 3300006028 | Bacteria | 3851 |
| 110 | Ga0070717_10059163 | 3300006028 | Bacteria | 3170 |
| 111 | Ga0070717_10098850 | 3300006028 | Bacteria | 2475 |
| 112 | Ga0070716_100000009 | 3300006173 | Bacteria | 173295 |
| 113 | Ga0070716_100000171 | 3300006173 | Bacteria | 25502 |
| 114 | Ga0070716_100001269 | 3300006173 | Bacteria | 11126 |
| 115 | Ga0070712_100007748 | 3300006175 | Bacteria | 6721 |
| 116 | Ga0097621_100000055 | 3300006237 | Bacteria | 59474 |
| 117 | Ga0097621_100001902 | 3300006237 | Bacteria | 14254 |
| 118 | Ga0097621_100007707 | 3300006237 | Bacteria | 7718 |
| 119 | Ga0097621_100028552 | 3300006237 | Bacteria | 4398 |
| 120 | Ga0097621_100057552 | 3300006237 | Bacteria | 3179 |
| 121 | Ga0068871_100000898 | 3300006358 | Bacteria | 19832 |
| 122 | Ga0068871_100001374 | 3300006358 | Bacteria | 16292 |
| 123 | Ga0068871_100006265 | 3300006358 | Bacteria | 8393 |
| 124 | Ga0075434_100037571 | 3300006871 | Bacteria | 4795 |
| 125 | Ga0075429_100018197 | 3300006880 | Bacteria | 6081 |
| 126 | Ga0075436_100001265 | 3300006914 | Bacteria | 17164 |
| 127 | Ga0097620_100001218 | 3300006931 | Bacteria | 26254 |
| 128 | Ga0075435_100033728 | 3300007076 | Bacteria | 4050 |
| 129 | Ga0099794_10002260 | 3300007265 | Bacteria | 7064 |
| 130 | Ga0105250_10015048 | 3300009092 | Bacteria | 3170 |
| 131 | Ga0105240_10004290 | 3300009093 | Bacteria | 21785 |
| 132 | Ga0105240_10005280 | 3300009093 | Bacteria | 19287 |
| 133 | Ga0105240_10010390 | 3300009093 | Bacteria | 13084 |
| 134 | Ga0105240_10249166 | 3300009093 | Bacteria | 2055 |
| 135 | Ga0105245_10002919 | 3300009098 | Bacteria | 15346 |
| 136 | Ga0105245_10009846 | 3300009098 | Bacteria | 8327 |
| 137 | Ga0105245_10065761 | 3300009098 | Bacteria | 3279 |
| 138 | Ga0105243_10058370 | 3300009148 | Bacteria | 3075 |
| 139 | Ga0105241_10000036 | 3300009174 | Bacteria | 115495 |
| 140 | Ga0105241_10000356 | 3300009174 | Bacteria | 34723 |
| 141 | Ga0105241_10001564 | 3300009174 | Bacteria | 17507 |
| 142 | Ga0105241_10010035 | 3300009174 | Bacteria | 6954 |
| 143 | Ga0105241_10027006 | 3300009174 | Bacteria | 4272 |
| 144 | Ga0105241_10082084 | 3300009174 | Bacteria | 2526 |
| 145 | Ga0105242_10017800 | 3300009176 | Bacteria | 5544 |
| 146 | Ga0105248_10002319 | 3300009177 | Bacteria | 21100 |
| 147 | Ga0105248_10015128 | 3300009177 | Bacteria | 8499 |
| 148 | Ga0105248_10154922 | 3300009177 | Bacteria | 2586 |
| 149 | Ga0105237_10004629 | 3300009545 | Bacteria | 15849 |
| 150 | Ga0105237_10133068 | 3300009545 | Bacteria | 2481 |
| 151 | Ga0105238_10000088 | 3300009551 | Bacteria | 103463 |
| 152 | Ga0105239_10004026 | 3300010375 | Bacteria | 17797 |
| 153 | Ga0105239_10009210 | 3300010375 | Bacteria | 11166 |
| 154 | Ga0105239_10089261 | 3300010375 | Bacteria | 3399 |
| 155 | Ga0105246_10001970 | 3300011119 | Bacteria | 12386 |
| 156 | Ga0157373_10003297 | 3300013100 | Bacteria | 12195 |
| 157 | Ga0157373_10009903 | 3300013100 | Bacteria | 7026 |
| 158 | Ga0157373_10076899 | 3300013100 | Bacteria | 2355 |
| 159 | Ga0157370_10014880 | 3300013104 | Bacteria | 7937 |
| 160 | Ga0157370_10064942 | 3300013104 | Bacteria | 3454 |
| 161 | Ga0157369_10008409 | 3300013105 | Bacteria | 11834 |
| 162 | Ga0157369_10013357 | 3300013105 | Bacteria | 9290 |
| 163 | Ga0157369_10013957 | 3300013105 | Bacteria | 9079 |
| 164 | Ga0157369_10014181 | 3300013105 | Bacteria | 9004 |
| 165 | Ga0157374_10000674 | 3300013296 | Bacteria | 30061 |
| 166 | Ga0157374_10003523 | 3300013296 | Bacteria | 13165 |
| 167 | Ga0157374_10081952 | 3300013296 | Bacteria | 3062 |
| 168 | Ga0157378_10000072 | 3300013297 | Bacteria | 91281 |
| 169 | Ga0157378_10001504 | 3300013297 | Bacteria | 21099 |
| 170 | Ga0157378_10016884 | 3300013297 | Bacteria | 6398 |
| 171 | Ga0157378_10027096 | 3300013297 | Bacteria | 5056 |
| 172 | Ga0157378_10031245 | 3300013297 | Bacteria | 4703 |
| 173 | Ga0157378_10062947 | 3300013297 | Bacteria | 3314 |
| 174 | Ga0163162_10086012 | 3300013306 | Bacteria | 3221 |
| 175 | Ga0157372_10000877 | 3300013307 | Bacteria | 32693 |
| 176 | Ga0157372_10001066 | 3300013307 | Bacteria | 29985 |
| 177 | Ga0157372_10012518 | 3300013307 | Bacteria | 9036 |
| 178 | Ga0157372_10028726 | 3300013307 | Bacteria | 6071 |
| 179 | Ga0157372_10040246 | 3300013307 | Bacteria | 5161 |
| 180 | Ga0157372_10115055 | 3300013307 | Bacteria | 3083 |
| 181 | Ga0157375_10039176 | 3300013308 | Bacteria | 4559 |
| 182 | Ga0163163_10001028 | 3300014325 | Bacteria | 23642 |
| 183 | Ga0163163_10010359 | 3300014325 | Bacteria | 8376 |
| 184 | Ga0157379_10000305 | 3300014968 | Bacteria | 38880 |
| 185 | Ga0157379_10010359 | 3300014968 | Bacteria | 8123 |
| 186 | Ga0157379_10036864 | 3300014968 | Bacteria | 4360 |
| 187 | Ga0157376_10000014 | 3300014969 | Bacteria | 303001 |
| 188 | Ga0157376_10004853 | 3300014969 | Bacteria | 9374 |
| 189 | Ga0157376_10006248 | 3300014969 | Bacteria | 8398 |
| 190 | Ga0157376_10006488 | 3300014969 | Bacteria | 8268 |
| 191 | Ga0182007_10014693 | 3300015262 | Bacteria | 2942 |
| 192 | Ga0163161_10029585 | 3300017792 | Bacteria | 3894 |
| 193 | Ga0213873_10003542 | 3300021358 | Bacteria | 2819 |
| 194 | Ga0213872_10002475 | 3300021361 | Bacteria | 10828 |
| 195 | Ga0213872_10007332 | 3300021361 | Bacteria | 5442 |
| 196 | Ga0224569_100001 | 3300022732 | Bacteria | 26447 |
| 197 | Ga0228598_1000020 | 3300024227 | Bacteria | 22455 |
| 198 | Ga0228598_1000466 | 3300024227 | Bacteria | 8245 |
| 199 | Ga0209675_1001998 | 3300025291 | Bacteria | 10947 |
| 200 | Ga0207656_10002035 | 3300025321 | Bacteria | 6751 |
| 201 | Ga0207692_10000192 | 3300025898 | Bacteria | 20115 |
| 202 | Ga0207642_10008381 | 3300025899 | Bacteria | 3542 |
| 203 | Ga0207710_10002050 | 3300025900 | Bacteria | 9571 |
| 204 | Ga0207680_10000044 | 3300025903 | Bacteria | 64236 |
| 205 | Ga0207680_10021320 | 3300025903 | Bacteria | 3504 |
| 206 | Ga0207680_10035246 | 3300025903 | Bacteria | 2871 |
| 207 | Ga0207647_10003423 | 3300025904 | Bacteria | 11898 |
| 208 | Ga0207699_10004975 | 3300025906 | Bacteria | 6355 |
| 209 | Ga0207699_10049285 | 3300025906 | Bacteria | 2479 |
| 210 | Ga0207645_10001672 | 3300025907 | Bacteria | 18045 |
| 211 | Ga0207684_10007645 | 3300025910 | Bacteria | 9695 |
| 212 | Ga0207684_10009404 | 3300025910 | Bacteria | 8630 |
| 213 | Ga0207684_10036900 | 3300025910 | Bacteria | 4148 |
| 214 | Ga0207684_10038051 | 3300025910 | Bacteria | 4083 |
| 215 | Ga0207684_10053959 | 3300025910 | Bacteria | 3410 |
| 216 | Ga0207654_10000052 | 3300025911 | Bacteria | 84058 |
| 217 | Ga0207654_10001017 | 3300025911 | Bacteria | 15347 |
| 218 | Ga0207654_10001505 | 3300025911 | Bacteria | 12289 |
| 219 | Ga0207695_10000063 | 3300025913 | Bacteria | 349527 |
| 220 | Ga0207695_10000538 | 3300025913 | Bacteria | 79042 |
| 221 | Ga0207695_10002072 | 3300025913 | Bacteria | 30560 |
| 222 | Ga0207695_10015533 | 3300025913 | Bacteria | 8956 |
| 223 | Ga0207671_10001289 | 3300025914 | Bacteria | 29494 |
| 224 | Ga0207671_10001318 | 3300025914 | Bacteria | 29039 |
| 225 | Ga0207693_10032614 | 3300025915 | Bacteria | 4110 |
| 226 | Ga0207663_10002713 | 3300025916 | Bacteria | 8529 |
| 227 | Ga0207663_10012901 | 3300025916 | Bacteria | 4531 |
| 228 | Ga0207662_10000873 | 3300025918 | Bacteria | 13921 |
| 229 | Ga0207649_10000899 | 3300025920 | Bacteria | 18766 |
| 230 | Ga0207649_10002426 | 3300025920 | Bacteria | 10438 |
| 231 | Ga0207646_10000415 | 3300025922 | Bacteria | 57158 |
| 232 | Ga0207646_10002244 | 3300025922 | Bacteria | 23007 |
| 233 | Ga0207646_10029308 | 3300025922 | Bacteria | 5004 |
| 234 | Ga0207646_10032203 | 3300025922 | Bacteria | 4745 |
| 235 | Ga0207694_10000028 | 3300025924 | Bacteria | 242395 |
| 236 | Ga0207694_10000513 | 3300025924 | Bacteria | 35098 |
| 237 | Ga0207650_10000058 | 3300025925 | Bacteria | 153056 |
| 238 | Ga0207650_10020580 | 3300025925 | Bacteria | 4655 |
| 239 | Ga0207659_10000859 | 3300025926 | Bacteria | 18034 |
| 240 | Ga0207700_10001574 | 3300025928 | Bacteria | 12949 |
| 241 | Ga0207700_10019110 | 3300025928 | Bacteria | 4622 |
| 242 | Ga0207700_10035710 | 3300025928 | Bacteria | 3583 |
| 243 | Ga0207700_10045813 | 3300025928 | Bacteria | 3230 |
| 244 | Ga0207700_10084612 | 3300025928 | Bacteria | 2487 |
| 245 | Ga0207664_10011412 | 3300025929 | Bacteria | 6314 |
| 246 | Ga0207664_10025988 | 3300025929 | Bacteria | 4419 |
| 247 | Ga0207644_10021000 | 3300025931 | Bacteria | 4446 |
| 248 | Ga0207690_10044512 | 3300025932 | Bacteria | 2926 |
| 249 | Ga0207706_10001905 | 3300025933 | Bacteria | 20495 |
| 250 | Ga0207709_10061587 | 3300025935 | Bacteria | 2345 |
| 251 | Ga0207670_10004380 | 3300025936 | Bacteria | 7593 |
| 252 | Ga0207669_10025192 | 3300025937 | Bacteria | 3211 |
| 253 | Ga0207704_10008586 | 3300025938 | Bacteria | 4893 |
| 254 | Ga0207665_10000001 | 3300025939 | Bacteria | 279842 |
| 255 | Ga0207665_10000039 | 3300025939 | Bacteria | 85276 |
| 256 | Ga0207665_10000309 | 3300025939 | Bacteria | 33802 |
| 257 | Ga0207665_10022779 | 3300025939 | Bacteria | 4123 |
| 258 | Ga0207665_10066363 | 3300025939 | Bacteria | 2456 |
| 259 | Ga0207691_10001717 | 3300025940 | Bacteria | 21573 |
| 260 | Ga0207711_10001067 | 3300025941 | Bacteria | 26234 |
| 261 | Ga0207711_10007191 | 3300025941 | Bacteria | 9330 |
| 262 | Ga0207711_10023134 | 3300025941 | Bacteria | 5202 |
| 263 | Ga0207689_10081829 | 3300025942 | Bacteria | 2654 |
| 264 | Ga0207679_10000141 | 3300025945 | Bacteria | 59703 |
| 265 | Ga0207667_10001808 | 3300025949 | Bacteria | 26932 |
| 266 | Ga0207667_10005791 | 3300025949 | Bacteria | 15077 |
| 267 | Ga0207667_10089487 | 3300025949 | Bacteria | 3182 |
| 268 | Ga0207667_10119254 | 3300025949 | Bacteria | 2719 |
| 269 | Ga0207667_10130987 | 3300025949 | Bacteria | 2583 |
| 270 | Ga0207651_10031970 | 3300025960 | Bacteria | 3372 |
| 271 | Ga0207668_10000141 | 3300025972 | Bacteria | 49147 |
| 272 | Ga0207640_10086021 | 3300025981 | Bacteria | 2163 |
| 273 | Ga0207658_10000163 | 3300025986 | Bacteria | 70810 |
| 274 | Ga0207658_10000526 | 3300025986 | Bacteria | 34963 |
| 275 | Ga0207658_10010633 | 3300025986 | Bacteria | 6255 |
| 276 | Ga0207658_10014728 | 3300025986 | Bacteria | 5359 |
| 277 | Ga0207677_10000076 | 3300026023 | Bacteria | 81764 |
| 278 | Ga0207677_10018318 | 3300026023 | Bacteria | 4199 |
| 279 | Ga0207639_10000043 | 3300026041 | Bacteria | 140295 |
| 280 | Ga0207678_10000143 | 3300026067 | Bacteria | 58580 |
| 281 | Ga0207678_10054733 | 3300026067 | Bacteria | 3436 |
| 282 | Ga0207702_10000152 | 3300026078 | Bacteria | 81294 |
| 283 | Ga0207702_10000834 | 3300026078 | Bacteria | 32311 |
| 284 | Ga0207702_10000880 | 3300026078 | Bacteria | 31244 |
| 285 | Ga0207702_10003040 | 3300026078 | Bacteria | 15590 |
| 286 | Ga0207702_10006030 | 3300026078 | Bacteria | 10518 |
| 287 | Ga0207641_10000102 | 3300026088 | Bacteria | 122366 |
| 288 | Ga0207641_10001695 | 3300026088 | Bacteria | 21432 |
| 289 | Ga0207641_10005273 | 3300026088 | Bacteria | 11040 |
| 290 | Ga0207641_10012129 | 3300026088 | Bacteria | 7072 |
| 291 | Ga0207641_10018780 | 3300026088 | Bacteria | 5669 |
| 292 | Ga0207641_10061604 | 3300026088 | Bacteria | 3200 |
| 293 | Ga0207648_10000388 | 3300026089 | Bacteria | 48734 |
| 294 | Ga0207676_10000242 | 3300026095 | Bacteria | 47504 |
| 295 | Ga0207676_10010954 | 3300026095 | Bacteria | 6472 |
| 296 | Ga0207674_10001643 | 3300026116 | Bacteria | 28768 |
| 297 | Ga0207683_10000687 | 3300026121 | Bacteria | 31074 |
| 298 | Ga0207698_10000046 | 3300026142 | Bacteria | 93146 |
| 299 | Ga0209588_1000637 | 3300027671 | Bacteria | 8853 |
| 300 | Ga0209588_1002340 | 3300027671 | Bacteria | 5136 |
| 301 | Ga0268266_10000019 | 3300028379 | Bacteria | 556465 |
| 302 | Ga0268266_10005371 | 3300028379 | Bacteria | 11973 |
| 303 | Ga0268266_10010876 | 3300028379 | Bacteria | 7926 |
| 304 | Ga0268266_10037535 | 3300028379 | Bacteria | 4126 |
| 305 | Ga0268265_10026475 | 3300028380 | Bacteria | 4127 |
| 306 | Ga0268265_10057009 | 3300028380 | Bacteria | 2975 |
| 307 | Ga0268264_10001026 | 3300028381 | Bacteria | 28064 |
| 308 | Ga0268264_10005784 | 3300028381 | Bacteria | 10484 |
| 309 | Ga0265319_1000243 | 3300028563 | Bacteria | 40938 |
| 310 | Ga0265318_10000198 | 3300028577 | Bacteria | 52281 |
| 311 | Ga0265338_10001153 | 3300028800 | Bacteria | 43711 |
| 312 | Ga0265338_10013219 | 3300028800 | Bacteria | 9342 |
| 313 | Ga0265338_10027535 | 3300028800 | Bacteria | 5700 |
| 314 | Ga0265338_10033682 | 3300028800 | Bacteria | 4965 |
| 315 | Ga0265338_10036142 | 3300028800 | Bacteria | 4734 |
| 316 | Ga0265762_1000553 | 3300030760 | Bacteria | 6546 |
| 317 | Ga0265762_1001187 | 3300030760 | Bacteria | 4724 |
| 318 | Ga0265760_10000739 | 3300031090 | Bacteria | 9335 |
| 319 | Ga0265760_10002732 | 3300031090 | Bacteria | 5165 |
| 320 | Ga0265760_10003062 | 3300031090 | Bacteria | 4882 |
| 321 | Ga0265330_10000369 | 3300031235 | Bacteria | 31708 |
| 322 | Ga0265330_10005992 | 3300031235 | Bacteria | 6018 |
| 323 | Ga0265330_10010598 | 3300031235 | Bacteria | 4340 |
| 324 | Ga0265328_10006673 | 3300031239 | Bacteria | 4860 |
| 325 | Ga0265320_10001269 | 3300031240 | Bacteria | 18468 |
| 326 | Ga0265325_10000123 | 3300031241 | Bacteria | 53074 |
| 327 | Ga0265325_10005843 | 3300031241 | Bacteria | 7539 |
| 328 | Ga0265325_10006468 | 3300031241 | Bacteria | 7104 |
| 329 | Ga0265325_10023536 | 3300031241 | Bacteria | 3361 |
| 330 | Ga0265325_10044646 | 3300031241 | Bacteria | 2307 |
| 331 | Ga0265329_10001276 | 3300031242 | Bacteria | 12285 |
| 332 | Ga0265340_10002857 | 3300031247 | Bacteria | 9831 |
| 333 | Ga0265340_10006216 | 3300031247 | Bacteria | 6582 |
| 334 | Ga0265340_10008247 | 3300031247 | Bacteria | 5629 |
| 335 | Ga0265340_10015123 | 3300031247 | Bacteria | 4015 |
| 336 | Ga0265339_10000041 | 3300031249 | Bacteria | 119820 |
| 337 | Ga0265339_10002921 | 3300031249 | Bacteria | 12090 |
| 338 | Ga0265339_10007961 | 3300031249 | Bacteria | 6796 |
| 339 | Ga0265339_10015971 | 3300031249 | Bacteria | 4487 |
| 340 | Ga0265331_10000403 | 3300031250 | Bacteria | 44394 |
| 341 | Ga0265331_10000455 | 3300031250 | Bacteria | 39585 |
| 342 | Ga0265331_10007479 | 3300031250 | Bacteria | 6314 |
| 343 | Ga0265331_10008479 | 3300031250 | Bacteria | 5844 |
| 344 | Ga0265316_10002553 | 3300031344 | Bacteria | 18817 |
| 345 | Ga0265316_10003681 | 3300031344 | Bacteria | 15446 |
| 346 | Ga0265316_10003715 | 3300031344 | Bacteria | 15361 |
| 347 | Ga0265316_10004429 | 3300031344 | Bacteria | 13997 |
| 348 | Ga0265316_10028057 | 3300031344 | Bacteria | 4648 |
| 349 | Ga0265316_10031064 | 3300031344 | Bacteria | 4371 |
| 350 | Ga0265316_10041549 | 3300031344 | Bacteria | 3679 |
| 351 | Ga0265316_10067562 | 3300031344 | Bacteria | 2764 |
| 352 | Ga0307513_10006554 | 3300031456 | Bacteria | 15205 |
| 353 | Ga0265313_10004552 | 3300031595 | Bacteria | 10574 |
| 354 | Ga0265313_10010620 | 3300031595 | Bacteria | 5799 |
| 355 | Ga0265314_10000564 | 3300031711 | Bacteria | 47150 |
| 356 | Ga0265314_10001387 | 3300031711 | Bacteria | 27158 |
| 357 | Ga0265314_10043889 | 3300031711 | Bacteria | 3173 |
| 358 | Ga0265342_10000346 | 3300031712 | Bacteria | 52003 |
| 359 | Ga0265342_10001067 | 3300031712 | Bacteria | 26609 |
| 360 | Ga0265342_10001635 | 3300031712 | Bacteria | 20659 |
| 361 | Ga0265342_10011617 | 3300031712 | Bacteria | 6011 |
| 362 | Ga0265342_10012957 | 3300031712 | Bacteria | 5621 |
| 363 | Ga0265342_10053900 | 3300031712 | Bacteria | 2392 |
| 364 | Ga0373926_0000436 | 3300035083 | Bacteria | 10824 |
| 365 | Ga0373926_0004645 | 3300035083 | Bacteria | 4510 |
| 366 | Ga0373944_0013623 | 3300035089 | Bacteria | 2259 |
| 367 | Ga0373923_0001368 | 3300035111 | Bacteria | 6945 |
| 368 | Ga0373923_0001710 | 3300035111 | Bacteria | 6440 |
| 369 | Ga0373936_0001427 | 3300035113 | Bacteria | 8692 |
| 370 | Ga0373943_0001062 | 3300035170 | Bacteria | 12209 |
| 371 | Ga0373955_0001580 | 3300035172 | Bacteria | 9738 |
| 372 | Ga0373924_0018203 | 3300035410 | Bacteria | 2704 |
| 373 | Ga0373935_0000209 | 3300035692 | Bacteria | 28196 |
| 374 | Ga0373927_0000687 | 3300035695 | Bacteria | 25823 |
| 375 | Ga0373927_0002059 | 3300035695 | Bacteria | 14841 |
| 376 | Ga0373927_0002490 | 3300035695 | Bacteria | 13443 |
| 377 | Ga0373933_0004419 | 3300035724 | Bacteria | 7718 |
| 378 | Ga0373933_0016491 | 3300035724 | Bacteria | 4132 |
| 379 | Ga0373933_0045053 | 3300035724 | Bacteria | 2615 |
| 380 | Ga0373947_0002718 | 3300035725 | Bacteria | 10618 |
| 381 | Ga0373937_0006560 | 3300036401 | Bacteria | 10052 |
| 382 | Ga0373937_0008394 | 3300036401 | Bacteria | 8975 |
| 383 | Ga0373937_0026913 | 3300036401 | Bacteria | 5198 |
| 384 | Ga0373937_0028735 | 3300036401 | Bacteria | 5034 |
| 385 | Ga0373925_0004050 | 3300037068 | Bacteria | 11133 |
| 386 | Ga0373925_0004332 | 3300037068 | Bacteria | 10734 |
| 387 | Ga0373925_0005709 | 3300037068 | Bacteria | 9251 |
| 388 | Ga0395899_0000503 | 3300037312 | Bacteria | 43549 |
| 389 | Ga0395899_0008485 | 3300037312 | Bacteria | 7917 |
| 390 | Ga0395900_0000545 | 3300037418 | Bacteria | 52739 |
| 391 | Ga0395900_0022964 | 3300037418 | Bacteria | 6383 |
| 392 | Ga0395898_0000315 | 3300037466 | Bacteria | 111811 |
| 393 | Ga0395898_0017876 | 3300037466 | Bacteria | 7233 |
| 394 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 395 | Ga0395905_0010596 | 3300037471 | Bacteria | 8950 |
| 396 | Ga0395905_0085226 | 3300037471 | Bacteria | 2961 |
| 397 | Ga0395901_0000242 | 3300038443 | Bacteria | 68210 |
| 398 | Ga0395901_0023408 | 3300038443 | Bacteria | 6331 |
| 399 | Ga0436361_0028357 | 3300039447 | Bacteria | 8837 |
| 400 | Ga0436361_0128209 | 3300039447 | Bacteria | 3865 |
| 401 | Ga0436361_0554053 | 3300039447 | Bacteria | 4093 |
| 402 | Ga0436361_0602192 | 3300039447 | Bacteria | 22271 |
| 403 | Ga0436363_0305738 | 3300039450 | Bacteria | 10027 |
| 404 | Ga0436363_1714569 | 3300039450 | Bacteria | 3616 |
| 405 | Ga0436362_0944545 | 3300039453 | Bacteria | 12506 |
| 406 | Ga0451577_0001507 | 3300042876 | Bacteria | 30779 |
| 407 | Ga0466969_0037157 | 3300044656 | Bacteria | 2458 |
| 408 | Ga0466972_0006300 | 3300044658 | Bacteria | 5960 |
| 409 | Ga0466965_0001122 | 3300044683 | Bacteria | 10468 |
| 410 | Ga0451576_0000333 | 3300045051 | Bacteria | 114207 |
| 411 | Ga0451576_0007115 | 3300045051 | Bacteria | 13513 |
| 412 | Ga0451576_0025506 | 3300045051 | Bacteria | 6368 |
| 413 | Ga0451576_0026250 | 3300045051 | Bacteria | 6266 |
| 414 | Ga0495592_0019495 | 3300046454 | Bacteria | 5159 |
| 415 | Ga0495603_0013668 | 3300046455 | Bacteria | 4913 |
| 416 | Ga0495641_0014767 | 3300046461 | Bacteria | 4212 |
| 417 | Ga0495651_0001391 | 3300046462 | Bacteria | 18750 |
| 418 | Ga0495651_0009925 | 3300046462 | Bacteria | 7322 |
| 419 | Ga0495653_0003892 | 3300046463 | Bacteria | 12068 |
| 420 | Ga0495653_0006091 | 3300046463 | Bacteria | 9882 |
| 421 | Ga0495580_0000421 | 3300046472 | Bacteria | 35130 |
| 422 | Ga0495580_0004588 | 3300046472 | Bacteria | 11597 |
| 423 | Ga0495580_0007434 | 3300046472 | Bacteria | 8806 |
| 424 | Ga0495580_0016434 | 3300046472 | Bacteria | 5553 |
| 425 | Ga0495580_0016484 | 3300046472 | Bacteria | 5543 |
| 426 | Ga0495580_0023836 | 3300046472 | Bacteria | 4488 |
| 427 | Ga0495580_0030303 | 3300046472 | Bacteria | 3918 |
| 428 | Ga0495580_0034709 | 3300046472 | Bacteria | 3630 |
| 429 | Ga0495582_0000458 | 3300046473 | Bacteria | 22294 |
| 430 | Ga0495639_0025517 | 3300046475 | Bacteria | 2607 |
| 431 | Ga0495664_0048052 | 3300046477 | Bacteria | 2533 |
| 432 | Ga0495583_0000027 | 3300046506 | Bacteria | 256299 |
| 433 | Ga0495608_0003890 | 3300046511 | Bacteria | 10734 |
| 434 | Ga0495618_0001605 | 3300046514 | Bacteria | 15089 |
| 435 | Ga0495618_0012799 | 3300046514 | Bacteria | 5099 |
| 436 | Ga0495628_0021192 | 3300046516 | Bacteria | 5350 |
| 437 | Ga0495628_0034045 | 3300046516 | Bacteria | 4101 |
| 438 | Ga0495628_0034602 | 3300046516 | Bacteria | 4063 |
| 439 | Ga0495630_0003809 | 3300046517 | Bacteria | 10524 |
| 440 | Ga0495630_0005469 | 3300046517 | Bacteria | 8972 |
| 441 | Ga0495630_0011445 | 3300046517 | Bacteria | 6425 |
| 442 | Ga0495630_0016965 | 3300046517 | Bacteria | 5329 |
| 443 | Ga0495666_0016200 | 3300046526 | Bacteria | 3712 |
| 444 | Ga0495652_0001970 | 3300046529 | Bacteria | 21862 |
| 445 | Ga0495665_0001245 | 3300046531 | Bacteria | 13582 |
| 446 | Ga0495665_0006790 | 3300046531 | Bacteria | 6173 |
| 447 | Ga0495586_0002781 | 3300046535 | Bacteria | 9456 |
| 448 | Ga0495586_0039686 | 3300046535 | Bacteria | 2531 |
| 449 | Ga0495587_0002165 | 3300046536 | Bacteria | 13150 |
| 450 | Ga0495645_0014227 | 3300046543 | Bacteria | 5644 |
| 451 | Ga0495645_0064295 | 3300046543 | Bacteria | 2655 |
| 452 | Ga0495645_0073485 | 3300046543 | Bacteria | 2463 |
| 453 | Ga0495645_0075123 | 3300046543 | Bacteria | 2432 |
| 454 | Ga0495667_0000989 | 3300046559 | Bacteria | 18391 |
| 455 | Ga0495667_0012131 | 3300046559 | Bacteria | 5840 |
| 456 | Ga0495635_0028800 | 3300046663 | Bacteria | 3860 |
| 457 | Ga0495635_0029370 | 3300046663 | Bacteria | 3823 |
| 458 | Ga0495635_0054643 | 3300046663 | Bacteria | 2751 |
| 459 | Ga0495657_0004661 | 3300046675 | Bacteria | 10936 |
| 460 | Ga0495599_0004864 | 3300046678 | Bacteria | 7992 |
| 461 | Ga0495646_0000426 | 3300046680 | Bacteria | 22331 |
| 462 | Ga0495624_0013521 | 3300046690 | Bacteria | 5564 |
| 463 | Ga0495600_0001896 | 3300046809 | Bacteria | 11741 |
| 464 | Ga0495581_0006715 | 3300047315 | Bacteria | 6672 |
| 465 | Ga0495604_0003114 | 3300047317 | Bacteria | 13257 |
| 466 | Ga0495604_0006914 | 3300047317 | Bacteria | 8992 |
| 467 | Ga0495604_0022516 | 3300047317 | Bacteria | 5031 |
| 468 | Ga0495674_0050097 | 3300047319 | Bacteria | 3686 |
| 469 | Ga0495674_0056704 | 3300047319 | Bacteria | 3430 |
| 470 | Ga0495674_0064253 | 3300047319 | Bacteria | 3191 |
| 471 | Ga0495674_0087297 | 3300047319 | Bacteria | 2670 |
| 472 | Ga0495672_0001806 | 3300047320 | Bacteria | 20509 |
| 473 | Ga0495676_0064900 | 3300047321 | Bacteria | 2837 |
| 474 | Ga0495680_0001356 | 3300047322 | Bacteria | 26600 |
| 475 | Ga0495680_0003103 | 3300047322 | Bacteria | 16552 |
| 476 | Ga0495675_0000038 | 3300047444 | Bacteria | 91107 |
| 477 | Ga0495675_0002235 | 3300047444 | Bacteria | 11559 |
| 478 | Ga0495675_0011901 | 3300047444 | Bacteria | 5468 |
| 479 | Ga0495675_0072524 | 3300047444 | Bacteria | 2172 |
| 480 | Ga0495684_0001645 | 3300047471 | Bacteria | 17943 |
| 481 | Ga0495684_0003016 | 3300047471 | Bacteria | 13257 |
| 482 | Ga0495684_0005618 | 3300047471 | Bacteria | 9775 |
| 483 | Ga0495593_0021786 | 3300047673 | Bacteria | 3576 |
| 484 | Ga0495602_0038045 | 3300048088 | Bacteria | 4455 |
| 485 | Ga0495614_0008984 | 3300048089 | Bacteria | 4435 |
| 486 | Ga0496101_0035715 | 3300048904 | Bacteria | 3517 |
| 487 | Ga0496102_0080319 | 3300048905 | Bacteria | 3004 |
| 488 | Ga0496104_0069821 | 3300048907 | Bacteria | 3339 |
| 489 | Ga0496105_0000676 | 3300048908 | Bacteria | 22926 |
| 490 | Ga0496105_0027375 | 3300048908 | Bacteria | 4657 |
| 491 | Ga0496106_0000054 | 3300048909 | Bacteria | 93869 |
| 492 | Ga0496107_0097269 | 3300048910 | Bacteria | 2155 |
| 493 | Ga0496108_0000813 | 3300048911 | Bacteria | 24249 |
| 494 | Ga0496109_0000177 | 3300048912 | Bacteria | 63414 |
| 495 | Ga0496110_0014401 | 3300048913 | Bacteria | 6565 |
| 496 | Ga0496110_0054205 | 3300048913 | Bacteria | 3527 |
| 497 | Ga0496111_0002828 | 3300048914 | Bacteria | 10584 |
| 498 | Ga0496112_0002570 | 3300048915 | Bacteria | 14665 |
| 499 | Ga0496112_0026198 | 3300048915 | Bacteria | 5608 |
| 500 | Ga0496112_0064802 | 3300048915 | Bacteria | 3606 |
| 501 | Ga0496113_0000250 | 3300048916 | Bacteria | 25446 |
| 502 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 503 | Ga0496114_0015955 | 3300048917 | Bacteria | 6045 |
| 504 | Ga0496115_0039705 | 3300048918 | Bacteria | 3739 |
| 505 | Ga0496115_0050926 | 3300048918 | Bacteria | 3320 |
| 506 | Ga0496118_0009338 | 3300048921 | Bacteria | 9937 |
| 507 | Ga0496118_0028322 | 3300048921 | Bacteria | 4721 |
| 508 | Ga0496121_0005696 | 3300048924 | Bacteria | 15838 |
| 509 | Ga0496123_0007874 | 3300048926 | Bacteria | 9905 |
| 510 | Ga0496124_0007439 | 3300048927 | Bacteria | 11634 |
| 511 | Ga0496126_0000850 | 3300048929 | Bacteria | 53951 |
| 512 | Ga0496126_0003557 | 3300048929 | Bacteria | 19573 |
| 513 | Ga0501031_0008913 | 3300049568 | Bacteria | 6522 |
| 514 | Ga0501036_0001713 | 3300049572 | Bacteria | 17044 |
| 515 | Ga0501040_0001126 | 3300049576 | Bacteria | 16935 |
| 516 | Ga0501040_0002850 | 3300049576 | Bacteria | 11163 |
| 517 | Ga0501041_0005367 | 3300049577 | Bacteria | 7508 |
| 518 | Ga0501041_0009370 | 3300049577 | Bacteria | 5770 |
| 519 | Ga0501041_0039428 | 3300049577 | Bacteria | 2867 |
| 520 | Ga0501042_0000521 | 3300049578 | Bacteria | 20048 |
| 521 | Ga0501042_0003103 | 3300049578 | Bacteria | 10339 |
| 522 | Ga0501046_0004130 | 3300049580 | Bacteria | 13232 |
| 523 | Ga0501071_0000569 | 3300049587 | Bacteria | 19100 |
| 524 | Ga0501071_0002730 | 3300049587 | Bacteria | 10819 |
| 525 | Ga0501072_0000689 | 3300049588 | Bacteria | 24469 |
| 526 | Ga0501072_0004213 | 3300049588 | Bacteria | 10911 |
| 527 | Ga0501072_0021438 | 3300049588 | Bacteria | 5010 |
| 528 | Ga0501074_0006035 | 3300049590 | Bacteria | 8742 |
| 529 | Ga0501075_0000709 | 3300049591 | Bacteria | 20630 |
| 530 | Ga0501076_0000716 | 3300049592 | Bacteria | 21417 |
| 531 | Ga0501076_0002992 | 3300049592 | Bacteria | 11739 |
| 532 | Ga0501077_0000768 | 3300049593 | Bacteria | 19362 |
| 533 | Ga0501079_0002138 | 3300049741 | Bacteria | 14212 |
| 534 | Ga0501079_0004196 | 3300049741 | Bacteria | 10681 |
| 535 | Ga0501080_0002348 | 3300049742 | Bacteria | 16519 |
| 536 | Ga0501081_0001963 | 3300049743 | Bacteria | 12797 |
| 537 | Ga0501081_0002879 | 3300049743 | Bacteria | 10926 |
| 538 | Ga0501083_0019225 | 3300049744 | Bacteria | 4758 |
| 539 | Ga0501035_0042430 | 3300049822 | Bacteria | 4103 |
| 540 | Ga0501044_0050215 | 3300049823 | Bacteria | 4305 |
| 541 | Ga0501045_0000582 | 3300049824 | Bacteria | 22920 |
| 542 | Ga0501045_0060533 | 3300049824 | Bacteria | 2776 |
| 543 | nmdc:mga09592_7123_c1 | 3300050508 | Bacteria | 9092 |
| 544 | nmdc:mga0n895_6912_c1 | 3300050512 | Bacteria | 9695 |
| 545 | nmdc:mga0n895_6964_c1 | 3300050512 | Bacteria | 9651 |
| 546 | nmdc:mga0rr50_26640_c1 | 3300050513 | Bacteria | 3337 |
| 547 | nmdc:mga0rr50_49221_c1 | 3300050513 | Bacteria | 3119 |
| 548 | nmdc:mga08x19_1360_c1 | 3300050514 | Bacteria | 15164 |
| 549 | nmdc:mga08x19_18570_c1 | 3300050514 | Bacteria | 4261 |
| 550 | Ga0495601_0007080 | 3300053077 | Bacteria | 6571 |
| 551 | Ga0495601_0014426 | 3300053077 | Bacteria | 4762 |
| 552 | Ga0495612_0006187 | 3300053078 | Bacteria | 4927 |
| 553 | Ga0495595_0008086 | 3300053084 | Bacteria | 4312 |
| 554 | Ga0500643_000232 | 3300053087 | Bacteria | 51502 |
| 555 | Ga0500651_0002216 | 3300053093 | Bacteria | 10188 |
| 556 | Ga0500555_001028 | 3300053103 | Bacteria | 9426 |
| 557 | Ga0500592_000029 | 3300053116 | Bacteria | 48246 |
| 558 | Ga0500655_000030 | 3300053133 | Bacteria | 39615 |
| 559 | Ga0500590_009282 | 3300053148 | Bacteria | 4945 |
| 560 | Ga0500627_0000478 | 3300053158 | Bacteria | 10842 |
| 561 | Ga0501084_0000707 | 3300054114 | Bacteria | 25538 |
| 562 | Ga0501084_0009537 | 3300054114 | Bacteria | 8034 |
| 563 | Ga0501084_0019449 | 3300054114 | Bacteria | 5658 |
| 564 | Ga0501084_0025193 | 3300054114 | Bacteria | 4962 |
| 565 | Ga0501084_0084179 | 3300054114 | Bacteria | 2670 |
| 566 | Ga0501082_0002040 | 3300060353 | Bacteria | 17753 |
| 567 | Ga0501082_0074384 | 3300060353 | Bacteria | 2926 |
| 568 | Ga0530510_0002872 | 3300061734 | Bacteria | 11839 |
| 569 | Ga0530510_0003931 | 3300061734 | Bacteria | 10251 |
| 570 | Ga0530510_0050215 | 3300061734 | Bacteria | 3013 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044683 | Ga0466965_0001122 | Ga0466965_0001122_8038_10029 | 501 |
| 2 | 3300044658 | Ga0466972_0006300 | Ga0466972_0006300_838_2829 | 504 |
| 3 | 3300039447 | Ga0436361_0128209 | Ga0436361_0128209_1980_3809 | 523 |
| 4 | 3300025928 | Ga0207700_10035710 | Ga0207700_100357102 | 524 |
| 5 | 3300049578 | Ga0501042_0003103 | Ga0501042_0003103_686_2653 | 540 |
| 6 | 3300046663 | Ga0495635_0028800 | Ga0495635_0028800_817_2883 | 544 |
| 7 | 3300060353 | Ga0501082_0074384 | Ga0501082_0074384_32_1954 | 546 |
| 8 | 3300013296 | Ga0157374_10003523 | Ga0157374_100035239 | 553 |
| 9 | 3300005616 | Ga0068852_100035459 | Ga0068852_1000354592 | 554 |
| 10 | 3300013297 | Ga0157378_10062947 | Ga0157378_100629473 | 554 |
| 11 | 3300005618 | Ga0068864_100107938 | Ga0068864_1001079381 | 563 |
| 12 | 3300005841 | Ga0068863_100000182 | Ga0068863_10000018242 | 563 |
| 13 | 3300025903 | Ga0207680_10000044 | Ga0207680_1000004423 | 563 |
| 14 | 3300025972 | Ga0207668_10000141 | Ga0207668_1000014147 | 563 |
| 15 | 3300025986 | Ga0207658_10000526 | Ga0207658_1000052613 | 563 |
| 16 | 3300026088 | Ga0207641_10000102 | Ga0207641_1000010229 | 563 |
| 17 | 3300048908 | Ga0496105_0027375 | Ga0496105_0027375_22_1968 | 563 |
| 18 | 3300025910 | Ga0207684_10038051 | Ga0207684_100380512 | 565 |
| 19 | 3300009093 | Ga0105240_10249166 | Ga0105240_102491661 | 567 |
| 20 | 3300031456 | Ga0307513_10006554 | Ga0307513_100065543 | 568 |
| 21 | 3300039447 | Ga0436361_0028357 | Ga0436361_0028357_4205_6151 | 569 |
| 22 | 3300047319 | Ga0495674_0056704 | Ga0495674_0056704_15_1946 | 569 |
| 23 | 3300049576 | Ga0501040_0002850 | Ga0501040_0002850_3330_5348 | 569 |
| 24 | 3300049577 | Ga0501041_0009370 | Ga0501041_0009370_3547_5565 | 569 |
| 25 | 3300049577 | Ga0501041_0039428 | Ga0501041_0039428_44_2059 | 569 |
| 26 | 3300049587 | Ga0501071_0002730 | Ga0501071_0002730_3361_5379 | 569 |
| 27 | 3300049588 | Ga0501072_0004213 | Ga0501072_0004213_3402_5420 | 569 |
| 28 | 3300049592 | Ga0501076_0002992 | Ga0501076_0002992_3402_5420 | 569 |
| 29 | 3300049741 | Ga0501079_0004196 | Ga0501079_0004196_2344_4362 | 569 |
| 30 | 3300049743 | Ga0501081_0002879 | Ga0501081_0002879_3489_5507 | 569 |
| 31 | 3300054114 | Ga0501084_0009537 | Ga0501084_0009537_3378_5396 | 569 |
| 32 | 3300054114 | Ga0501084_0025193 | Ga0501084_0025193_828_2843 | 569 |
| 33 | 3300061734 | Ga0530510_0002872 | Ga0530510_0002872_6438_8456 | 569 |
| 34 | 3300049568 | Ga0501031_0008913 | Ga0501031_0008913_1959_3977 | 570 |
| 35 | 3300049572 | Ga0501036_0001713 | Ga0501036_0001713_7384_9402 | 570 |
| 36 | 3300049576 | Ga0501040_0001126 | Ga0501040_0001126_8181_10199 | 570 |
| 37 | 3300049577 | Ga0501041_0005367 | Ga0501041_0005367_5315_7333 | 570 |
| 38 | 3300049578 | Ga0501042_0000521 | Ga0501042_0000521_8615_10633 | 570 |
| 39 | 3300049580 | Ga0501046_0004130 | Ga0501046_0004130_2868_4886 | 570 |
| 40 | 3300049587 | Ga0501071_0000569 | Ga0501071_0000569_7834_9852 | 570 |
| 41 | 3300049588 | Ga0501072_0000689 | Ga0501072_0000689_13812_15830 | 570 |
| 42 | 3300049590 | Ga0501074_0006035 | Ga0501074_0006035_6669_8687 | 570 |
| 43 | 3300049591 | Ga0501075_0000709 | Ga0501075_0000709_9747_11765 | 570 |
| 44 | 3300049592 | Ga0501076_0000716 | Ga0501076_0000716_10760_12778 | 570 |
| 45 | 3300049593 | Ga0501077_0000768 | Ga0501077_0000768_7578_9596 | 570 |
| 46 | 3300049741 | Ga0501079_0002138 | Ga0501079_0002138_3555_5573 | 570 |
| 47 | 3300049742 | Ga0501080_0002348 | Ga0501080_0002348_8407_10425 | 570 |
| 48 | 3300049743 | Ga0501081_0001963 | Ga0501081_0001963_7787_9805 | 570 |
| 49 | 3300049744 | Ga0501083_0019225 | Ga0501083_0019225_2094_4112 | 570 |
| 50 | 3300049822 | Ga0501035_0042430 | Ga0501035_0042430_386_2404 | 570 |
| 51 | 3300049824 | Ga0501045_0000582 | Ga0501045_0000582_7677_9695 | 570 |
| 52 | 3300054114 | Ga0501084_0000707 | Ga0501084_0000707_8640_10658 | 570 |
| 53 | 3300060353 | Ga0501082_0002040 | Ga0501082_0002040_7096_9114 | 570 |
| 54 | 3300061734 | Ga0530510_0003931 | Ga0530510_0003931_5028_7046 | 570 |
| 55 | 3300005435 | Ga0070714_100019566 | Ga0070714_1000195662 | 571 |
| 56 | 3300005436 | Ga0070713_100044937 | Ga0070713_1000449373 | 571 |
| 57 | 3300006028 | Ga0070717_10010782 | Ga0070717_100107826 | 571 |
| 58 | 3300025928 | Ga0207700_10001574 | Ga0207700_100015749 | 571 |
| 59 | 3300048907 | Ga0496104_0069821 | Ga0496104_0069821_1393_3324 | 571 |
| 60 | 3300031241 | Ga0265325_10005843 | Ga0265325_100058436 | 573 |
| 61 | 3300045051 | Ga0451576_0000333 | Ga0451576_0000333_74958_77006 | 573 |
| 62 | 3300005335 | Ga0070666_10000667 | Ga0070666_100006675 | 574 |
| 63 | 3300005347 | Ga0070668_100000213 | Ga0070668_1000002132 | 574 |
| 64 | 3300005367 | Ga0070667_100000914 | Ga0070667_1000009145 | 574 |
| 65 | 3300005437 | Ga0070710_10000042 | Ga0070710_1000004218 | 574 |
| 66 | 3300025898 | Ga0207692_10000192 | Ga0207692_100001927 | 574 |
| 67 | 3300053116 | Ga0500592_000029 | Ga0500592_000029_43669_45654 | 574 |
| 68 | 3300053158 | Ga0500627_0000478 | Ga0500627_0000478_6215_8200 | 574 |
| 69 | 3300005455 | Ga0070663_100027398 | Ga0070663_1000273982 | 576 |
| 70 | 3300005548 | Ga0070665_100051893 | Ga0070665_1000518933 | 576 |
| 71 | 3300006237 | Ga0097621_100028552 | Ga0097621_1000285523 | 576 |
| 72 | 3300009093 | Ga0105240_10004290 | Ga0105240_100042908 | 576 |
| 73 | 3300009098 | Ga0105245_10065761 | Ga0105245_100657612 | 576 |
| 74 | 3300009174 | Ga0105241_10027006 | Ga0105241_100270062 | 576 |
| 75 | 3300009177 | Ga0105248_10015128 | Ga0105248_100151284 | 576 |
| 76 | 3300010375 | Ga0105239_10009210 | Ga0105239_100092108 | 576 |
| 77 | 3300014969 | Ga0157376_10006488 | Ga0157376_100064886 | 576 |
| 78 | 3300025913 | Ga0207695_10000063 | Ga0207695_10000063180 | 576 |
| 79 | 3300025924 | Ga0207694_10000513 | Ga0207694_100005134 | 576 |
| 80 | 3300025941 | Ga0207711_10023134 | Ga0207711_100231342 | 576 |
| 81 | 3300026067 | Ga0207678_10054733 | Ga0207678_100547332 | 576 |
| 82 | 3300028379 | Ga0268266_10037535 | Ga0268266_100375353 | 576 |
| 83 | 3300031344 | Ga0265316_10003715 | Ga0265316_100037153 | 576 |
| 84 | 3300005614 | Ga0068856_100009954 | Ga0068856_1000099547 | 577 |
| 85 | 3300009174 | Ga0105241_10082084 | Ga0105241_100820842 | 577 |
| 86 | 3300025949 | Ga0207667_10130987 | Ga0207667_101309871 | 577 |
| 87 | 3300005616 | Ga0068852_100046974 | Ga0068852_1000469742 | 578 |
| 88 | 3300013104 | Ga0157370_10064942 | Ga0157370_100649422 | 578 |
| 89 | 3300013308 | Ga0157375_10039176 | Ga0157375_100391763 | 578 |
| 90 | 3300048905 | Ga0496102_0080319 | Ga0496102_0080319_976_2991 | 578 |
| 91 | 3300048913 | Ga0496110_0054205 | Ga0496110_0054205_286_2331 | 578 |
| 92 | 3300048914 | Ga0496111_0002828 | Ga0496111_0002828_4916_6961 | 578 |
| 93 | 3300013297 | Ga0157378_10016884 | Ga0157378_100168842 | 579 |
| 94 | 3300053133 | Ga0500655_000030 | Ga0500655_000030_30861_32891 | 580 |
| 95 | 3300031249 | Ga0265339_10000041 | Ga0265339_10000041101 | 581 |
| 96 | 3300031712 | Ga0265342_10001067 | Ga0265342_100010673 | 581 |
| 97 | 3300048926 | Ga0496123_0007874 | Ga0496123_0007874_3384_5420 | 581 |
| 98 | 3300048927 | Ga0496124_0007439 | Ga0496124_0007439_264_2300 | 581 |
| 99 | 3300053093 | Ga0500651_0002216 | Ga0500651_0002216_6042_8072 | 581 |
| 100 | 3300053148 | Ga0500590_009282 | Ga0500590_009282_2347_4377 | 581 |
| 101 | 3300005367 | Ga0070667_100004192 | Ga0070667_1000041928 | 582 |
| 102 | 3300005548 | Ga0070665_100012368 | Ga0070665_1000123685 | 582 |
| 103 | 3300005843 | Ga0068860_100001223 | Ga0068860_1000012234 | 582 |
| 104 | 3300025986 | Ga0207658_10010633 | Ga0207658_100106333 | 582 |
| 105 | 3300028379 | Ga0268266_10010876 | Ga0268266_100108768 | 582 |
| 106 | 3300028381 | Ga0268264_10001026 | Ga0268264_1000102625 | 582 |
| 107 | 3300031344 | Ga0265316_10041549 | Ga0265316_100415492 | 582 |
| 108 | 3300031711 | Ga0265314_10043889 | Ga0265314_100438892 | 582 |
| 109 | 3300021361 | Ga0213872_10002475 | Ga0213872_100024759 | 583 |
| 110 | 3300037312 | Ga0395899_0008485 | Ga0395899_0008485_3452_5509 | 583 |
| 111 | 3300037418 | Ga0395900_0022964 | Ga0395900_0022964_2255_4312 | 583 |
| 112 | 3300037471 | Ga0395905_0010596 | Ga0395905_0010596_5140_7197 | 583 |
| 113 | 3300038443 | Ga0395901_0023408 | Ga0395901_0023408_3106_5163 | 583 |
| 114 | 3300039447 | Ga0436361_0554053 | Ga0436361_0554053_38_2101 | 583 |
| 115 | 3300048908 | Ga0496105_0000676 | Ga0496105_0000676_2434_4509 | 583 |
| 116 | 3300031235 | Ga0265330_10010598 | Ga0265330_100105982 | 584 |
| 117 | 3300031344 | Ga0265316_10031064 | Ga0265316_100310642 | 584 |
| 118 | 3300031712 | Ga0265342_10053900 | Ga0265342_100539002 | 584 |
| 119 | 3300045051 | Ga0451576_0007115 | Ga0451576_0007115_7831_9900 | 584 |
| 120 | 3300048904 | Ga0496101_0035715 | Ga0496101_0035715_589_2598 | 584 |
| 121 | 3300005985 | Ga0081539_10001024 | Ga0081539_1000102431 | 585 |
| 122 | 3300009174 | Ga0105241_10000356 | Ga0105241_100003568 | 585 |
| 123 | 3300013105 | Ga0157369_10013957 | Ga0157369_100139572 | 585 |
| 124 | 3300025911 | Ga0207654_10001017 | Ga0207654_100010178 | 585 |
| 125 | 3300045051 | Ga0451576_0026250 | Ga0451576_0026250_2039_4075 | 585 |
| 126 | 3300013100 | Ga0157373_10003297 | Ga0157373_100032971 | 586 |
| 127 | 3300014968 | Ga0157379_10010359 | Ga0157379_100103593 | 586 |
| 128 | 3300014969 | Ga0157376_10004853 | Ga0157376_100048536 | 586 |
| 129 | 3300046475 | Ga0495639_0025517 | Ga0495639_0025517_610_2559 | 586 |
| 130 | 3300046543 | Ga0495645_0014227 | Ga0495645_0014227_1149_3230 | 586 |
| 131 | 3300048913 | Ga0496110_0014401 | Ga0496110_0014401_1957_3894 | 586 |
| 132 | 3300009092 | Ga0105250_10015048 | Ga0105250_100150482 | 587 |
| 133 | 3300009093 | Ga0105240_10005280 | Ga0105240_1000528012 | 587 |
| 134 | 3300009098 | Ga0105245_10002919 | Ga0105245_100029198 | 587 |
| 135 | 3300013307 | Ga0157372_10115055 | Ga0157372_101150552 | 587 |
| 136 | 3300014325 | Ga0163163_10010359 | Ga0163163_100103593 | 587 |
| 137 | 3300048911 | Ga0496108_0000813 | Ga0496108_0000813_18039_19976 | 587 |
| 138 | 3300048912 | Ga0496109_0000177 | Ga0496109_0000177_31885_33822 | 587 |
| 139 | 3300048915 | Ga0496112_0002570 | Ga0496112_0002570_11525_13462 | 587 |
| 140 | 3300048916 | Ga0496113_0000250 | Ga0496113_0000250_11148_13085 | 587 |
| 141 | 3300048929 | Ga0496126_0003557 | Ga0496126_0003557_8052_10094 | 587 |
| 142 | 3300005548 | Ga0070665_100000024 | Ga0070665_1000000246 | 588 |
| 143 | 3300028379 | Ga0268266_10000019 | Ga0268266_10000019356 | 588 |
| 144 | 3300013307 | Ga0157372_10040246 | Ga0157372_100402462 | 589 |
| 145 | 3300014968 | Ga0157379_10036864 | Ga0157379_100368643 | 589 |
| 146 | 3300025939 | Ga0207665_10022779 | Ga0207665_100227792 | 589 |
| 147 | 3300031712 | Ga0265342_10011617 | Ga0265342_100116172 | 589 |
| 148 | 3300037471 | Ga0395905_0085226 | Ga0395905_0085226_243_2294 | 589 |
| 149 | 3300047471 | Ga0495684_0001645 | Ga0495684_0001645_12713_14758 | 589 |
| 150 | 3300005536 | Ga0070697_100004240 | Ga0070697_1000042405 | 590 |
| 151 | 3300005617 | Ga0068859_100001218 | Ga0068859_10000121820 | 590 |
| 152 | 3300006931 | Ga0097620_100001218 | Ga0097620_10000121820 | 590 |
| 153 | 3300025900 | Ga0207710_10002050 | Ga0207710_100020501 | 590 |
| 154 | 3300025913 | Ga0207695_10015533 | Ga0207695_100155337 | 590 |
| 155 | 3300028800 | Ga0265338_10027535 | Ga0265338_100275354 | 590 |
| 156 | 3300028800 | Ga0265338_10033682 | Ga0265338_100336824 | 590 |
| 157 | 3300031241 | Ga0265325_10044646 | Ga0265325_100446461 | 590 |
| 158 | 3300031247 | Ga0265340_10015123 | Ga0265340_100151233 | 590 |
| 159 | 3300031249 | Ga0265339_10007961 | Ga0265339_100079612 | 590 |
| 160 | 3300031249 | Ga0265339_10015971 | Ga0265339_100159712 | 590 |
| 161 | 3300031250 | Ga0265331_10007479 | Ga0265331_100074793 | 590 |
| 162 | 3300031344 | Ga0265316_10028057 | Ga0265316_100280573 | 590 |
| 163 | 3300031344 | Ga0265316_10067562 | Ga0265316_100675622 | 590 |
| 164 | 3300031711 | Ga0265314_10000564 | Ga0265314_1000056451 | 590 |
| 165 | 3300031712 | Ga0265342_10012957 | Ga0265342_100129574 | 590 |
| 166 | 3300037466 | Ga0395898_0017876 | Ga0395898_0017876_3271_5316 | 590 |
| 167 | 3300005436 | Ga0070713_100014865 | Ga0070713_1000148652 | 591 |
| 168 | 3300006028 | Ga0070717_10011163 | Ga0070717_100111633 | 591 |
| 169 | 3300025906 | Ga0207699_10049285 | Ga0207699_100492851 | 591 |
| 170 | 3300031235 | Ga0265330_10005992 | Ga0265330_100059925 | 591 |
| 171 | 3300031239 | Ga0265328_10006673 | Ga0265328_100066733 | 591 |
| 172 | 3300031241 | Ga0265325_10006468 | Ga0265325_100064686 | 591 |
| 173 | 3300031247 | Ga0265340_10006216 | Ga0265340_100062162 | 591 |
| 174 | 3300031247 | Ga0265340_10008247 | Ga0265340_100082472 | 591 |
| 175 | 3300031250 | Ga0265331_10008479 | Ga0265331_100084795 | 591 |
| 176 | 3300031344 | Ga0265316_10004429 | Ga0265316_100044294 | 591 |
| 177 | 3300048921 | Ga0496118_0028322 | Ga0496118_0028322_1263_3359 | 591 |
| 178 | 3300048929 | Ga0496126_0000850 | Ga0496126_0000850_10894_12990 | 591 |
| 179 | 3300049824 | Ga0501045_0060533 | Ga0501045_0060533_360_2390 | 591 |
| 180 | 3300021361 | Ga0213872_10007332 | Ga0213872_100073322 | 592 |
| 181 | 3300022732 | Ga0224569_100001 | Ga0224569_1000017 | 592 |
| 182 | 3300024227 | Ga0228598_1000020 | Ga0228598_10000206 | 592 |
| 183 | 3300026088 | Ga0207641_10012129 | Ga0207641_100121297 | 592 |
| 184 | 3300054114 | Ga0501084_0019449 | Ga0501084_0019449_1836_3866 | 592 |
| 185 | 3300005468 | Ga0070707_100032149 | Ga0070707_1000321492 | 593 |
| 186 | 3300005471 | Ga0070698_100011068 | Ga0070698_1000110686 | 593 |
| 187 | 3300025910 | Ga0207684_10009404 | Ga0207684_100094047 | 593 |
| 188 | 3300025922 | Ga0207646_10029308 | Ga0207646_100293082 | 593 |
| 189 | 3300035083 | Ga0373926_0000436 | Ga0373926_0000436_7275_9320 | 593 |
| 190 | 3300035089 | Ga0373944_0013623 | Ga0373944_0013623_92_2137 | 593 |
| 191 | 3300035111 | Ga0373923_0001368 | Ga0373923_0001368_4213_6258 | 593 |
| 192 | 3300035170 | Ga0373943_0001062 | Ga0373943_0001062_8817_10862 | 593 |
| 193 | 3300035695 | Ga0373927_0002059 | Ga0373927_0002059_5487_7532 | 593 |
| 194 | 3300035725 | Ga0373947_0002718 | Ga0373947_0002718_7287_9332 | 593 |
| 195 | 3300037068 | Ga0373925_0004332 | Ga0373925_0004332_7282_9327 | 593 |
| 196 | 3300046472 | Ga0495580_0023836 | Ga0495580_0023836_2116_4161 | 593 |
| 197 | 3300046517 | Ga0495630_0016965 | Ga0495630_0016965_2932_4977 | 593 |
| 198 | iso_pu_bacteria | 2848297114 | 2848297167 | 593 |
| 199 | 3300025938 | Ga0207704_10008586 | Ga0207704_100085863 | 594 |
| 200 | 3300048909 | Ga0496106_0000054 | Ga0496106_0000054_57687_59783 | 594 |
| 201 | 3300005354 | Ga0070675_100009772 | Ga0070675_1000097724 | 595 |
| 202 | 3300005434 | Ga0070709_10036570 | Ga0070709_100365702 | 595 |
| 203 | 3300005467 | Ga0070706_100001640 | Ga0070706_1000016402 | 595 |
| 204 | 3300005536 | Ga0070697_100011182 | Ga0070697_1000111824 | 595 |
| 205 | 3300025910 | Ga0207684_10036900 | Ga0207684_100369004 | 595 |
| 206 | 3300025918 | Ga0207662_10000873 | Ga0207662_100008737 | 595 |
| 207 | 3300025926 | Ga0207659_10000859 | Ga0207659_100008598 | 595 |
| 208 | 3300028563 | Ga0265319_1000243 | Ga0265319_100024329 | 595 |
| 209 | 3300028577 | Ga0265318_10000198 | Ga0265318_1000019824 | 595 |
| 210 | 3300031240 | Ga0265320_10001269 | Ga0265320_1000126911 | 595 |
| 211 | 3300031241 | Ga0265325_10023536 | Ga0265325_100235362 | 595 |
| 212 | 3300031242 | Ga0265329_10001276 | Ga0265329_100012768 | 595 |
| 213 | 3300031247 | Ga0265340_10002857 | Ga0265340_1000285710 | 595 |
| 214 | 3300031250 | Ga0265331_10000403 | Ga0265331_100004037 | 595 |
| 215 | 3300031250 | Ga0265331_10000455 | Ga0265331_1000045510 | 595 |
| 216 | 3300031344 | Ga0265316_10002553 | Ga0265316_100025536 | 595 |
| 217 | 3300031595 | Ga0265313_10004552 | Ga0265313_100045528 | 595 |
| 218 | 3300031712 | Ga0265342_10000346 | Ga0265342_1000034629 | 595 |
| 219 | 3300037312 | Ga0395899_0000503 | Ga0395899_0000503_12890_14926 | 595 |
| 220 | 3300037418 | Ga0395900_0000545 | Ga0395900_0000545_11547_13583 | 595 |
| 221 | 3300037466 | Ga0395898_0000315 | Ga0395898_0000315_12921_14957 | 595 |
| 222 | 3300037471 | Ga0395905_0000005 | Ga0395905_0000005_373695_375731 | 595 |
| 223 | 3300038443 | Ga0395901_0000242 | Ga0395901_0000242_10912_12948 | 595 |
| 224 | 3300005439 | Ga0070711_100000334 | Ga0070711_10000033411 | 596 |
| 225 | 3300025291 | Ga0209675_1001998 | Ga0209675_10019986 | 596 |
| 226 | 3300046462 | Ga0495651_0001391 | Ga0495651_0001391_8699_10744 | 596 |
| 227 | 3300046463 | Ga0495653_0006091 | Ga0495653_0006091_191_2233 | 596 |
| 228 | 3300046477 | Ga0495664_0048052 | Ga0495664_0048052_150_2192 | 596 |
| 229 | 3300046511 | Ga0495608_0003890 | Ga0495608_0003890_8244_10286 | 596 |
| 230 | 3300046514 | Ga0495618_0012799 | Ga0495618_0012799_592_2634 | 596 |
| 231 | 3300046516 | Ga0495628_0021192 | Ga0495628_0021192_1166_3208 | 596 |
| 232 | 3300046529 | Ga0495652_0001970 | Ga0495652_0001970_4519_6561 | 596 |
| 233 | 3300046536 | Ga0495587_0002165 | Ga0495587_0002165_7603_9645 | 596 |
| 234 | 3300046543 | Ga0495645_0064295 | Ga0495645_0064295_55_2097 | 596 |
| 235 | 3300046543 | Ga0495645_0073485 | Ga0495645_0073485_174_2219 | 596 |
| 236 | 3300046559 | Ga0495667_0000989 | Ga0495667_0000989_4306_6348 | 596 |
| 237 | 3300046663 | Ga0495635_0054643 | Ga0495635_0054643_517_2559 | 596 |
| 238 | 3300046675 | Ga0495657_0004661 | Ga0495657_0004661_2171_4213 | 596 |
| 239 | 3300046678 | Ga0495599_0004864 | Ga0495599_0004864_324_2366 | 596 |
| 240 | 3300046809 | Ga0495600_0001896 | Ga0495600_0001896_2014_4056 | 596 |
| 241 | 3300047317 | Ga0495604_0003114 | Ga0495604_0003114_9061_11103 | 596 |
| 242 | 3300047319 | Ga0495674_0050097 | Ga0495674_0050097_1692_3671 | 596 |
| 243 | 3300047319 | Ga0495674_0087297 | Ga0495674_0087297_514_2556 | 596 |
| 244 | 3300047322 | Ga0495680_0001356 | Ga0495680_0001356_4091_6136 | 596 |
| 245 | 3300047322 | Ga0495680_0003103 | Ga0495680_0003103_2683_4725 | 596 |
| 246 | 3300047444 | Ga0495675_0000038 | Ga0495675_0000038_75121_77163 | 596 |
| 247 | 3300047444 | Ga0495675_0011901 | Ga0495675_0011901_1449_3494 | 596 |
| 248 | 3300047471 | Ga0495684_0003016 | Ga0495684_0003016_2645_4687 | 596 |
| 249 | 3300005577 | Ga0068857_100002324 | Ga0068857_10000232411 | 597 |
| 250 | 3300025936 | Ga0207670_10004380 | Ga0207670_100043804 | 597 |
| 251 | 3300025940 | Ga0207691_10001717 | Ga0207691_100017176 | 597 |
| 252 | 3300025942 | Ga0207689_10081829 | Ga0207689_100818292 | 597 |
| 253 | 3300026116 | Ga0207674_10001643 | Ga0207674_1000164311 | 597 |
| 254 | 3300031090 | Ga0265760_10003062 | Ga0265760_100030621 | 597 |
| 255 | 3300035111 | Ga0373923_0001710 | Ga0373923_0001710_26_2101 | 597 |
| 256 | 3300035724 | Ga0373933_0016491 | Ga0373933_0016491_747_2864 | 597 |
| 257 | 3300035724 | Ga0373933_0045053 | Ga0373933_0045053_428_2503 | 597 |
| 258 | 3300036401 | Ga0373937_0026913 | Ga0373937_0026913_2063_4180 | 597 |
| 259 | 3300046454 | Ga0495592_0019495 | Ga0495592_0019495_2030_4147 | 597 |
| 260 | 3300046462 | Ga0495651_0009925 | Ga0495651_0009925_1925_4000 | 597 |
| 261 | 3300046463 | Ga0495653_0003892 | Ga0495653_0003892_7548_9623 | 597 |
| 262 | 3300046472 | Ga0495580_0004588 | Ga0495580_0004588_1626_3701 | 597 |
| 263 | 3300046516 | Ga0495628_0034045 | Ga0495628_0034045_466_2583 | 597 |
| 264 | 3300046517 | Ga0495630_0005469 | Ga0495630_0005469_5553_7598 | 597 |
| 265 | 3300046517 | Ga0495630_0011445 | Ga0495630_0011445_229_2304 | 597 |
| 266 | 3300046526 | Ga0495666_0016200 | Ga0495666_0016200_124_2199 | 597 |
| 267 | 3300046531 | Ga0495665_0006790 | Ga0495665_0006790_2101_4176 | 597 |
| 268 | 3300046535 | Ga0495586_0002781 | Ga0495586_0002781_3218_5293 | 597 |
| 269 | 3300046680 | Ga0495646_0000426 | Ga0495646_0000426_2583_4658 | 597 |
| 270 | 3300046690 | Ga0495624_0013521 | Ga0495624_0013521_1782_3857 | 597 |
| 271 | 3300047317 | Ga0495604_0006914 | Ga0495604_0006914_2011_4128 | 597 |
| 272 | 3300047444 | Ga0495675_0002235 | Ga0495675_0002235_7658_9733 | 597 |
| 273 | 3300047471 | Ga0495684_0005618 | Ga0495684_0005618_3998_6073 | 597 |
| 274 | 3300048089 | Ga0495614_0008984 | Ga0495614_0008984_548_2623 | 597 |
| 275 | 3300053078 | Ga0495612_0006187 | Ga0495612_0006187_2038_4113 | 597 |
| 276 | 3300053084 | Ga0495595_0008086 | Ga0495595_0008086_624_2741 | 597 |
| 277 | 3300053087 | Ga0500643_000232 | Ga0500643_000232_5269_7317 | 597 |
| 278 | 3300005539 | Ga0068853_100000656 | Ga0068853_10000065612 | 598 |
| 279 | 3300005563 | Ga0068855_100002483 | Ga0068855_1000024836 | 598 |
| 280 | 3300005578 | Ga0068854_100012992 | Ga0068854_1000129922 | 598 |
| 281 | 3300005614 | Ga0068856_100000382 | Ga0068856_10000038228 | 598 |
| 282 | 3300005616 | Ga0068852_100000361 | Ga0068852_1000003617 | 598 |
| 283 | 3300005983 | Ga0081540_1009521 | Ga0081540_10095212 | 598 |
| 284 | 3300009093 | Ga0105240_10010390 | Ga0105240_100103904 | 598 |
| 285 | 3300009174 | Ga0105241_10000036 | Ga0105241_1000003689 | 598 |
| 286 | 3300009545 | Ga0105237_10004629 | Ga0105237_100046298 | 598 |
| 287 | 3300009551 | Ga0105238_10000088 | Ga0105238_1000008896 | 598 |
| 288 | 3300010375 | Ga0105239_10004026 | Ga0105239_100040267 | 598 |
| 289 | 3300013100 | Ga0157373_10076899 | Ga0157373_100768991 | 598 |
| 290 | 3300013105 | Ga0157369_10008409 | Ga0157369_100084096 | 598 |
| 291 | 3300025911 | Ga0207654_10000052 | Ga0207654_1000005264 | 598 |
| 292 | 3300025913 | Ga0207695_10002072 | Ga0207695_1000207219 | 598 |
| 293 | 3300025914 | Ga0207671_10001318 | Ga0207671_1000131810 | 598 |
| 294 | 3300025920 | Ga0207649_10002426 | Ga0207649_100024267 | 598 |
| 295 | 3300025924 | Ga0207694_10000028 | Ga0207694_1000002819 | 598 |
| 296 | 3300025949 | Ga0207667_10005791 | Ga0207667_1000579110 | 598 |
| 297 | 3300026041 | Ga0207639_10000043 | Ga0207639_10000043109 | 598 |
| 298 | 3300026078 | Ga0207702_10000834 | Ga0207702_1000083418 | 598 |
| 299 | 3300026142 | Ga0207698_10000046 | Ga0207698_1000004671 | 598 |
| 300 | 3300037068 | Ga0373925_0005709 | Ga0373925_0005709_3892_5919 | 598 |
| 301 | 3300046516 | Ga0495628_0034602 | Ga0495628_0034602_1900_3945 | 598 |
| 302 | 3300047317 | Ga0495604_0022516 | Ga0495604_0022516_638_2683 | 598 |
| 303 | 3300047444 | Ga0495675_0072524 | Ga0495675_0072524_81_2126 | 598 |
| 304 | 3300005439 | Ga0070711_100001289 | Ga0070711_1000012892 | 599 |
| 305 | 3300005536 | Ga0070697_100059857 | Ga0070697_1000598572 | 599 |
| 306 | 3300009148 | Ga0105243_10058370 | Ga0105243_100583702 | 599 |
| 307 | 3300025935 | Ga0207709_10061587 | Ga0207709_100615872 | 599 |
| 308 | 3300028800 | Ga0265338_10001153 | Ga0265338_1000115331 | 599 |
| 309 | 3300031711 | Ga0265314_10001387 | Ga0265314_100013872 | 599 |
| 310 | 3300005331 | Ga0070670_100000733 | Ga0070670_10000073315 | 600 |
| 311 | 3300005338 | Ga0068868_100029772 | Ga0068868_1000297721 | 600 |
| 312 | 3300005367 | Ga0070667_100000267 | Ga0070667_10000026740 | 600 |
| 313 | 3300005614 | Ga0068856_100003704 | Ga0068856_1000037047 | 600 |
| 314 | 3300005618 | Ga0068864_100000506 | Ga0068864_10000050615 | 600 |
| 315 | 3300005841 | Ga0068863_100000898 | Ga0068863_10000089830 | 600 |
| 316 | 3300005841 | Ga0068863_100007234 | Ga0068863_1000072345 | 600 |
| 317 | 3300005843 | Ga0068860_100001482 | Ga0068860_1000014827 | 600 |
| 318 | 3300005844 | Ga0068862_100046011 | Ga0068862_1000460112 | 600 |
| 319 | 3300006028 | Ga0070717_10001711 | Ga0070717_100017117 | 600 |
| 320 | 3300006237 | Ga0097621_100057552 | Ga0097621_1000575522 | 600 |
| 321 | 3300009098 | Ga0105245_10009846 | Ga0105245_100098464 | 600 |
| 322 | 3300009174 | Ga0105241_10010035 | Ga0105241_100100356 | 600 |
| 323 | 3300009177 | Ga0105248_10154922 | Ga0105248_101549222 | 600 |
| 324 | 3300009545 | Ga0105237_10133068 | Ga0105237_101330681 | 600 |
| 325 | 3300010375 | Ga0105239_10089261 | Ga0105239_100892612 | 600 |
| 326 | 3300011119 | Ga0105246_10001970 | Ga0105246_100019704 | 600 |
| 327 | 3300013296 | Ga0157374_10081952 | Ga0157374_100819522 | 600 |
| 328 | 3300013297 | Ga0157378_10031245 | Ga0157378_100312454 | 600 |
| 329 | 3300013306 | Ga0163162_10086012 | Ga0163162_100860122 | 600 |
| 330 | 3300014325 | Ga0163163_10001028 | Ga0163163_100010288 | 600 |
| 331 | 3300014968 | Ga0157379_10000305 | Ga0157379_1000030518 | 600 |
| 332 | 3300025911 | Ga0207654_10001505 | Ga0207654_100015057 | 600 |
| 333 | 3300025913 | Ga0207695_10000538 | Ga0207695_1000053828 | 600 |
| 334 | 3300025914 | Ga0207671_10001289 | Ga0207671_100012895 | 600 |
| 335 | 3300025925 | Ga0207650_10020580 | Ga0207650_100205802 | 600 |
| 336 | 3300025986 | Ga0207658_10000163 | Ga0207658_1000016359 | 600 |
| 337 | 3300026023 | Ga0207677_10000076 | Ga0207677_1000007659 | 600 |
| 338 | 3300026078 | Ga0207702_10006030 | Ga0207702_100060304 | 600 |
| 339 | 3300026088 | Ga0207641_10005273 | Ga0207641_100052732 | 600 |
| 340 | 3300026088 | Ga0207641_10018780 | Ga0207641_100187802 | 600 |
| 341 | 3300026095 | Ga0207676_10010954 | Ga0207676_100109545 | 600 |
| 342 | 3300028380 | Ga0268265_10026475 | Ga0268265_100264752 | 600 |
| 343 | 3300031235 | Ga0265330_10000369 | Ga0265330_1000036914 | 600 |
| 344 | 3300031241 | Ga0265325_10000123 | Ga0265325_1000012312 | 600 |
| 345 | 3300031249 | Ga0265339_10002921 | Ga0265339_100029212 | 600 |
| 346 | 3300031344 | Ga0265316_10003681 | Ga0265316_100036816 | 600 |
| 347 | 3300031595 | Ga0265313_10010620 | Ga0265313_100106202 | 600 |
| 348 | 3300031712 | Ga0265342_10001635 | Ga0265342_100016357 | 600 |
| 349 | 3300049823 | Ga0501044_0050215 | Ga0501044_0050215_1329_3359 | 600 |
| 350 | 3300050512 | nmdc:mga0n895_6964_c1 | nmdc:mga0n895_6964_c1_4267_6339 | 600 |
| 351 | 3300005548 | Ga0070665_100037493 | Ga0070665_1000374935 | 601 |
| 352 | 3300028800 | Ga0265338_10013219 | Ga0265338_100132196 | 601 |
| 353 | 3300036401 | Ga0373937_0028735 | Ga0373937_0028735_985_3030 | 601 |
| 354 | 3300046472 | Ga0495580_0016434 | Ga0495580_0016434_1829_3853 | 601 |
| 355 | 3300046472 | Ga0495580_0030303 | Ga0495580_0030303_1515_3542 | 601 |
| 356 | 3300006173 | Ga0070716_100001269 | Ga0070716_1000012692 | 602 |
| 357 | 3300025939 | Ga0207665_10000309 | Ga0207665_1000030922 | 602 |
| 358 | 3300035113 | Ga0373936_0001427 | Ga0373936_0001427_3255_5300 | 602 |
| 359 | 3300035410 | Ga0373924_0018203 | Ga0373924_0018203_20_2065 | 602 |
| 360 | 3300035692 | Ga0373935_0000209 | Ga0373935_0000209_822_2867 | 602 |
| 361 | 3300035695 | Ga0373927_0002490 | Ga0373927_0002490_3364_5409 | 602 |
| 362 | 3300039450 | Ga0436363_1714569 | Ga0436363_1714569_306_2336 | 602 |
| 363 | 3300046531 | Ga0495665_0001245 | Ga0495665_0001245_6040_8085 | 602 |
| 364 | 3300046559 | Ga0495667_0012131 | Ga0495667_0012131_35_2080 | 602 |
| 365 | 3300046663 | Ga0495635_0029370 | Ga0495635_0029370_951_2996 | 602 |
| 366 | 3300047315 | Ga0495581_0006715 | Ga0495581_0006715_1370_3415 | 602 |
| 367 | 3300047319 | Ga0495674_0064253 | Ga0495674_0064253_821_2866 | 602 |
| 368 | 3300050514 | nmdc:mga08x19_18570_c1 | nmdc:mga08x19_18570_c1_101_2149 | 602 |
| 369 | 3300053077 | Ga0495601_0007080 | Ga0495601_0007080_1311_3347 | 602 |
| 370 | 3300013307 | Ga0157372_10001066 | Ga0157372_100010662 | 603 |
| 371 | 3300025928 | Ga0207700_10084612 | Ga0207700_100846121 | 603 |
| 372 | 3300042876 | Ga0451577_0001507 | Ga0451577_0001507_10524_12545 | 603 |
| 373 | 3300045051 | Ga0451576_0025506 | Ga0451576_0025506_1140_3251 | 603 |
| 374 | 3300039450 | Ga0436363_0305738 | Ga0436363_0305738_6178_8199 | 604 |
| 375 | 3300046461 | Ga0495641_0014767 | Ga0495641_0014767_528_2576 | 604 |
| 376 | 3300046472 | Ga0495580_0016484 | Ga0495580_0016484_3349_5397 | 604 |
| 377 | 3300046473 | Ga0495582_0000458 | Ga0495582_0000458_8108_10156 | 604 |
| 378 | 3300046543 | Ga0495645_0075123 | Ga0495645_0075123_16_2064 | 604 |
| 379 | 3300048918 | Ga0496115_0050926 | Ga0496115_0050926_222_2270 | 604 |
| 380 | 3300049588 | Ga0501072_0021438 | Ga0501072_0021438_707_2782 | 604 |
| 381 | 3300053077 | Ga0495601_0014426 | Ga0495601_0014426_746_2794 | 604 |
| 382 | 3300005367 | Ga0070667_100051802 | Ga0070667_1000518023 | 605 |
| 383 | 3300005436 | Ga0070713_100024867 | Ga0070713_1000248672 | 605 |
| 384 | 3300005468 | Ga0070707_100064733 | Ga0070707_1000647332 | 605 |
| 385 | 3300005471 | Ga0070698_100001127 | Ga0070698_10000112725 | 605 |
| 386 | 3300005518 | Ga0070699_100006840 | Ga0070699_1000068404 | 605 |
| 387 | 3300005518 | Ga0070699_100078123 | Ga0070699_1000781232 | 605 |
| 388 | 3300005536 | Ga0070697_100011602 | Ga0070697_1000116022 | 605 |
| 389 | 3300006175 | Ga0070712_100007748 | Ga0070712_1000077488 | 605 |
| 390 | 3300006237 | Ga0097621_100001902 | Ga0097621_1000019023 | 605 |
| 391 | 3300006358 | Ga0068871_100006265 | Ga0068871_1000062658 | 605 |
| 392 | 3300007265 | Ga0099794_10002260 | Ga0099794_100022604 | 605 |
| 393 | 3300014969 | Ga0157376_10000014 | Ga0157376_1000001447 | 605 |
| 394 | 3300025906 | Ga0207699_10004975 | Ga0207699_100049755 | 605 |
| 395 | 3300025916 | Ga0207663_10002713 | Ga0207663_100027133 | 605 |
| 396 | 3300025922 | Ga0207646_10032203 | Ga0207646_100322033 | 605 |
| 397 | 3300025928 | Ga0207700_10019110 | Ga0207700_100191102 | 605 |
| 398 | 3300025929 | Ga0207664_10011412 | Ga0207664_100114122 | 605 |
| 399 | 3300025986 | Ga0207658_10014728 | Ga0207658_100147282 | 605 |
| 400 | 3300027671 | Ga0209588_1002340 | Ga0209588_10023404 | 605 |
| 401 | 3300028380 | Ga0268265_10057009 | Ga0268265_100570092 | 605 |
| 402 | 3300028381 | Ga0268264_10005784 | Ga0268264_100057846 | 605 |
| 403 | 3300028800 | Ga0265338_10036142 | Ga0265338_100361422 | 605 |
| 404 | 3300035724 | Ga0373933_0004419 | Ga0373933_0004419_4420_6468 | 605 |
| 405 | 3300036401 | Ga0373937_0008394 | Ga0373937_0008394_4448_6496 | 605 |
| 406 | 3300048088 | Ga0495602_0038045 | Ga0495602_0038045_875_2923 | 605 |
| 407 | 3300048917 | Ga0496114_0015955 | Ga0496114_0015955_731_2779 | 605 |
| 408 | 3300048918 | Ga0496115_0039705 | Ga0496115_0039705_158_2206 | 605 |
| 409 | 3300050513 | nmdc:mga0rr50_49221_c1 | nmdc:mga0rr50_49221_c1_425_2521 | 605 |
| 410 | 3300005338 | Ga0068868_100038498 | Ga0068868_1000384983 | 606 |
| 411 | 3300005439 | Ga0070711_100014418 | Ga0070711_1000144184 | 606 |
| 412 | 3300005471 | Ga0070698_100009333 | Ga0070698_1000093332 | 606 |
| 413 | 3300005563 | Ga0068855_100117050 | Ga0068855_1001170502 | 606 |
| 414 | 3300005985 | Ga0081539_10007203 | Ga0081539_100072035 | 606 |
| 415 | 3300006028 | Ga0070717_10039262 | Ga0070717_100392622 | 606 |
| 416 | 3300006237 | Ga0097621_100007707 | Ga0097621_1000077074 | 606 |
| 417 | 3300006358 | Ga0068871_100001374 | Ga0068871_1000013745 | 606 |
| 418 | 3300006871 | Ga0075434_100037571 | Ga0075434_1000375712 | 606 |
| 419 | 3300007076 | Ga0075435_100033728 | Ga0075435_1000337282 | 606 |
| 420 | 3300009176 | Ga0105242_10017800 | Ga0105242_100178003 | 606 |
| 421 | 3300013104 | Ga0157370_10014880 | Ga0157370_100148803 | 606 |
| 422 | 3300013297 | Ga0157378_10027096 | Ga0157378_100270963 | 606 |
| 423 | 3300025903 | Ga0207680_10021320 | Ga0207680_100213202 | 606 |
| 424 | 3300025915 | Ga0207693_10032614 | Ga0207693_100326143 | 606 |
| 425 | 3300025916 | Ga0207663_10012901 | Ga0207663_100129013 | 606 |
| 426 | 3300025931 | Ga0207644_10021000 | Ga0207644_100210002 | 606 |
| 427 | 3300025949 | Ga0207667_10089487 | Ga0207667_100894872 | 606 |
| 428 | 3300026023 | Ga0207677_10018318 | Ga0207677_100183182 | 606 |
| 429 | 3300035083 | Ga0373926_0004645 | Ga0373926_0004645_2038_4095 | 606 |
| 430 | 3300035172 | Ga0373955_0001580 | Ga0373955_0001580_5624_7660 | 606 |
| 431 | 3300035695 | Ga0373927_0000687 | Ga0373927_0000687_3380_5437 | 606 |
| 432 | 3300036401 | Ga0373937_0006560 | Ga0373937_0006560_6941_8977 | 606 |
| 433 | 3300037068 | Ga0373925_0004050 | Ga0373925_0004050_7987_10044 | 606 |
| 434 | 3300044656 | Ga0466969_0037157 | Ga0466969_0037157_361_2397 | 606 |
| 435 | 3300046506 | Ga0495583_0000027 | Ga0495583_0000027_196412_198442 | 606 |
| 436 | 3300046517 | Ga0495630_0003809 | Ga0495630_0003809_5342_7399 | 606 |
| 437 | 3300047321 | Ga0495676_0064900 | Ga0495676_0064900_40_2097 | 606 |
| 438 | 3300048910 | Ga0496107_0097269 | Ga0496107_0097269_61_2097 | 606 |
| 439 | 3300048917 | Ga0496114_0000006 | Ga0496114_0000006_76563_78599 | 606 |
| 440 | 3300048921 | Ga0496118_0009338 | Ga0496118_0009338_4794_6800 | 606 |
| 441 | 3300048924 | Ga0496121_0005696 | Ga0496121_0005696_5988_7994 | 606 |
| 442 | 3300050512 | nmdc:mga0n895_6912_c1 | nmdc:mga0n895_6912_c1_3333_5363 | 606 |
| 443 | 3300050513 | nmdc:mga0rr50_26640_c1 | nmdc:mga0rr50_26640_c1_837_2867 | 606 |
| 444 | 3300053103 | Ga0500555_001028 | Ga0500555_001028_6741_8771 | 606 |
| 445 | 3300005467 | Ga0070706_100007511 | Ga0070706_1000075118 | 607 |
| 446 | 3300005468 | Ga0070707_100006661 | Ga0070707_1000066618 | 607 |
| 447 | 3300005471 | Ga0070698_100005177 | Ga0070698_1000051778 | 607 |
| 448 | 3300005518 | Ga0070699_100001183 | Ga0070699_10000118315 | 607 |
| 449 | 3300005536 | Ga0070697_100004353 | Ga0070697_1000043533 | 607 |
| 450 | 3300013297 | Ga0157378_10001504 | Ga0157378_1000150414 | 607 |
| 451 | 3300025910 | Ga0207684_10007645 | Ga0207684_100076452 | 607 |
| 452 | 3300025910 | Ga0207684_10053959 | Ga0207684_100539593 | 607 |
| 453 | 3300025922 | Ga0207646_10000415 | Ga0207646_100004155 | 607 |
| 454 | 3300025922 | Ga0207646_10002244 | Ga0207646_1000224415 | 607 |
| 455 | 3300027671 | Ga0209588_1000637 | Ga0209588_10006374 | 607 |
| 456 | 3300030760 | Ga0265762_1000553 | Ga0265762_10005536 | 607 |
| 457 | 3300039447 | Ga0436361_0602192 | Ga0436361_0602192_13102_15165 | 607 |
| 458 | 3300005445 | Ga0070708_100001790 | Ga0070708_10000179011 | 608 |
| 459 | 3300005518 | Ga0070699_100042930 | Ga0070699_1000429302 | 608 |
| 460 | 3300005614 | Ga0068856_100002267 | Ga0068856_1000022674 | 608 |
| 461 | 3300021358 | Ga0213873_10003542 | Ga0213873_100035422 | 608 |
| 462 | 3300026078 | Ga0207702_10000880 | Ga0207702_1000088010 | 608 |
| 463 | 3300039453 | Ga0436362_0944545 | Ga0436362_0944545_4394_6424 | 608 |
| 464 | 3300005330 | Ga0070690_100015851 | Ga0070690_1000158513 | 609 |
| 465 | 3300005343 | Ga0070687_100000839 | Ga0070687_1000008395 | 609 |
| 466 | 3300005455 | Ga0070663_100001078 | Ga0070663_1000010783 | 609 |
| 467 | 3300005459 | Ga0068867_100001057 | Ga0068867_10000105713 | 609 |
| 468 | 3300005530 | Ga0070679_100037285 | Ga0070679_1000372851 | 609 |
| 469 | 3300005536 | Ga0070697_100000208 | Ga0070697_1000002087 | 609 |
| 470 | 3300005544 | Ga0070686_100004422 | Ga0070686_1000044223 | 609 |
| 471 | 3300005563 | Ga0068855_100001962 | Ga0068855_10000196210 | 609 |
| 472 | 3300005563 | Ga0068855_100003923 | Ga0068855_1000039238 | 609 |
| 473 | 3300005563 | Ga0068855_100128847 | Ga0068855_1001288472 | 609 |
| 474 | 3300005614 | Ga0068856_100000241 | Ga0068856_10000024110 | 609 |
| 475 | 3300005614 | Ga0068856_100035650 | Ga0068856_1000356503 | 609 |
| 476 | 3300005614 | Ga0068856_100069313 | Ga0068856_1000693131 | 609 |
| 477 | 3300005718 | Ga0068866_10002202 | Ga0068866_100022026 | 609 |
| 478 | 3300005842 | Ga0068858_100021531 | Ga0068858_1000215314 | 609 |
| 479 | 3300006028 | Ga0070717_10001525 | Ga0070717_1000152512 | 609 |
| 480 | 3300006028 | Ga0070717_10059163 | Ga0070717_100591632 | 609 |
| 481 | 3300006237 | Ga0097621_100000055 | Ga0097621_10000005510 | 609 |
| 482 | 3300006358 | Ga0068871_100000898 | Ga0068871_1000008986 | 609 |
| 483 | 3300006880 | Ga0075429_100018197 | Ga0075429_1000181972 | 609 |
| 484 | 3300006914 | Ga0075436_100001265 | Ga0075436_10000126515 | 609 |
| 485 | 3300009174 | Ga0105241_10001564 | Ga0105241_100015646 | 609 |
| 486 | 3300009177 | Ga0105248_10002319 | Ga0105248_100023193 | 609 |
| 487 | 3300013105 | Ga0157369_10014181 | Ga0157369_100141817 | 609 |
| 488 | 3300013296 | Ga0157374_10000674 | Ga0157374_100006748 | 609 |
| 489 | 3300013297 | Ga0157378_10000072 | Ga0157378_100000729 | 609 |
| 490 | 3300013307 | Ga0157372_10000877 | Ga0157372_1000087721 | 609 |
| 491 | 3300013307 | Ga0157372_10012518 | Ga0157372_100125186 | 609 |
| 492 | 3300015262 | Ga0182007_10014693 | Ga0182007_100146932 | 609 |
| 493 | 3300024227 | Ga0228598_1000466 | Ga0228598_10004664 | 609 |
| 494 | 3300025899 | Ga0207642_10008381 | Ga0207642_100083812 | 609 |
| 495 | 3300025903 | Ga0207680_10035246 | Ga0207680_100352461 | 609 |
| 496 | 3300025928 | Ga0207700_10045813 | Ga0207700_100458132 | 609 |
| 497 | 3300025933 | Ga0207706_10001905 | Ga0207706_1000190514 | 609 |
| 498 | 3300025941 | Ga0207711_10001067 | Ga0207711_100010677 | 609 |
| 499 | 3300025941 | Ga0207711_10007191 | Ga0207711_100071912 | 609 |
| 500 | 3300025949 | Ga0207667_10001808 | Ga0207667_1000180811 | 609 |
| 501 | 3300025949 | Ga0207667_10119254 | Ga0207667_101192542 | 609 |
| 502 | 3300025981 | Ga0207640_10086021 | Ga0207640_100860212 | 609 |
| 503 | 3300026067 | Ga0207678_10000143 | Ga0207678_1000014326 | 609 |
| 504 | 3300026078 | Ga0207702_10000152 | Ga0207702_1000015265 | 609 |
| 505 | 3300026078 | Ga0207702_10003040 | Ga0207702_100030407 | 609 |
| 506 | 3300026088 | Ga0207641_10061604 | Ga0207641_100616043 | 609 |
| 507 | 3300026089 | Ga0207648_10000388 | Ga0207648_1000038831 | 609 |
| 508 | 3300028379 | Ga0268266_10005371 | Ga0268266_100053715 | 609 |
| 509 | 3300031090 | Ga0265760_10002732 | Ga0265760_100027323 | 609 |
| 510 | 3300046455 | Ga0495603_0013668 | Ga0495603_0013668_1188_3236 | 609 |
| 511 | 3300046472 | Ga0495580_0000421 | Ga0495580_0000421_13121_15217 | 609 |
| 512 | 3300046472 | Ga0495580_0034709 | Ga0495580_0034709_641_2689 | 609 |
| 513 | 3300046535 | Ga0495586_0039686 | Ga0495586_0039686_52_2100 | 609 |
| 514 | 3300047320 | Ga0495672_0001806 | Ga0495672_0001806_8369_10408 | 609 |
| 515 | 3300047673 | Ga0495593_0021786 | Ga0495593_0021786_860_2908 | 609 |
| 516 | 3300048915 | Ga0496112_0026198 | Ga0496112_0026198_24_2048 | 609 |
| 517 | 3300048915 | Ga0496112_0064802 | Ga0496112_0064802_1455_3482 | 609 |
| 518 | 3300050508 | nmdc:mga09592_7123_c1 | nmdc:mga09592_7123_c1_171_2240 | 609 |
| 519 | 3300050514 | nmdc:mga08x19_1360_c1 | nmdc:mga08x19_1360_c1_10831_12888 | 609 |
| 520 | 3300054114 | Ga0501084_0084179 | Ga0501084_0084179_430_2469 | 609 |
| 521 | 3300061734 | Ga0530510_0050215 | Ga0530510_0050215_665_2704 | 609 |
| 522 | 3300001991 | JGI24743J22301_10000234 | JGI24743J22301_100002344 | 610 |
| 523 | 3300005293 | Ga0065715_10008447 | Ga0065715_100084472 | 610 |
| 524 | 3300005328 | Ga0070676_10002079 | Ga0070676_100020796 | 610 |
| 525 | 3300005329 | Ga0070683_100000388 | Ga0070683_10000038813 | 610 |
| 526 | 3300005334 | Ga0068869_100001749 | Ga0068869_1000017493 | 610 |
| 527 | 3300005337 | Ga0070682_100014018 | Ga0070682_1000140183 | 610 |
| 528 | 3300005338 | Ga0068868_100001390 | Ga0068868_1000013907 | 610 |
| 529 | 3300005344 | Ga0070661_100001681 | Ga0070661_1000016812 | 610 |
| 530 | 3300005365 | Ga0070688_100000493 | Ga0070688_1000004935 | 610 |
| 531 | 3300005366 | Ga0070659_100028963 | Ga0070659_1000289632 | 610 |
| 532 | 3300005436 | Ga0070713_100028764 | Ga0070713_1000287643 | 610 |
| 533 | 3300005436 | Ga0070713_100115143 | Ga0070713_1001151432 | 610 |
| 534 | 3300005439 | Ga0070711_100014425 | Ga0070711_1000144255 | 610 |
| 535 | 3300005445 | Ga0070708_100016018 | Ga0070708_1000160186 | 610 |
| 536 | 3300005456 | Ga0070678_100010083 | Ga0070678_1000100833 | 610 |
| 537 | 3300005535 | Ga0070684_100000706 | Ga0070684_10000070611 | 610 |
| 538 | 3300005539 | Ga0068853_100052976 | Ga0068853_1000529763 | 610 |
| 539 | 3300005564 | Ga0070664_100004044 | Ga0070664_1000040443 | 610 |
| 540 | 3300005578 | Ga0068854_100026268 | Ga0068854_1000262682 | 610 |
| 541 | 3300005615 | Ga0070702_100016981 | Ga0070702_1000169813 | 610 |
| 542 | 3300005834 | Ga0068851_10001335 | Ga0068851_100013355 | 610 |
| 543 | 3300006028 | Ga0070717_10026871 | Ga0070717_100268714 | 610 |
| 544 | 3300006028 | Ga0070717_10098850 | Ga0070717_100988502 | 610 |
| 545 | 3300006173 | Ga0070716_100000009 | Ga0070716_10000000958 | 610 |
| 546 | 3300006173 | Ga0070716_100000171 | Ga0070716_10000017118 | 610 |
| 547 | 3300013100 | Ga0157373_10009903 | Ga0157373_100099034 | 610 |
| 548 | 3300013105 | Ga0157369_10013357 | Ga0157369_100133576 | 610 |
| 549 | 3300013307 | Ga0157372_10028726 | Ga0157372_100287265 | 610 |
| 550 | 3300014969 | Ga0157376_10006248 | Ga0157376_100062486 | 610 |
| 551 | 3300017792 | Ga0163161_10029585 | Ga0163161_100295852 | 610 |
| 552 | 3300025321 | Ga0207656_10002035 | Ga0207656_100020353 | 610 |
| 553 | 3300025904 | Ga0207647_10003423 | Ga0207647_100034233 | 610 |
| 554 | 3300025907 | Ga0207645_10001672 | Ga0207645_100016727 | 610 |
| 555 | 3300025920 | Ga0207649_10000899 | Ga0207649_100008998 | 610 |
| 556 | 3300025925 | Ga0207650_10000058 | Ga0207650_1000005812 | 610 |
| 557 | 3300025929 | Ga0207664_10025988 | Ga0207664_100259882 | 610 |
| 558 | 3300025932 | Ga0207690_10044512 | Ga0207690_100445122 | 610 |
| 559 | 3300025937 | Ga0207669_10025192 | Ga0207669_100251922 | 610 |
| 560 | 3300025939 | Ga0207665_10000001 | Ga0207665_1000000186 | 610 |
| 561 | 3300025939 | Ga0207665_10000039 | Ga0207665_1000003969 | 610 |
| 562 | 3300025939 | Ga0207665_10066363 | Ga0207665_100663631 | 610 |
| 563 | 3300025945 | Ga0207679_10000141 | Ga0207679_1000014126 | 610 |
| 564 | 3300025960 | Ga0207651_10031970 | Ga0207651_100319702 | 610 |
| 565 | 3300026088 | Ga0207641_10001695 | Ga0207641_100016956 | 610 |
| 566 | 3300026095 | Ga0207676_10000242 | Ga0207676_1000024227 | 610 |
| 567 | 3300026121 | Ga0207683_10000687 | Ga0207683_100006879 | 610 |
| 568 | 3300030760 | Ga0265762_1001187 | Ga0265762_10011874 | 610 |
| 569 | 3300031090 | Ga0265760_10000739 | Ga0265760_100007397 | 610 |
| 570 | 3300046472 | Ga0495580_0007434 | Ga0495580_0007434_4396_6426 | 610 |
| 571 | 3300046514 | Ga0495618_0001605 | Ga0495618_0001605_3343_5409 | 610 |
| 572 | iso_pu_bacteria | 2888373701 | 2888374552 | 610 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u7q-assembly1.cif.gz_A | the solution structure of the nucleotide binding domain of kdpb | 0.9309 | 260 | 395 |
| 1u7q-assembly1.cif.gz_A | the solution structure of the nucleotide binding domain of kdpb | 0.9244 | 260 | 395 |
| 2voy-assembly1.cif.gz_J | cryoem model of copa, the copper transporting atpase from archaeoglobus fulgidus | 0.8248 | 259 | 389 |
| 2voy-assembly1.cif.gz_J | cryoem model of copa, the copper transporting atpase from archaeoglobus fulgidus | 0.7999 | 259 | 389 |
| 2voy-assembly1.cif.gz_I | cryoem model of copa, the copper transporting atpase from archaeoglobus fulgidus | 0.7969 | 394 | 506 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPU3_333_476_3.40.1110.10 | Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N | 0.9517 | 260 | 393 | 3.40.1110.10 |
| af_Q2FWI0_295_426_3.40.1110.10 | Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N | 0.9306 | 260 | 392 | 3.40.1110.10 |
| af_Q2FWI0_295_426_3.40.1110.10 | Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N | 0.917 | 260 | 392 | 3.40.1110.10 |
| af_P9WPU3_333_476_3.40.1110.10 | Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N | 0.8812 | 260 | 393 | 3.40.1110.10 |
| af_P9WPS3_469_590_3.40.1110.10 | Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N | 0.8718 | 260 | 391 | 3.40.1110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1K4Z3-F1-model_v4 | CBS domain-containing protein | 0.9075 | 259 | 475 |
GO:0005524
GO:0008556 GO:0016020 GO:0016887 |
| AF-A0A6B3FGJ3-F1-model_v4 | HAD family hydrolase | 0.8861 | 256 | 424 |
GO:0005524
GO:0008556 GO:0016020 GO:0016787 |
| AF-X1K4Z3-F1-model_v4 | CBS domain-containing protein | 0.8448 | 259 | 475 |
GO:0005524
GO:0008556 GO:0016020 GO:0016887 |
| AF-A0A519JCB6-F1-model_v4 | K(+)-transporting ATPase subunit B | 0.8361 | 128 | 522 |
GO:0005524
GO:0008556 GO:0016020 GO:0016887 |
| AF-A0A6B3FGJ3-F1-model_v4 | HAD family hydrolase | 0.8354 | 256 | 424 |
GO:0005524
GO:0008556 GO:0016020 GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar