F465046

General Info

Members Datasets Scaffolds Average Seq Length
572 285 570 647

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100000656|Ga0068853_10000065612
Length 698
Sequence MSSYNDFSFAAQAEVPSSSSGPDSQVPIPPSALLPPEHRGHRKRKTTAGGLEQKSLWNAQIVRQAAIYSLKKLNPRWMIKNPVMFVVEVGSLLTTSLLITDAIHNRQGFFTVLFANFAEAMAEGRGKXXXDTLRKAKGETIAQRYTVSGALEQVTSGQLRAGDVIYVPAGHYIAGDGEVTEGVASVDESAITGESAPVIREGGGDRSAVTGGTKVLSDWIKVRITSNPGETFLDRMIALVEGATRQKTPNEIALSILLSGLTIVFLLAVVTLQPFAIYSKAPQTIFVLVSLLVCLIPTTIGGLLSAIGIAGMDRLVQYNVLAMSGRAVEAAGDVNTLLLDKTGTITLGNRQATEFIPAPDVTAERLADAAQFASLSDETPEGRSIVVLAKEKYNLRGRDLGGVHAEFVPFSAQTRMSGVNLPGMRIRKGSAAAIARFLEDQGSALPKKVREAVEEISRAGGTPLVVAENSTALGVIYLKDIVKGGLKERLARLRAMGIRTVMITGDNPLTAAVIAREAGVDDFLAEAKPKDKMDLIKREQAKGKLVAMTGDGTNDAPALAQADVGVAMNSGTQAAKEAGNMVDLDSNPTKLIEIVEIGKQLLMTRGALTTFSIANDVAKYFAIIPAMFAGAFPVLNALNIMHLATPQSAILSRGVKYEPKAAEALLRQNLLIYGVGGVIIPFIGIKAIDVLLVAAHLA

Samples

Sample ID Description Type Environment
1 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
2 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
279 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
280 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
281 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
282 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0.87
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 3.5
Rhizosphere 93.18
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000234 3300001991 Bacteria 5878
2 Ga0065715_10008447 3300005293 Bacteria 5652
3 Ga0070676_10002079 3300005328 Bacteria 10189
4 Ga0070683_100000388 3300005329 Bacteria 30404
5 Ga0070690_100015851 3300005330 Bacteria 4502
6 Ga0070670_100000733 3300005331 Bacteria 25485
7 Ga0068869_100001749 3300005334 Bacteria 12983
8 Ga0070666_10000667 3300005335 Bacteria 20738
9 Ga0070682_100014018 3300005337 Bacteria 4626
10 Ga0068868_100001390 3300005338 Bacteria 16686
11 Ga0068868_100029772 3300005338 Bacteria 4183
12 Ga0068868_100038498 3300005338 Bacteria 3712
13 Ga0070687_100000839 3300005343 Bacteria 10248
14 Ga0070661_100001681 3300005344 Bacteria 15317
15 Ga0070668_100000213 3300005347 Bacteria 37697
16 Ga0070675_100009772 3300005354 Bacteria 7473
17 Ga0070688_100000493 3300005365 Bacteria 19999
18 Ga0070659_100028963 3300005366 Bacteria 4278
19 Ga0070667_100000267 3300005367 Bacteria 59181
20 Ga0070667_100000914 3300005367 Bacteria 27251
21 Ga0070667_100004192 3300005367 Bacteria 12173
22 Ga0070667_100051802 3300005367 Bacteria 3461
23 Ga0070709_10036570 3300005434 Bacteria 2992
24 Ga0070714_100019566 3300005435 Bacteria 5518
25 Ga0070713_100014865 3300005436 Bacteria 5794
26 Ga0070713_100024867 3300005436 Bacteria 4674
27 Ga0070713_100028764 3300005436 Bacteria 4392
28 Ga0070713_100044937 3300005436 Bacteria 3617
29 Ga0070713_100115143 3300005436 Bacteria 2350
30 Ga0070710_10000042 3300005437 Bacteria 58499
31 Ga0070711_100000334 3300005439 Bacteria 24165
32 Ga0070711_100001289 3300005439 Bacteria 13617
33 Ga0070711_100014418 3300005439 Bacteria 4981
34 Ga0070711_100014425 3300005439 Bacteria 4980
35 Ga0070708_100001790 3300005445 Bacteria 16493
36 Ga0070708_100016018 3300005445 Bacteria 6209
37 Ga0070663_100001078 3300005455 Bacteria 14951
38 Ga0070663_100027398 3300005455 Bacteria 3870
39 Ga0070678_100010083 3300005456 Bacteria 5752
40 Ga0068867_100001057 3300005459 Bacteria 18773
41 Ga0070706_100001640 3300005467 Bacteria 23302
42 Ga0070706_100007511 3300005467 Bacteria 10218
43 Ga0070707_100006661 3300005468 Bacteria 10701
44 Ga0070707_100032149 3300005468 Bacteria 4998
45 Ga0070707_100064733 3300005468 Bacteria 3511
46 Ga0070698_100001127 3300005471 Bacteria 29533
47 Ga0070698_100005177 3300005471 Bacteria 14261
48 Ga0070698_100009333 3300005471 Bacteria 10521
49 Ga0070698_100011068 3300005471 Bacteria 9585
50 Ga0070699_100001183 3300005518 Bacteria 24159
51 Ga0070699_100006840 3300005518 Bacteria 9925
52 Ga0070699_100042930 3300005518 Bacteria 3914
53 Ga0070699_100078123 3300005518 Bacteria 2882
54 Ga0070679_100037285 3300005530 Bacteria 4828
55 Ga0070684_100000706 3300005535 Bacteria 23068
56 Ga0070697_100000208 3300005536 Bacteria 48156
57 Ga0070697_100004240 3300005536 Bacteria 10985
58 Ga0070697_100004353 3300005536 Bacteria 10861
59 Ga0070697_100011182 3300005536 Bacteria 7014
60 Ga0070697_100011602 3300005536 Bacteria 6886
61 Ga0070697_100059857 3300005536 Bacteria 3103
62 Ga0068853_100000656 3300005539 Bacteria 23758
63 Ga0068853_100052976 3300005539 Bacteria 3494
64 Ga0070686_100004422 3300005544 Bacteria 7756
65 Ga0070665_100000024 3300005548 Bacteria 374559
66 Ga0070665_100012368 3300005548 Bacteria 8600
67 Ga0070665_100037493 3300005548 Bacteria 4875
68 Ga0070665_100051893 3300005548 Bacteria 4113
69 Ga0068855_100001962 3300005563 Bacteria 25558
70 Ga0068855_100002483 3300005563 Bacteria 22740
71 Ga0068855_100003923 3300005563 Bacteria 18151
72 Ga0068855_100117050 3300005563 Bacteria 3054
73 Ga0068855_100128847 3300005563 Bacteria 2891
74 Ga0070664_100004044 3300005564 Bacteria 11780
75 Ga0068857_100002324 3300005577 Bacteria 15456
76 Ga0068854_100012992 3300005578 Bacteria 5457
77 Ga0068854_100026268 3300005578 Bacteria 4001
78 Ga0068856_100000241 3300005614 Bacteria 59474
79 Ga0068856_100000382 3300005614 Bacteria 48530
80 Ga0068856_100002267 3300005614 Bacteria 19847
81 Ga0068856_100003704 3300005614 Bacteria 15336
82 Ga0068856_100009954 3300005614 Bacteria 9232
83 Ga0068856_100035650 3300005614 Bacteria 4876
84 Ga0068856_100069313 3300005614 Bacteria 3487
85 Ga0070702_100016981 3300005615 Bacteria 3746
86 Ga0068852_100000361 3300005616 Bacteria 30684
87 Ga0068852_100035459 3300005616 Bacteria 4162
88 Ga0068852_100046974 3300005616 Bacteria 3681
89 Ga0068859_100001218 3300005617 Bacteria 26254
90 Ga0068864_100000506 3300005618 Bacteria 33582
91 Ga0068864_100107938 3300005618 Bacteria 2477
92 Ga0068866_10002202 3300005718 Bacteria 8112
93 Ga0068851_10001335 3300005834 Bacteria 10766
94 Ga0068863_100000182 3300005841 Bacteria 67022
95 Ga0068863_100000898 3300005841 Bacteria 29914
96 Ga0068863_100007234 3300005841 Bacteria 10880
97 Ga0068858_100021531 3300005842 Bacteria 6025
98 Ga0068860_100001223 3300005843 Bacteria 27966
99 Ga0068860_100001482 3300005843 Bacteria 25349
100 Ga0068862_100046011 3300005844 Bacteria 3724
101 Ga0081540_1009521 3300005983 Bacteria 6688
102 Ga0081539_10001024 3300005985 Bacteria 51459
103 Ga0081539_10007203 3300005985 Bacteria 10244
104 Ga0070717_10001525 3300006028 Bacteria 16044
105 Ga0070717_10001711 3300006028 Bacteria 15291
106 Ga0070717_10010782 3300006028 Bacteria 6917
107 Ga0070717_10011163 3300006028 Bacteria 6808
108 Ga0070717_10026871 3300006028 Bacteria 4596
109 Ga0070717_10039262 3300006028 Bacteria 3851
110 Ga0070717_10059163 3300006028 Bacteria 3170
111 Ga0070717_10098850 3300006028 Bacteria 2475
112 Ga0070716_100000009 3300006173 Bacteria 173295
113 Ga0070716_100000171 3300006173 Bacteria 25502
114 Ga0070716_100001269 3300006173 Bacteria 11126
115 Ga0070712_100007748 3300006175 Bacteria 6721
116 Ga0097621_100000055 3300006237 Bacteria 59474
117 Ga0097621_100001902 3300006237 Bacteria 14254
118 Ga0097621_100007707 3300006237 Bacteria 7718
119 Ga0097621_100028552 3300006237 Bacteria 4398
120 Ga0097621_100057552 3300006237 Bacteria 3179
121 Ga0068871_100000898 3300006358 Bacteria 19832
122 Ga0068871_100001374 3300006358 Bacteria 16292
123 Ga0068871_100006265 3300006358 Bacteria 8393
124 Ga0075434_100037571 3300006871 Bacteria 4795
125 Ga0075429_100018197 3300006880 Bacteria 6081
126 Ga0075436_100001265 3300006914 Bacteria 17164
127 Ga0097620_100001218 3300006931 Bacteria 26254
128 Ga0075435_100033728 3300007076 Bacteria 4050
129 Ga0099794_10002260 3300007265 Bacteria 7064
130 Ga0105250_10015048 3300009092 Bacteria 3170
131 Ga0105240_10004290 3300009093 Bacteria 21785
132 Ga0105240_10005280 3300009093 Bacteria 19287
133 Ga0105240_10010390 3300009093 Bacteria 13084
134 Ga0105240_10249166 3300009093 Bacteria 2055
135 Ga0105245_10002919 3300009098 Bacteria 15346
136 Ga0105245_10009846 3300009098 Bacteria 8327
137 Ga0105245_10065761 3300009098 Bacteria 3279
138 Ga0105243_10058370 3300009148 Bacteria 3075
139 Ga0105241_10000036 3300009174 Bacteria 115495
140 Ga0105241_10000356 3300009174 Bacteria 34723
141 Ga0105241_10001564 3300009174 Bacteria 17507
142 Ga0105241_10010035 3300009174 Bacteria 6954
143 Ga0105241_10027006 3300009174 Bacteria 4272
144 Ga0105241_10082084 3300009174 Bacteria 2526
145 Ga0105242_10017800 3300009176 Bacteria 5544
146 Ga0105248_10002319 3300009177 Bacteria 21100
147 Ga0105248_10015128 3300009177 Bacteria 8499
148 Ga0105248_10154922 3300009177 Bacteria 2586
149 Ga0105237_10004629 3300009545 Bacteria 15849
150 Ga0105237_10133068 3300009545 Bacteria 2481
151 Ga0105238_10000088 3300009551 Bacteria 103463
152 Ga0105239_10004026 3300010375 Bacteria 17797
153 Ga0105239_10009210 3300010375 Bacteria 11166
154 Ga0105239_10089261 3300010375 Bacteria 3399
155 Ga0105246_10001970 3300011119 Bacteria 12386
156 Ga0157373_10003297 3300013100 Bacteria 12195
157 Ga0157373_10009903 3300013100 Bacteria 7026
158 Ga0157373_10076899 3300013100 Bacteria 2355
159 Ga0157370_10014880 3300013104 Bacteria 7937
160 Ga0157370_10064942 3300013104 Bacteria 3454
161 Ga0157369_10008409 3300013105 Bacteria 11834
162 Ga0157369_10013357 3300013105 Bacteria 9290
163 Ga0157369_10013957 3300013105 Bacteria 9079
164 Ga0157369_10014181 3300013105 Bacteria 9004
165 Ga0157374_10000674 3300013296 Bacteria 30061
166 Ga0157374_10003523 3300013296 Bacteria 13165
167 Ga0157374_10081952 3300013296 Bacteria 3062
168 Ga0157378_10000072 3300013297 Bacteria 91281
169 Ga0157378_10001504 3300013297 Bacteria 21099
170 Ga0157378_10016884 3300013297 Bacteria 6398
171 Ga0157378_10027096 3300013297 Bacteria 5056
172 Ga0157378_10031245 3300013297 Bacteria 4703
173 Ga0157378_10062947 3300013297 Bacteria 3314
174 Ga0163162_10086012 3300013306 Bacteria 3221
175 Ga0157372_10000877 3300013307 Bacteria 32693
176 Ga0157372_10001066 3300013307 Bacteria 29985
177 Ga0157372_10012518 3300013307 Bacteria 9036
178 Ga0157372_10028726 3300013307 Bacteria 6071
179 Ga0157372_10040246 3300013307 Bacteria 5161
180 Ga0157372_10115055 3300013307 Bacteria 3083
181 Ga0157375_10039176 3300013308 Bacteria 4559
182 Ga0163163_10001028 3300014325 Bacteria 23642
183 Ga0163163_10010359 3300014325 Bacteria 8376
184 Ga0157379_10000305 3300014968 Bacteria 38880
185 Ga0157379_10010359 3300014968 Bacteria 8123
186 Ga0157379_10036864 3300014968 Bacteria 4360
187 Ga0157376_10000014 3300014969 Bacteria 303001
188 Ga0157376_10004853 3300014969 Bacteria 9374
189 Ga0157376_10006248 3300014969 Bacteria 8398
190 Ga0157376_10006488 3300014969 Bacteria 8268
191 Ga0182007_10014693 3300015262 Bacteria 2942
192 Ga0163161_10029585 3300017792 Bacteria 3894
193 Ga0213873_10003542 3300021358 Bacteria 2819
194 Ga0213872_10002475 3300021361 Bacteria 10828
195 Ga0213872_10007332 3300021361 Bacteria 5442
196 Ga0224569_100001 3300022732 Bacteria 26447
197 Ga0228598_1000020 3300024227 Bacteria 22455
198 Ga0228598_1000466 3300024227 Bacteria 8245
199 Ga0209675_1001998 3300025291 Bacteria 10947
200 Ga0207656_10002035 3300025321 Bacteria 6751
201 Ga0207692_10000192 3300025898 Bacteria 20115
202 Ga0207642_10008381 3300025899 Bacteria 3542
203 Ga0207710_10002050 3300025900 Bacteria 9571
204 Ga0207680_10000044 3300025903 Bacteria 64236
205 Ga0207680_10021320 3300025903 Bacteria 3504
206 Ga0207680_10035246 3300025903 Bacteria 2871
207 Ga0207647_10003423 3300025904 Bacteria 11898
208 Ga0207699_10004975 3300025906 Bacteria 6355
209 Ga0207699_10049285 3300025906 Bacteria 2479
210 Ga0207645_10001672 3300025907 Bacteria 18045
211 Ga0207684_10007645 3300025910 Bacteria 9695
212 Ga0207684_10009404 3300025910 Bacteria 8630
213 Ga0207684_10036900 3300025910 Bacteria 4148
214 Ga0207684_10038051 3300025910 Bacteria 4083
215 Ga0207684_10053959 3300025910 Bacteria 3410
216 Ga0207654_10000052 3300025911 Bacteria 84058
217 Ga0207654_10001017 3300025911 Bacteria 15347
218 Ga0207654_10001505 3300025911 Bacteria 12289
219 Ga0207695_10000063 3300025913 Bacteria 349527
220 Ga0207695_10000538 3300025913 Bacteria 79042
221 Ga0207695_10002072 3300025913 Bacteria 30560
222 Ga0207695_10015533 3300025913 Bacteria 8956
223 Ga0207671_10001289 3300025914 Bacteria 29494
224 Ga0207671_10001318 3300025914 Bacteria 29039
225 Ga0207693_10032614 3300025915 Bacteria 4110
226 Ga0207663_10002713 3300025916 Bacteria 8529
227 Ga0207663_10012901 3300025916 Bacteria 4531
228 Ga0207662_10000873 3300025918 Bacteria 13921
229 Ga0207649_10000899 3300025920 Bacteria 18766
230 Ga0207649_10002426 3300025920 Bacteria 10438
231 Ga0207646_10000415 3300025922 Bacteria 57158
232 Ga0207646_10002244 3300025922 Bacteria 23007
233 Ga0207646_10029308 3300025922 Bacteria 5004
234 Ga0207646_10032203 3300025922 Bacteria 4745
235 Ga0207694_10000028 3300025924 Bacteria 242395
236 Ga0207694_10000513 3300025924 Bacteria 35098
237 Ga0207650_10000058 3300025925 Bacteria 153056
238 Ga0207650_10020580 3300025925 Bacteria 4655
239 Ga0207659_10000859 3300025926 Bacteria 18034
240 Ga0207700_10001574 3300025928 Bacteria 12949
241 Ga0207700_10019110 3300025928 Bacteria 4622
242 Ga0207700_10035710 3300025928 Bacteria 3583
243 Ga0207700_10045813 3300025928 Bacteria 3230
244 Ga0207700_10084612 3300025928 Bacteria 2487
245 Ga0207664_10011412 3300025929 Bacteria 6314
246 Ga0207664_10025988 3300025929 Bacteria 4419
247 Ga0207644_10021000 3300025931 Bacteria 4446
248 Ga0207690_10044512 3300025932 Bacteria 2926
249 Ga0207706_10001905 3300025933 Bacteria 20495
250 Ga0207709_10061587 3300025935 Bacteria 2345
251 Ga0207670_10004380 3300025936 Bacteria 7593
252 Ga0207669_10025192 3300025937 Bacteria 3211
253 Ga0207704_10008586 3300025938 Bacteria 4893
254 Ga0207665_10000001 3300025939 Bacteria 279842
255 Ga0207665_10000039 3300025939 Bacteria 85276
256 Ga0207665_10000309 3300025939 Bacteria 33802
257 Ga0207665_10022779 3300025939 Bacteria 4123
258 Ga0207665_10066363 3300025939 Bacteria 2456
259 Ga0207691_10001717 3300025940 Bacteria 21573
260 Ga0207711_10001067 3300025941 Bacteria 26234
261 Ga0207711_10007191 3300025941 Bacteria 9330
262 Ga0207711_10023134 3300025941 Bacteria 5202
263 Ga0207689_10081829 3300025942 Bacteria 2654
264 Ga0207679_10000141 3300025945 Bacteria 59703
265 Ga0207667_10001808 3300025949 Bacteria 26932
266 Ga0207667_10005791 3300025949 Bacteria 15077
267 Ga0207667_10089487 3300025949 Bacteria 3182
268 Ga0207667_10119254 3300025949 Bacteria 2719
269 Ga0207667_10130987 3300025949 Bacteria 2583
270 Ga0207651_10031970 3300025960 Bacteria 3372
271 Ga0207668_10000141 3300025972 Bacteria 49147
272 Ga0207640_10086021 3300025981 Bacteria 2163
273 Ga0207658_10000163 3300025986 Bacteria 70810
274 Ga0207658_10000526 3300025986 Bacteria 34963
275 Ga0207658_10010633 3300025986 Bacteria 6255
276 Ga0207658_10014728 3300025986 Bacteria 5359
277 Ga0207677_10000076 3300026023 Bacteria 81764
278 Ga0207677_10018318 3300026023 Bacteria 4199
279 Ga0207639_10000043 3300026041 Bacteria 140295
280 Ga0207678_10000143 3300026067 Bacteria 58580
281 Ga0207678_10054733 3300026067 Bacteria 3436
282 Ga0207702_10000152 3300026078 Bacteria 81294
283 Ga0207702_10000834 3300026078 Bacteria 32311
284 Ga0207702_10000880 3300026078 Bacteria 31244
285 Ga0207702_10003040 3300026078 Bacteria 15590
286 Ga0207702_10006030 3300026078 Bacteria 10518
287 Ga0207641_10000102 3300026088 Bacteria 122366
288 Ga0207641_10001695 3300026088 Bacteria 21432
289 Ga0207641_10005273 3300026088 Bacteria 11040
290 Ga0207641_10012129 3300026088 Bacteria 7072
291 Ga0207641_10018780 3300026088 Bacteria 5669
292 Ga0207641_10061604 3300026088 Bacteria 3200
293 Ga0207648_10000388 3300026089 Bacteria 48734
294 Ga0207676_10000242 3300026095 Bacteria 47504
295 Ga0207676_10010954 3300026095 Bacteria 6472
296 Ga0207674_10001643 3300026116 Bacteria 28768
297 Ga0207683_10000687 3300026121 Bacteria 31074
298 Ga0207698_10000046 3300026142 Bacteria 93146
299 Ga0209588_1000637 3300027671 Bacteria 8853
300 Ga0209588_1002340 3300027671 Bacteria 5136
301 Ga0268266_10000019 3300028379 Bacteria 556465
302 Ga0268266_10005371 3300028379 Bacteria 11973
303 Ga0268266_10010876 3300028379 Bacteria 7926
304 Ga0268266_10037535 3300028379 Bacteria 4126
305 Ga0268265_10026475 3300028380 Bacteria 4127
306 Ga0268265_10057009 3300028380 Bacteria 2975
307 Ga0268264_10001026 3300028381 Bacteria 28064
308 Ga0268264_10005784 3300028381 Bacteria 10484
309 Ga0265319_1000243 3300028563 Bacteria 40938
310 Ga0265318_10000198 3300028577 Bacteria 52281
311 Ga0265338_10001153 3300028800 Bacteria 43711
312 Ga0265338_10013219 3300028800 Bacteria 9342
313 Ga0265338_10027535 3300028800 Bacteria 5700
314 Ga0265338_10033682 3300028800 Bacteria 4965
315 Ga0265338_10036142 3300028800 Bacteria 4734
316 Ga0265762_1000553 3300030760 Bacteria 6546
317 Ga0265762_1001187 3300030760 Bacteria 4724
318 Ga0265760_10000739 3300031090 Bacteria 9335
319 Ga0265760_10002732 3300031090 Bacteria 5165
320 Ga0265760_10003062 3300031090 Bacteria 4882
321 Ga0265330_10000369 3300031235 Bacteria 31708
322 Ga0265330_10005992 3300031235 Bacteria 6018
323 Ga0265330_10010598 3300031235 Bacteria 4340
324 Ga0265328_10006673 3300031239 Bacteria 4860
325 Ga0265320_10001269 3300031240 Bacteria 18468
326 Ga0265325_10000123 3300031241 Bacteria 53074
327 Ga0265325_10005843 3300031241 Bacteria 7539
328 Ga0265325_10006468 3300031241 Bacteria 7104
329 Ga0265325_10023536 3300031241 Bacteria 3361
330 Ga0265325_10044646 3300031241 Bacteria 2307
331 Ga0265329_10001276 3300031242 Bacteria 12285
332 Ga0265340_10002857 3300031247 Bacteria 9831
333 Ga0265340_10006216 3300031247 Bacteria 6582
334 Ga0265340_10008247 3300031247 Bacteria 5629
335 Ga0265340_10015123 3300031247 Bacteria 4015
336 Ga0265339_10000041 3300031249 Bacteria 119820
337 Ga0265339_10002921 3300031249 Bacteria 12090
338 Ga0265339_10007961 3300031249 Bacteria 6796
339 Ga0265339_10015971 3300031249 Bacteria 4487
340 Ga0265331_10000403 3300031250 Bacteria 44394
341 Ga0265331_10000455 3300031250 Bacteria 39585
342 Ga0265331_10007479 3300031250 Bacteria 6314
343 Ga0265331_10008479 3300031250 Bacteria 5844
344 Ga0265316_10002553 3300031344 Bacteria 18817
345 Ga0265316_10003681 3300031344 Bacteria 15446
346 Ga0265316_10003715 3300031344 Bacteria 15361
347 Ga0265316_10004429 3300031344 Bacteria 13997
348 Ga0265316_10028057 3300031344 Bacteria 4648
349 Ga0265316_10031064 3300031344 Bacteria 4371
350 Ga0265316_10041549 3300031344 Bacteria 3679
351 Ga0265316_10067562 3300031344 Bacteria 2764
352 Ga0307513_10006554 3300031456 Bacteria 15205
353 Ga0265313_10004552 3300031595 Bacteria 10574
354 Ga0265313_10010620 3300031595 Bacteria 5799
355 Ga0265314_10000564 3300031711 Bacteria 47150
356 Ga0265314_10001387 3300031711 Bacteria 27158
357 Ga0265314_10043889 3300031711 Bacteria 3173
358 Ga0265342_10000346 3300031712 Bacteria 52003
359 Ga0265342_10001067 3300031712 Bacteria 26609
360 Ga0265342_10001635 3300031712 Bacteria 20659
361 Ga0265342_10011617 3300031712 Bacteria 6011
362 Ga0265342_10012957 3300031712 Bacteria 5621
363 Ga0265342_10053900 3300031712 Bacteria 2392
364 Ga0373926_0000436 3300035083 Bacteria 10824
365 Ga0373926_0004645 3300035083 Bacteria 4510
366 Ga0373944_0013623 3300035089 Bacteria 2259
367 Ga0373923_0001368 3300035111 Bacteria 6945
368 Ga0373923_0001710 3300035111 Bacteria 6440
369 Ga0373936_0001427 3300035113 Bacteria 8692
370 Ga0373943_0001062 3300035170 Bacteria 12209
371 Ga0373955_0001580 3300035172 Bacteria 9738
372 Ga0373924_0018203 3300035410 Bacteria 2704
373 Ga0373935_0000209 3300035692 Bacteria 28196
374 Ga0373927_0000687 3300035695 Bacteria 25823
375 Ga0373927_0002059 3300035695 Bacteria 14841
376 Ga0373927_0002490 3300035695 Bacteria 13443
377 Ga0373933_0004419 3300035724 Bacteria 7718
378 Ga0373933_0016491 3300035724 Bacteria 4132
379 Ga0373933_0045053 3300035724 Bacteria 2615
380 Ga0373947_0002718 3300035725 Bacteria 10618
381 Ga0373937_0006560 3300036401 Bacteria 10052
382 Ga0373937_0008394 3300036401 Bacteria 8975
383 Ga0373937_0026913 3300036401 Bacteria 5198
384 Ga0373937_0028735 3300036401 Bacteria 5034
385 Ga0373925_0004050 3300037068 Bacteria 11133
386 Ga0373925_0004332 3300037068 Bacteria 10734
387 Ga0373925_0005709 3300037068 Bacteria 9251
388 Ga0395899_0000503 3300037312 Bacteria 43549
389 Ga0395899_0008485 3300037312 Bacteria 7917
390 Ga0395900_0000545 3300037418 Bacteria 52739
391 Ga0395900_0022964 3300037418 Bacteria 6383
392 Ga0395898_0000315 3300037466 Bacteria 111811
393 Ga0395898_0017876 3300037466 Bacteria 7233
394 Ga0395905_0000005 3300037471 Bacteria 557808
395 Ga0395905_0010596 3300037471 Bacteria 8950
396 Ga0395905_0085226 3300037471 Bacteria 2961
397 Ga0395901_0000242 3300038443 Bacteria 68210
398 Ga0395901_0023408 3300038443 Bacteria 6331
399 Ga0436361_0028357 3300039447 Bacteria 8837
400 Ga0436361_0128209 3300039447 Bacteria 3865
401 Ga0436361_0554053 3300039447 Bacteria 4093
402 Ga0436361_0602192 3300039447 Bacteria 22271
403 Ga0436363_0305738 3300039450 Bacteria 10027
404 Ga0436363_1714569 3300039450 Bacteria 3616
405 Ga0436362_0944545 3300039453 Bacteria 12506
406 Ga0451577_0001507 3300042876 Bacteria 30779
407 Ga0466969_0037157 3300044656 Bacteria 2458
408 Ga0466972_0006300 3300044658 Bacteria 5960
409 Ga0466965_0001122 3300044683 Bacteria 10468
410 Ga0451576_0000333 3300045051 Bacteria 114207
411 Ga0451576_0007115 3300045051 Bacteria 13513
412 Ga0451576_0025506 3300045051 Bacteria 6368
413 Ga0451576_0026250 3300045051 Bacteria 6266
414 Ga0495592_0019495 3300046454 Bacteria 5159
415 Ga0495603_0013668 3300046455 Bacteria 4913
416 Ga0495641_0014767 3300046461 Bacteria 4212
417 Ga0495651_0001391 3300046462 Bacteria 18750
418 Ga0495651_0009925 3300046462 Bacteria 7322
419 Ga0495653_0003892 3300046463 Bacteria 12068
420 Ga0495653_0006091 3300046463 Bacteria 9882
421 Ga0495580_0000421 3300046472 Bacteria 35130
422 Ga0495580_0004588 3300046472 Bacteria 11597
423 Ga0495580_0007434 3300046472 Bacteria 8806
424 Ga0495580_0016434 3300046472 Bacteria 5553
425 Ga0495580_0016484 3300046472 Bacteria 5543
426 Ga0495580_0023836 3300046472 Bacteria 4488
427 Ga0495580_0030303 3300046472 Bacteria 3918
428 Ga0495580_0034709 3300046472 Bacteria 3630
429 Ga0495582_0000458 3300046473 Bacteria 22294
430 Ga0495639_0025517 3300046475 Bacteria 2607
431 Ga0495664_0048052 3300046477 Bacteria 2533
432 Ga0495583_0000027 3300046506 Bacteria 256299
433 Ga0495608_0003890 3300046511 Bacteria 10734
434 Ga0495618_0001605 3300046514 Bacteria 15089
435 Ga0495618_0012799 3300046514 Bacteria 5099
436 Ga0495628_0021192 3300046516 Bacteria 5350
437 Ga0495628_0034045 3300046516 Bacteria 4101
438 Ga0495628_0034602 3300046516 Bacteria 4063
439 Ga0495630_0003809 3300046517 Bacteria 10524
440 Ga0495630_0005469 3300046517 Bacteria 8972
441 Ga0495630_0011445 3300046517 Bacteria 6425
442 Ga0495630_0016965 3300046517 Bacteria 5329
443 Ga0495666_0016200 3300046526 Bacteria 3712
444 Ga0495652_0001970 3300046529 Bacteria 21862
445 Ga0495665_0001245 3300046531 Bacteria 13582
446 Ga0495665_0006790 3300046531 Bacteria 6173
447 Ga0495586_0002781 3300046535 Bacteria 9456
448 Ga0495586_0039686 3300046535 Bacteria 2531
449 Ga0495587_0002165 3300046536 Bacteria 13150
450 Ga0495645_0014227 3300046543 Bacteria 5644
451 Ga0495645_0064295 3300046543 Bacteria 2655
452 Ga0495645_0073485 3300046543 Bacteria 2463
453 Ga0495645_0075123 3300046543 Bacteria 2432
454 Ga0495667_0000989 3300046559 Bacteria 18391
455 Ga0495667_0012131 3300046559 Bacteria 5840
456 Ga0495635_0028800 3300046663 Bacteria 3860
457 Ga0495635_0029370 3300046663 Bacteria 3823
458 Ga0495635_0054643 3300046663 Bacteria 2751
459 Ga0495657_0004661 3300046675 Bacteria 10936
460 Ga0495599_0004864 3300046678 Bacteria 7992
461 Ga0495646_0000426 3300046680 Bacteria 22331
462 Ga0495624_0013521 3300046690 Bacteria 5564
463 Ga0495600_0001896 3300046809 Bacteria 11741
464 Ga0495581_0006715 3300047315 Bacteria 6672
465 Ga0495604_0003114 3300047317 Bacteria 13257
466 Ga0495604_0006914 3300047317 Bacteria 8992
467 Ga0495604_0022516 3300047317 Bacteria 5031
468 Ga0495674_0050097 3300047319 Bacteria 3686
469 Ga0495674_0056704 3300047319 Bacteria 3430
470 Ga0495674_0064253 3300047319 Bacteria 3191
471 Ga0495674_0087297 3300047319 Bacteria 2670
472 Ga0495672_0001806 3300047320 Bacteria 20509
473 Ga0495676_0064900 3300047321 Bacteria 2837
474 Ga0495680_0001356 3300047322 Bacteria 26600
475 Ga0495680_0003103 3300047322 Bacteria 16552
476 Ga0495675_0000038 3300047444 Bacteria 91107
477 Ga0495675_0002235 3300047444 Bacteria 11559
478 Ga0495675_0011901 3300047444 Bacteria 5468
479 Ga0495675_0072524 3300047444 Bacteria 2172
480 Ga0495684_0001645 3300047471 Bacteria 17943
481 Ga0495684_0003016 3300047471 Bacteria 13257
482 Ga0495684_0005618 3300047471 Bacteria 9775
483 Ga0495593_0021786 3300047673 Bacteria 3576
484 Ga0495602_0038045 3300048088 Bacteria 4455
485 Ga0495614_0008984 3300048089 Bacteria 4435
486 Ga0496101_0035715 3300048904 Bacteria 3517
487 Ga0496102_0080319 3300048905 Bacteria 3004
488 Ga0496104_0069821 3300048907 Bacteria 3339
489 Ga0496105_0000676 3300048908 Bacteria 22926
490 Ga0496105_0027375 3300048908 Bacteria 4657
491 Ga0496106_0000054 3300048909 Bacteria 93869
492 Ga0496107_0097269 3300048910 Bacteria 2155
493 Ga0496108_0000813 3300048911 Bacteria 24249
494 Ga0496109_0000177 3300048912 Bacteria 63414
495 Ga0496110_0014401 3300048913 Bacteria 6565
496 Ga0496110_0054205 3300048913 Bacteria 3527
497 Ga0496111_0002828 3300048914 Bacteria 10584
498 Ga0496112_0002570 3300048915 Bacteria 14665
499 Ga0496112_0026198 3300048915 Bacteria 5608
500 Ga0496112_0064802 3300048915 Bacteria 3606
501 Ga0496113_0000250 3300048916 Bacteria 25446
502 Ga0496114_0000006 3300048917 Bacteria 472921
503 Ga0496114_0015955 3300048917 Bacteria 6045
504 Ga0496115_0039705 3300048918 Bacteria 3739
505 Ga0496115_0050926 3300048918 Bacteria 3320
506 Ga0496118_0009338 3300048921 Bacteria 9937
507 Ga0496118_0028322 3300048921 Bacteria 4721
508 Ga0496121_0005696 3300048924 Bacteria 15838
509 Ga0496123_0007874 3300048926 Bacteria 9905
510 Ga0496124_0007439 3300048927 Bacteria 11634
511 Ga0496126_0000850 3300048929 Bacteria 53951
512 Ga0496126_0003557 3300048929 Bacteria 19573
513 Ga0501031_0008913 3300049568 Bacteria 6522
514 Ga0501036_0001713 3300049572 Bacteria 17044
515 Ga0501040_0001126 3300049576 Bacteria 16935
516 Ga0501040_0002850 3300049576 Bacteria 11163
517 Ga0501041_0005367 3300049577 Bacteria 7508
518 Ga0501041_0009370 3300049577 Bacteria 5770
519 Ga0501041_0039428 3300049577 Bacteria 2867
520 Ga0501042_0000521 3300049578 Bacteria 20048
521 Ga0501042_0003103 3300049578 Bacteria 10339
522 Ga0501046_0004130 3300049580 Bacteria 13232
523 Ga0501071_0000569 3300049587 Bacteria 19100
524 Ga0501071_0002730 3300049587 Bacteria 10819
525 Ga0501072_0000689 3300049588 Bacteria 24469
526 Ga0501072_0004213 3300049588 Bacteria 10911
527 Ga0501072_0021438 3300049588 Bacteria 5010
528 Ga0501074_0006035 3300049590 Bacteria 8742
529 Ga0501075_0000709 3300049591 Bacteria 20630
530 Ga0501076_0000716 3300049592 Bacteria 21417
531 Ga0501076_0002992 3300049592 Bacteria 11739
532 Ga0501077_0000768 3300049593 Bacteria 19362
533 Ga0501079_0002138 3300049741 Bacteria 14212
534 Ga0501079_0004196 3300049741 Bacteria 10681
535 Ga0501080_0002348 3300049742 Bacteria 16519
536 Ga0501081_0001963 3300049743 Bacteria 12797
537 Ga0501081_0002879 3300049743 Bacteria 10926
538 Ga0501083_0019225 3300049744 Bacteria 4758
539 Ga0501035_0042430 3300049822 Bacteria 4103
540 Ga0501044_0050215 3300049823 Bacteria 4305
541 Ga0501045_0000582 3300049824 Bacteria 22920
542 Ga0501045_0060533 3300049824 Bacteria 2776
543 nmdc:mga09592_7123_c1 3300050508 Bacteria 9092
544 nmdc:mga0n895_6912_c1 3300050512 Bacteria 9695
545 nmdc:mga0n895_6964_c1 3300050512 Bacteria 9651
546 nmdc:mga0rr50_26640_c1 3300050513 Bacteria 3337
547 nmdc:mga0rr50_49221_c1 3300050513 Bacteria 3119
548 nmdc:mga08x19_1360_c1 3300050514 Bacteria 15164
549 nmdc:mga08x19_18570_c1 3300050514 Bacteria 4261
550 Ga0495601_0007080 3300053077 Bacteria 6571
551 Ga0495601_0014426 3300053077 Bacteria 4762
552 Ga0495612_0006187 3300053078 Bacteria 4927
553 Ga0495595_0008086 3300053084 Bacteria 4312
554 Ga0500643_000232 3300053087 Bacteria 51502
555 Ga0500651_0002216 3300053093 Bacteria 10188
556 Ga0500555_001028 3300053103 Bacteria 9426
557 Ga0500592_000029 3300053116 Bacteria 48246
558 Ga0500655_000030 3300053133 Bacteria 39615
559 Ga0500590_009282 3300053148 Bacteria 4945
560 Ga0500627_0000478 3300053158 Bacteria 10842
561 Ga0501084_0000707 3300054114 Bacteria 25538
562 Ga0501084_0009537 3300054114 Bacteria 8034
563 Ga0501084_0019449 3300054114 Bacteria 5658
564 Ga0501084_0025193 3300054114 Bacteria 4962
565 Ga0501084_0084179 3300054114 Bacteria 2670
566 Ga0501082_0002040 3300060353 Bacteria 17753
567 Ga0501082_0074384 3300060353 Bacteria 2926
568 Ga0530510_0002872 3300061734 Bacteria 11839
569 Ga0530510_0003931 3300061734 Bacteria 10251
570 Ga0530510_0050215 3300061734 Bacteria 3013

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0001122 Ga0466965_0001122_8038_10029 501
2 3300044658 Ga0466972_0006300 Ga0466972_0006300_838_2829 504
3 3300039447 Ga0436361_0128209 Ga0436361_0128209_1980_3809 523
4 3300025928 Ga0207700_10035710 Ga0207700_100357102 524
5 3300049578 Ga0501042_0003103 Ga0501042_0003103_686_2653 540
6 3300046663 Ga0495635_0028800 Ga0495635_0028800_817_2883 544
7 3300060353 Ga0501082_0074384 Ga0501082_0074384_32_1954 546
8 3300013296 Ga0157374_10003523 Ga0157374_100035239 553
9 3300005616 Ga0068852_100035459 Ga0068852_1000354592 554
10 3300013297 Ga0157378_10062947 Ga0157378_100629473 554
11 3300005618 Ga0068864_100107938 Ga0068864_1001079381 563
12 3300005841 Ga0068863_100000182 Ga0068863_10000018242 563
13 3300025903 Ga0207680_10000044 Ga0207680_1000004423 563
14 3300025972 Ga0207668_10000141 Ga0207668_1000014147 563
15 3300025986 Ga0207658_10000526 Ga0207658_1000052613 563
16 3300026088 Ga0207641_10000102 Ga0207641_1000010229 563
17 3300048908 Ga0496105_0027375 Ga0496105_0027375_22_1968 563
18 3300025910 Ga0207684_10038051 Ga0207684_100380512 565
19 3300009093 Ga0105240_10249166 Ga0105240_102491661 567
20 3300031456 Ga0307513_10006554 Ga0307513_100065543 568
21 3300039447 Ga0436361_0028357 Ga0436361_0028357_4205_6151 569
22 3300047319 Ga0495674_0056704 Ga0495674_0056704_15_1946 569
23 3300049576 Ga0501040_0002850 Ga0501040_0002850_3330_5348 569
24 3300049577 Ga0501041_0009370 Ga0501041_0009370_3547_5565 569
25 3300049577 Ga0501041_0039428 Ga0501041_0039428_44_2059 569
26 3300049587 Ga0501071_0002730 Ga0501071_0002730_3361_5379 569
27 3300049588 Ga0501072_0004213 Ga0501072_0004213_3402_5420 569
28 3300049592 Ga0501076_0002992 Ga0501076_0002992_3402_5420 569
29 3300049741 Ga0501079_0004196 Ga0501079_0004196_2344_4362 569
30 3300049743 Ga0501081_0002879 Ga0501081_0002879_3489_5507 569
31 3300054114 Ga0501084_0009537 Ga0501084_0009537_3378_5396 569
32 3300054114 Ga0501084_0025193 Ga0501084_0025193_828_2843 569
33 3300061734 Ga0530510_0002872 Ga0530510_0002872_6438_8456 569
34 3300049568 Ga0501031_0008913 Ga0501031_0008913_1959_3977 570
35 3300049572 Ga0501036_0001713 Ga0501036_0001713_7384_9402 570
36 3300049576 Ga0501040_0001126 Ga0501040_0001126_8181_10199 570
37 3300049577 Ga0501041_0005367 Ga0501041_0005367_5315_7333 570
38 3300049578 Ga0501042_0000521 Ga0501042_0000521_8615_10633 570
39 3300049580 Ga0501046_0004130 Ga0501046_0004130_2868_4886 570
40 3300049587 Ga0501071_0000569 Ga0501071_0000569_7834_9852 570
41 3300049588 Ga0501072_0000689 Ga0501072_0000689_13812_15830 570
42 3300049590 Ga0501074_0006035 Ga0501074_0006035_6669_8687 570
43 3300049591 Ga0501075_0000709 Ga0501075_0000709_9747_11765 570
44 3300049592 Ga0501076_0000716 Ga0501076_0000716_10760_12778 570
45 3300049593 Ga0501077_0000768 Ga0501077_0000768_7578_9596 570
46 3300049741 Ga0501079_0002138 Ga0501079_0002138_3555_5573 570
47 3300049742 Ga0501080_0002348 Ga0501080_0002348_8407_10425 570
48 3300049743 Ga0501081_0001963 Ga0501081_0001963_7787_9805 570
49 3300049744 Ga0501083_0019225 Ga0501083_0019225_2094_4112 570
50 3300049822 Ga0501035_0042430 Ga0501035_0042430_386_2404 570
51 3300049824 Ga0501045_0000582 Ga0501045_0000582_7677_9695 570
52 3300054114 Ga0501084_0000707 Ga0501084_0000707_8640_10658 570
53 3300060353 Ga0501082_0002040 Ga0501082_0002040_7096_9114 570
54 3300061734 Ga0530510_0003931 Ga0530510_0003931_5028_7046 570
55 3300005435 Ga0070714_100019566 Ga0070714_1000195662 571
56 3300005436 Ga0070713_100044937 Ga0070713_1000449373 571
57 3300006028 Ga0070717_10010782 Ga0070717_100107826 571
58 3300025928 Ga0207700_10001574 Ga0207700_100015749 571
59 3300048907 Ga0496104_0069821 Ga0496104_0069821_1393_3324 571
60 3300031241 Ga0265325_10005843 Ga0265325_100058436 573
61 3300045051 Ga0451576_0000333 Ga0451576_0000333_74958_77006 573
62 3300005335 Ga0070666_10000667 Ga0070666_100006675 574
63 3300005347 Ga0070668_100000213 Ga0070668_1000002132 574
64 3300005367 Ga0070667_100000914 Ga0070667_1000009145 574
65 3300005437 Ga0070710_10000042 Ga0070710_1000004218 574
66 3300025898 Ga0207692_10000192 Ga0207692_100001927 574
67 3300053116 Ga0500592_000029 Ga0500592_000029_43669_45654 574
68 3300053158 Ga0500627_0000478 Ga0500627_0000478_6215_8200 574
69 3300005455 Ga0070663_100027398 Ga0070663_1000273982 576
70 3300005548 Ga0070665_100051893 Ga0070665_1000518933 576
71 3300006237 Ga0097621_100028552 Ga0097621_1000285523 576
72 3300009093 Ga0105240_10004290 Ga0105240_100042908 576
73 3300009098 Ga0105245_10065761 Ga0105245_100657612 576
74 3300009174 Ga0105241_10027006 Ga0105241_100270062 576
75 3300009177 Ga0105248_10015128 Ga0105248_100151284 576
76 3300010375 Ga0105239_10009210 Ga0105239_100092108 576
77 3300014969 Ga0157376_10006488 Ga0157376_100064886 576
78 3300025913 Ga0207695_10000063 Ga0207695_10000063180 576
79 3300025924 Ga0207694_10000513 Ga0207694_100005134 576
80 3300025941 Ga0207711_10023134 Ga0207711_100231342 576
81 3300026067 Ga0207678_10054733 Ga0207678_100547332 576
82 3300028379 Ga0268266_10037535 Ga0268266_100375353 576
83 3300031344 Ga0265316_10003715 Ga0265316_100037153 576
84 3300005614 Ga0068856_100009954 Ga0068856_1000099547 577
85 3300009174 Ga0105241_10082084 Ga0105241_100820842 577
86 3300025949 Ga0207667_10130987 Ga0207667_101309871 577
87 3300005616 Ga0068852_100046974 Ga0068852_1000469742 578
88 3300013104 Ga0157370_10064942 Ga0157370_100649422 578
89 3300013308 Ga0157375_10039176 Ga0157375_100391763 578
90 3300048905 Ga0496102_0080319 Ga0496102_0080319_976_2991 578
91 3300048913 Ga0496110_0054205 Ga0496110_0054205_286_2331 578
92 3300048914 Ga0496111_0002828 Ga0496111_0002828_4916_6961 578
93 3300013297 Ga0157378_10016884 Ga0157378_100168842 579
94 3300053133 Ga0500655_000030 Ga0500655_000030_30861_32891 580
95 3300031249 Ga0265339_10000041 Ga0265339_10000041101 581
96 3300031712 Ga0265342_10001067 Ga0265342_100010673 581
97 3300048926 Ga0496123_0007874 Ga0496123_0007874_3384_5420 581
98 3300048927 Ga0496124_0007439 Ga0496124_0007439_264_2300 581
99 3300053093 Ga0500651_0002216 Ga0500651_0002216_6042_8072 581
100 3300053148 Ga0500590_009282 Ga0500590_009282_2347_4377 581
101 3300005367 Ga0070667_100004192 Ga0070667_1000041928 582
102 3300005548 Ga0070665_100012368 Ga0070665_1000123685 582
103 3300005843 Ga0068860_100001223 Ga0068860_1000012234 582
104 3300025986 Ga0207658_10010633 Ga0207658_100106333 582
105 3300028379 Ga0268266_10010876 Ga0268266_100108768 582
106 3300028381 Ga0268264_10001026 Ga0268264_1000102625 582
107 3300031344 Ga0265316_10041549 Ga0265316_100415492 582
108 3300031711 Ga0265314_10043889 Ga0265314_100438892 582
109 3300021361 Ga0213872_10002475 Ga0213872_100024759 583
110 3300037312 Ga0395899_0008485 Ga0395899_0008485_3452_5509 583
111 3300037418 Ga0395900_0022964 Ga0395900_0022964_2255_4312 583
112 3300037471 Ga0395905_0010596 Ga0395905_0010596_5140_7197 583
113 3300038443 Ga0395901_0023408 Ga0395901_0023408_3106_5163 583
114 3300039447 Ga0436361_0554053 Ga0436361_0554053_38_2101 583
115 3300048908 Ga0496105_0000676 Ga0496105_0000676_2434_4509 583
116 3300031235 Ga0265330_10010598 Ga0265330_100105982 584
117 3300031344 Ga0265316_10031064 Ga0265316_100310642 584
118 3300031712 Ga0265342_10053900 Ga0265342_100539002 584
119 3300045051 Ga0451576_0007115 Ga0451576_0007115_7831_9900 584
120 3300048904 Ga0496101_0035715 Ga0496101_0035715_589_2598 584
121 3300005985 Ga0081539_10001024 Ga0081539_1000102431 585
122 3300009174 Ga0105241_10000356 Ga0105241_100003568 585
123 3300013105 Ga0157369_10013957 Ga0157369_100139572 585
124 3300025911 Ga0207654_10001017 Ga0207654_100010178 585
125 3300045051 Ga0451576_0026250 Ga0451576_0026250_2039_4075 585
126 3300013100 Ga0157373_10003297 Ga0157373_100032971 586
127 3300014968 Ga0157379_10010359 Ga0157379_100103593 586
128 3300014969 Ga0157376_10004853 Ga0157376_100048536 586
129 3300046475 Ga0495639_0025517 Ga0495639_0025517_610_2559 586
130 3300046543 Ga0495645_0014227 Ga0495645_0014227_1149_3230 586
131 3300048913 Ga0496110_0014401 Ga0496110_0014401_1957_3894 586
132 3300009092 Ga0105250_10015048 Ga0105250_100150482 587
133 3300009093 Ga0105240_10005280 Ga0105240_1000528012 587
134 3300009098 Ga0105245_10002919 Ga0105245_100029198 587
135 3300013307 Ga0157372_10115055 Ga0157372_101150552 587
136 3300014325 Ga0163163_10010359 Ga0163163_100103593 587
137 3300048911 Ga0496108_0000813 Ga0496108_0000813_18039_19976 587
138 3300048912 Ga0496109_0000177 Ga0496109_0000177_31885_33822 587
139 3300048915 Ga0496112_0002570 Ga0496112_0002570_11525_13462 587
140 3300048916 Ga0496113_0000250 Ga0496113_0000250_11148_13085 587
141 3300048929 Ga0496126_0003557 Ga0496126_0003557_8052_10094 587
142 3300005548 Ga0070665_100000024 Ga0070665_1000000246 588
143 3300028379 Ga0268266_10000019 Ga0268266_10000019356 588
144 3300013307 Ga0157372_10040246 Ga0157372_100402462 589
145 3300014968 Ga0157379_10036864 Ga0157379_100368643 589
146 3300025939 Ga0207665_10022779 Ga0207665_100227792 589
147 3300031712 Ga0265342_10011617 Ga0265342_100116172 589
148 3300037471 Ga0395905_0085226 Ga0395905_0085226_243_2294 589
149 3300047471 Ga0495684_0001645 Ga0495684_0001645_12713_14758 589
150 3300005536 Ga0070697_100004240 Ga0070697_1000042405 590
151 3300005617 Ga0068859_100001218 Ga0068859_10000121820 590
152 3300006931 Ga0097620_100001218 Ga0097620_10000121820 590
153 3300025900 Ga0207710_10002050 Ga0207710_100020501 590
154 3300025913 Ga0207695_10015533 Ga0207695_100155337 590
155 3300028800 Ga0265338_10027535 Ga0265338_100275354 590
156 3300028800 Ga0265338_10033682 Ga0265338_100336824 590
157 3300031241 Ga0265325_10044646 Ga0265325_100446461 590
158 3300031247 Ga0265340_10015123 Ga0265340_100151233 590
159 3300031249 Ga0265339_10007961 Ga0265339_100079612 590
160 3300031249 Ga0265339_10015971 Ga0265339_100159712 590
161 3300031250 Ga0265331_10007479 Ga0265331_100074793 590
162 3300031344 Ga0265316_10028057 Ga0265316_100280573 590
163 3300031344 Ga0265316_10067562 Ga0265316_100675622 590
164 3300031711 Ga0265314_10000564 Ga0265314_1000056451 590
165 3300031712 Ga0265342_10012957 Ga0265342_100129574 590
166 3300037466 Ga0395898_0017876 Ga0395898_0017876_3271_5316 590
167 3300005436 Ga0070713_100014865 Ga0070713_1000148652 591
168 3300006028 Ga0070717_10011163 Ga0070717_100111633 591
169 3300025906 Ga0207699_10049285 Ga0207699_100492851 591
170 3300031235 Ga0265330_10005992 Ga0265330_100059925 591
171 3300031239 Ga0265328_10006673 Ga0265328_100066733 591
172 3300031241 Ga0265325_10006468 Ga0265325_100064686 591
173 3300031247 Ga0265340_10006216 Ga0265340_100062162 591
174 3300031247 Ga0265340_10008247 Ga0265340_100082472 591
175 3300031250 Ga0265331_10008479 Ga0265331_100084795 591
176 3300031344 Ga0265316_10004429 Ga0265316_100044294 591
177 3300048921 Ga0496118_0028322 Ga0496118_0028322_1263_3359 591
178 3300048929 Ga0496126_0000850 Ga0496126_0000850_10894_12990 591
179 3300049824 Ga0501045_0060533 Ga0501045_0060533_360_2390 591
180 3300021361 Ga0213872_10007332 Ga0213872_100073322 592
181 3300022732 Ga0224569_100001 Ga0224569_1000017 592
182 3300024227 Ga0228598_1000020 Ga0228598_10000206 592
183 3300026088 Ga0207641_10012129 Ga0207641_100121297 592
184 3300054114 Ga0501084_0019449 Ga0501084_0019449_1836_3866 592
185 3300005468 Ga0070707_100032149 Ga0070707_1000321492 593
186 3300005471 Ga0070698_100011068 Ga0070698_1000110686 593
187 3300025910 Ga0207684_10009404 Ga0207684_100094047 593
188 3300025922 Ga0207646_10029308 Ga0207646_100293082 593
189 3300035083 Ga0373926_0000436 Ga0373926_0000436_7275_9320 593
190 3300035089 Ga0373944_0013623 Ga0373944_0013623_92_2137 593
191 3300035111 Ga0373923_0001368 Ga0373923_0001368_4213_6258 593
192 3300035170 Ga0373943_0001062 Ga0373943_0001062_8817_10862 593
193 3300035695 Ga0373927_0002059 Ga0373927_0002059_5487_7532 593
194 3300035725 Ga0373947_0002718 Ga0373947_0002718_7287_9332 593
195 3300037068 Ga0373925_0004332 Ga0373925_0004332_7282_9327 593
196 3300046472 Ga0495580_0023836 Ga0495580_0023836_2116_4161 593
197 3300046517 Ga0495630_0016965 Ga0495630_0016965_2932_4977 593
198 iso_pu_bacteria 2848297114 2848297167 593
199 3300025938 Ga0207704_10008586 Ga0207704_100085863 594
200 3300048909 Ga0496106_0000054 Ga0496106_0000054_57687_59783 594
201 3300005354 Ga0070675_100009772 Ga0070675_1000097724 595
202 3300005434 Ga0070709_10036570 Ga0070709_100365702 595
203 3300005467 Ga0070706_100001640 Ga0070706_1000016402 595
204 3300005536 Ga0070697_100011182 Ga0070697_1000111824 595
205 3300025910 Ga0207684_10036900 Ga0207684_100369004 595
206 3300025918 Ga0207662_10000873 Ga0207662_100008737 595
207 3300025926 Ga0207659_10000859 Ga0207659_100008598 595
208 3300028563 Ga0265319_1000243 Ga0265319_100024329 595
209 3300028577 Ga0265318_10000198 Ga0265318_1000019824 595
210 3300031240 Ga0265320_10001269 Ga0265320_1000126911 595
211 3300031241 Ga0265325_10023536 Ga0265325_100235362 595
212 3300031242 Ga0265329_10001276 Ga0265329_100012768 595
213 3300031247 Ga0265340_10002857 Ga0265340_1000285710 595
214 3300031250 Ga0265331_10000403 Ga0265331_100004037 595
215 3300031250 Ga0265331_10000455 Ga0265331_1000045510 595
216 3300031344 Ga0265316_10002553 Ga0265316_100025536 595
217 3300031595 Ga0265313_10004552 Ga0265313_100045528 595
218 3300031712 Ga0265342_10000346 Ga0265342_1000034629 595
219 3300037312 Ga0395899_0000503 Ga0395899_0000503_12890_14926 595
220 3300037418 Ga0395900_0000545 Ga0395900_0000545_11547_13583 595
221 3300037466 Ga0395898_0000315 Ga0395898_0000315_12921_14957 595
222 3300037471 Ga0395905_0000005 Ga0395905_0000005_373695_375731 595
223 3300038443 Ga0395901_0000242 Ga0395901_0000242_10912_12948 595
224 3300005439 Ga0070711_100000334 Ga0070711_10000033411 596
225 3300025291 Ga0209675_1001998 Ga0209675_10019986 596
226 3300046462 Ga0495651_0001391 Ga0495651_0001391_8699_10744 596
227 3300046463 Ga0495653_0006091 Ga0495653_0006091_191_2233 596
228 3300046477 Ga0495664_0048052 Ga0495664_0048052_150_2192 596
229 3300046511 Ga0495608_0003890 Ga0495608_0003890_8244_10286 596
230 3300046514 Ga0495618_0012799 Ga0495618_0012799_592_2634 596
231 3300046516 Ga0495628_0021192 Ga0495628_0021192_1166_3208 596
232 3300046529 Ga0495652_0001970 Ga0495652_0001970_4519_6561 596
233 3300046536 Ga0495587_0002165 Ga0495587_0002165_7603_9645 596
234 3300046543 Ga0495645_0064295 Ga0495645_0064295_55_2097 596
235 3300046543 Ga0495645_0073485 Ga0495645_0073485_174_2219 596
236 3300046559 Ga0495667_0000989 Ga0495667_0000989_4306_6348 596
237 3300046663 Ga0495635_0054643 Ga0495635_0054643_517_2559 596
238 3300046675 Ga0495657_0004661 Ga0495657_0004661_2171_4213 596
239 3300046678 Ga0495599_0004864 Ga0495599_0004864_324_2366 596
240 3300046809 Ga0495600_0001896 Ga0495600_0001896_2014_4056 596
241 3300047317 Ga0495604_0003114 Ga0495604_0003114_9061_11103 596
242 3300047319 Ga0495674_0050097 Ga0495674_0050097_1692_3671 596
243 3300047319 Ga0495674_0087297 Ga0495674_0087297_514_2556 596
244 3300047322 Ga0495680_0001356 Ga0495680_0001356_4091_6136 596
245 3300047322 Ga0495680_0003103 Ga0495680_0003103_2683_4725 596
246 3300047444 Ga0495675_0000038 Ga0495675_0000038_75121_77163 596
247 3300047444 Ga0495675_0011901 Ga0495675_0011901_1449_3494 596
248 3300047471 Ga0495684_0003016 Ga0495684_0003016_2645_4687 596
249 3300005577 Ga0068857_100002324 Ga0068857_10000232411 597
250 3300025936 Ga0207670_10004380 Ga0207670_100043804 597
251 3300025940 Ga0207691_10001717 Ga0207691_100017176 597
252 3300025942 Ga0207689_10081829 Ga0207689_100818292 597
253 3300026116 Ga0207674_10001643 Ga0207674_1000164311 597
254 3300031090 Ga0265760_10003062 Ga0265760_100030621 597
255 3300035111 Ga0373923_0001710 Ga0373923_0001710_26_2101 597
256 3300035724 Ga0373933_0016491 Ga0373933_0016491_747_2864 597
257 3300035724 Ga0373933_0045053 Ga0373933_0045053_428_2503 597
258 3300036401 Ga0373937_0026913 Ga0373937_0026913_2063_4180 597
259 3300046454 Ga0495592_0019495 Ga0495592_0019495_2030_4147 597
260 3300046462 Ga0495651_0009925 Ga0495651_0009925_1925_4000 597
261 3300046463 Ga0495653_0003892 Ga0495653_0003892_7548_9623 597
262 3300046472 Ga0495580_0004588 Ga0495580_0004588_1626_3701 597
263 3300046516 Ga0495628_0034045 Ga0495628_0034045_466_2583 597
264 3300046517 Ga0495630_0005469 Ga0495630_0005469_5553_7598 597
265 3300046517 Ga0495630_0011445 Ga0495630_0011445_229_2304 597
266 3300046526 Ga0495666_0016200 Ga0495666_0016200_124_2199 597
267 3300046531 Ga0495665_0006790 Ga0495665_0006790_2101_4176 597
268 3300046535 Ga0495586_0002781 Ga0495586_0002781_3218_5293 597
269 3300046680 Ga0495646_0000426 Ga0495646_0000426_2583_4658 597
270 3300046690 Ga0495624_0013521 Ga0495624_0013521_1782_3857 597
271 3300047317 Ga0495604_0006914 Ga0495604_0006914_2011_4128 597
272 3300047444 Ga0495675_0002235 Ga0495675_0002235_7658_9733 597
273 3300047471 Ga0495684_0005618 Ga0495684_0005618_3998_6073 597
274 3300048089 Ga0495614_0008984 Ga0495614_0008984_548_2623 597
275 3300053078 Ga0495612_0006187 Ga0495612_0006187_2038_4113 597
276 3300053084 Ga0495595_0008086 Ga0495595_0008086_624_2741 597
277 3300053087 Ga0500643_000232 Ga0500643_000232_5269_7317 597
278 3300005539 Ga0068853_100000656 Ga0068853_10000065612 598
279 3300005563 Ga0068855_100002483 Ga0068855_1000024836 598
280 3300005578 Ga0068854_100012992 Ga0068854_1000129922 598
281 3300005614 Ga0068856_100000382 Ga0068856_10000038228 598
282 3300005616 Ga0068852_100000361 Ga0068852_1000003617 598
283 3300005983 Ga0081540_1009521 Ga0081540_10095212 598
284 3300009093 Ga0105240_10010390 Ga0105240_100103904 598
285 3300009174 Ga0105241_10000036 Ga0105241_1000003689 598
286 3300009545 Ga0105237_10004629 Ga0105237_100046298 598
287 3300009551 Ga0105238_10000088 Ga0105238_1000008896 598
288 3300010375 Ga0105239_10004026 Ga0105239_100040267 598
289 3300013100 Ga0157373_10076899 Ga0157373_100768991 598
290 3300013105 Ga0157369_10008409 Ga0157369_100084096 598
291 3300025911 Ga0207654_10000052 Ga0207654_1000005264 598
292 3300025913 Ga0207695_10002072 Ga0207695_1000207219 598
293 3300025914 Ga0207671_10001318 Ga0207671_1000131810 598
294 3300025920 Ga0207649_10002426 Ga0207649_100024267 598
295 3300025924 Ga0207694_10000028 Ga0207694_1000002819 598
296 3300025949 Ga0207667_10005791 Ga0207667_1000579110 598
297 3300026041 Ga0207639_10000043 Ga0207639_10000043109 598
298 3300026078 Ga0207702_10000834 Ga0207702_1000083418 598
299 3300026142 Ga0207698_10000046 Ga0207698_1000004671 598
300 3300037068 Ga0373925_0005709 Ga0373925_0005709_3892_5919 598
301 3300046516 Ga0495628_0034602 Ga0495628_0034602_1900_3945 598
302 3300047317 Ga0495604_0022516 Ga0495604_0022516_638_2683 598
303 3300047444 Ga0495675_0072524 Ga0495675_0072524_81_2126 598
304 3300005439 Ga0070711_100001289 Ga0070711_1000012892 599
305 3300005536 Ga0070697_100059857 Ga0070697_1000598572 599
306 3300009148 Ga0105243_10058370 Ga0105243_100583702 599
307 3300025935 Ga0207709_10061587 Ga0207709_100615872 599
308 3300028800 Ga0265338_10001153 Ga0265338_1000115331 599
309 3300031711 Ga0265314_10001387 Ga0265314_100013872 599
310 3300005331 Ga0070670_100000733 Ga0070670_10000073315 600
311 3300005338 Ga0068868_100029772 Ga0068868_1000297721 600
312 3300005367 Ga0070667_100000267 Ga0070667_10000026740 600
313 3300005614 Ga0068856_100003704 Ga0068856_1000037047 600
314 3300005618 Ga0068864_100000506 Ga0068864_10000050615 600
315 3300005841 Ga0068863_100000898 Ga0068863_10000089830 600
316 3300005841 Ga0068863_100007234 Ga0068863_1000072345 600
317 3300005843 Ga0068860_100001482 Ga0068860_1000014827 600
318 3300005844 Ga0068862_100046011 Ga0068862_1000460112 600
319 3300006028 Ga0070717_10001711 Ga0070717_100017117 600
320 3300006237 Ga0097621_100057552 Ga0097621_1000575522 600
321 3300009098 Ga0105245_10009846 Ga0105245_100098464 600
322 3300009174 Ga0105241_10010035 Ga0105241_100100356 600
323 3300009177 Ga0105248_10154922 Ga0105248_101549222 600
324 3300009545 Ga0105237_10133068 Ga0105237_101330681 600
325 3300010375 Ga0105239_10089261 Ga0105239_100892612 600
326 3300011119 Ga0105246_10001970 Ga0105246_100019704 600
327 3300013296 Ga0157374_10081952 Ga0157374_100819522 600
328 3300013297 Ga0157378_10031245 Ga0157378_100312454 600
329 3300013306 Ga0163162_10086012 Ga0163162_100860122 600
330 3300014325 Ga0163163_10001028 Ga0163163_100010288 600
331 3300014968 Ga0157379_10000305 Ga0157379_1000030518 600
332 3300025911 Ga0207654_10001505 Ga0207654_100015057 600
333 3300025913 Ga0207695_10000538 Ga0207695_1000053828 600
334 3300025914 Ga0207671_10001289 Ga0207671_100012895 600
335 3300025925 Ga0207650_10020580 Ga0207650_100205802 600
336 3300025986 Ga0207658_10000163 Ga0207658_1000016359 600
337 3300026023 Ga0207677_10000076 Ga0207677_1000007659 600
338 3300026078 Ga0207702_10006030 Ga0207702_100060304 600
339 3300026088 Ga0207641_10005273 Ga0207641_100052732 600
340 3300026088 Ga0207641_10018780 Ga0207641_100187802 600
341 3300026095 Ga0207676_10010954 Ga0207676_100109545 600
342 3300028380 Ga0268265_10026475 Ga0268265_100264752 600
343 3300031235 Ga0265330_10000369 Ga0265330_1000036914 600
344 3300031241 Ga0265325_10000123 Ga0265325_1000012312 600
345 3300031249 Ga0265339_10002921 Ga0265339_100029212 600
346 3300031344 Ga0265316_10003681 Ga0265316_100036816 600
347 3300031595 Ga0265313_10010620 Ga0265313_100106202 600
348 3300031712 Ga0265342_10001635 Ga0265342_100016357 600
349 3300049823 Ga0501044_0050215 Ga0501044_0050215_1329_3359 600
350 3300050512 nmdc:mga0n895_6964_c1 nmdc:mga0n895_6964_c1_4267_6339 600
351 3300005548 Ga0070665_100037493 Ga0070665_1000374935 601
352 3300028800 Ga0265338_10013219 Ga0265338_100132196 601
353 3300036401 Ga0373937_0028735 Ga0373937_0028735_985_3030 601
354 3300046472 Ga0495580_0016434 Ga0495580_0016434_1829_3853 601
355 3300046472 Ga0495580_0030303 Ga0495580_0030303_1515_3542 601
356 3300006173 Ga0070716_100001269 Ga0070716_1000012692 602
357 3300025939 Ga0207665_10000309 Ga0207665_1000030922 602
358 3300035113 Ga0373936_0001427 Ga0373936_0001427_3255_5300 602
359 3300035410 Ga0373924_0018203 Ga0373924_0018203_20_2065 602
360 3300035692 Ga0373935_0000209 Ga0373935_0000209_822_2867 602
361 3300035695 Ga0373927_0002490 Ga0373927_0002490_3364_5409 602
362 3300039450 Ga0436363_1714569 Ga0436363_1714569_306_2336 602
363 3300046531 Ga0495665_0001245 Ga0495665_0001245_6040_8085 602
364 3300046559 Ga0495667_0012131 Ga0495667_0012131_35_2080 602
365 3300046663 Ga0495635_0029370 Ga0495635_0029370_951_2996 602
366 3300047315 Ga0495581_0006715 Ga0495581_0006715_1370_3415 602
367 3300047319 Ga0495674_0064253 Ga0495674_0064253_821_2866 602
368 3300050514 nmdc:mga08x19_18570_c1 nmdc:mga08x19_18570_c1_101_2149 602
369 3300053077 Ga0495601_0007080 Ga0495601_0007080_1311_3347 602
370 3300013307 Ga0157372_10001066 Ga0157372_100010662 603
371 3300025928 Ga0207700_10084612 Ga0207700_100846121 603
372 3300042876 Ga0451577_0001507 Ga0451577_0001507_10524_12545 603
373 3300045051 Ga0451576_0025506 Ga0451576_0025506_1140_3251 603
374 3300039450 Ga0436363_0305738 Ga0436363_0305738_6178_8199 604
375 3300046461 Ga0495641_0014767 Ga0495641_0014767_528_2576 604
376 3300046472 Ga0495580_0016484 Ga0495580_0016484_3349_5397 604
377 3300046473 Ga0495582_0000458 Ga0495582_0000458_8108_10156 604
378 3300046543 Ga0495645_0075123 Ga0495645_0075123_16_2064 604
379 3300048918 Ga0496115_0050926 Ga0496115_0050926_222_2270 604
380 3300049588 Ga0501072_0021438 Ga0501072_0021438_707_2782 604
381 3300053077 Ga0495601_0014426 Ga0495601_0014426_746_2794 604
382 3300005367 Ga0070667_100051802 Ga0070667_1000518023 605
383 3300005436 Ga0070713_100024867 Ga0070713_1000248672 605
384 3300005468 Ga0070707_100064733 Ga0070707_1000647332 605
385 3300005471 Ga0070698_100001127 Ga0070698_10000112725 605
386 3300005518 Ga0070699_100006840 Ga0070699_1000068404 605
387 3300005518 Ga0070699_100078123 Ga0070699_1000781232 605
388 3300005536 Ga0070697_100011602 Ga0070697_1000116022 605
389 3300006175 Ga0070712_100007748 Ga0070712_1000077488 605
390 3300006237 Ga0097621_100001902 Ga0097621_1000019023 605
391 3300006358 Ga0068871_100006265 Ga0068871_1000062658 605
392 3300007265 Ga0099794_10002260 Ga0099794_100022604 605
393 3300014969 Ga0157376_10000014 Ga0157376_1000001447 605
394 3300025906 Ga0207699_10004975 Ga0207699_100049755 605
395 3300025916 Ga0207663_10002713 Ga0207663_100027133 605
396 3300025922 Ga0207646_10032203 Ga0207646_100322033 605
397 3300025928 Ga0207700_10019110 Ga0207700_100191102 605
398 3300025929 Ga0207664_10011412 Ga0207664_100114122 605
399 3300025986 Ga0207658_10014728 Ga0207658_100147282 605
400 3300027671 Ga0209588_1002340 Ga0209588_10023404 605
401 3300028380 Ga0268265_10057009 Ga0268265_100570092 605
402 3300028381 Ga0268264_10005784 Ga0268264_100057846 605
403 3300028800 Ga0265338_10036142 Ga0265338_100361422 605
404 3300035724 Ga0373933_0004419 Ga0373933_0004419_4420_6468 605
405 3300036401 Ga0373937_0008394 Ga0373937_0008394_4448_6496 605
406 3300048088 Ga0495602_0038045 Ga0495602_0038045_875_2923 605
407 3300048917 Ga0496114_0015955 Ga0496114_0015955_731_2779 605
408 3300048918 Ga0496115_0039705 Ga0496115_0039705_158_2206 605
409 3300050513 nmdc:mga0rr50_49221_c1 nmdc:mga0rr50_49221_c1_425_2521 605
410 3300005338 Ga0068868_100038498 Ga0068868_1000384983 606
411 3300005439 Ga0070711_100014418 Ga0070711_1000144184 606
412 3300005471 Ga0070698_100009333 Ga0070698_1000093332 606
413 3300005563 Ga0068855_100117050 Ga0068855_1001170502 606
414 3300005985 Ga0081539_10007203 Ga0081539_100072035 606
415 3300006028 Ga0070717_10039262 Ga0070717_100392622 606
416 3300006237 Ga0097621_100007707 Ga0097621_1000077074 606
417 3300006358 Ga0068871_100001374 Ga0068871_1000013745 606
418 3300006871 Ga0075434_100037571 Ga0075434_1000375712 606
419 3300007076 Ga0075435_100033728 Ga0075435_1000337282 606
420 3300009176 Ga0105242_10017800 Ga0105242_100178003 606
421 3300013104 Ga0157370_10014880 Ga0157370_100148803 606
422 3300013297 Ga0157378_10027096 Ga0157378_100270963 606
423 3300025903 Ga0207680_10021320 Ga0207680_100213202 606
424 3300025915 Ga0207693_10032614 Ga0207693_100326143 606
425 3300025916 Ga0207663_10012901 Ga0207663_100129013 606
426 3300025931 Ga0207644_10021000 Ga0207644_100210002 606
427 3300025949 Ga0207667_10089487 Ga0207667_100894872 606
428 3300026023 Ga0207677_10018318 Ga0207677_100183182 606
429 3300035083 Ga0373926_0004645 Ga0373926_0004645_2038_4095 606
430 3300035172 Ga0373955_0001580 Ga0373955_0001580_5624_7660 606
431 3300035695 Ga0373927_0000687 Ga0373927_0000687_3380_5437 606
432 3300036401 Ga0373937_0006560 Ga0373937_0006560_6941_8977 606
433 3300037068 Ga0373925_0004050 Ga0373925_0004050_7987_10044 606
434 3300044656 Ga0466969_0037157 Ga0466969_0037157_361_2397 606
435 3300046506 Ga0495583_0000027 Ga0495583_0000027_196412_198442 606
436 3300046517 Ga0495630_0003809 Ga0495630_0003809_5342_7399 606
437 3300047321 Ga0495676_0064900 Ga0495676_0064900_40_2097 606
438 3300048910 Ga0496107_0097269 Ga0496107_0097269_61_2097 606
439 3300048917 Ga0496114_0000006 Ga0496114_0000006_76563_78599 606
440 3300048921 Ga0496118_0009338 Ga0496118_0009338_4794_6800 606
441 3300048924 Ga0496121_0005696 Ga0496121_0005696_5988_7994 606
442 3300050512 nmdc:mga0n895_6912_c1 nmdc:mga0n895_6912_c1_3333_5363 606
443 3300050513 nmdc:mga0rr50_26640_c1 nmdc:mga0rr50_26640_c1_837_2867 606
444 3300053103 Ga0500555_001028 Ga0500555_001028_6741_8771 606
445 3300005467 Ga0070706_100007511 Ga0070706_1000075118 607
446 3300005468 Ga0070707_100006661 Ga0070707_1000066618 607
447 3300005471 Ga0070698_100005177 Ga0070698_1000051778 607
448 3300005518 Ga0070699_100001183 Ga0070699_10000118315 607
449 3300005536 Ga0070697_100004353 Ga0070697_1000043533 607
450 3300013297 Ga0157378_10001504 Ga0157378_1000150414 607
451 3300025910 Ga0207684_10007645 Ga0207684_100076452 607
452 3300025910 Ga0207684_10053959 Ga0207684_100539593 607
453 3300025922 Ga0207646_10000415 Ga0207646_100004155 607
454 3300025922 Ga0207646_10002244 Ga0207646_1000224415 607
455 3300027671 Ga0209588_1000637 Ga0209588_10006374 607
456 3300030760 Ga0265762_1000553 Ga0265762_10005536 607
457 3300039447 Ga0436361_0602192 Ga0436361_0602192_13102_15165 607
458 3300005445 Ga0070708_100001790 Ga0070708_10000179011 608
459 3300005518 Ga0070699_100042930 Ga0070699_1000429302 608
460 3300005614 Ga0068856_100002267 Ga0068856_1000022674 608
461 3300021358 Ga0213873_10003542 Ga0213873_100035422 608
462 3300026078 Ga0207702_10000880 Ga0207702_1000088010 608
463 3300039453 Ga0436362_0944545 Ga0436362_0944545_4394_6424 608
464 3300005330 Ga0070690_100015851 Ga0070690_1000158513 609
465 3300005343 Ga0070687_100000839 Ga0070687_1000008395 609
466 3300005455 Ga0070663_100001078 Ga0070663_1000010783 609
467 3300005459 Ga0068867_100001057 Ga0068867_10000105713 609
468 3300005530 Ga0070679_100037285 Ga0070679_1000372851 609
469 3300005536 Ga0070697_100000208 Ga0070697_1000002087 609
470 3300005544 Ga0070686_100004422 Ga0070686_1000044223 609
471 3300005563 Ga0068855_100001962 Ga0068855_10000196210 609
472 3300005563 Ga0068855_100003923 Ga0068855_1000039238 609
473 3300005563 Ga0068855_100128847 Ga0068855_1001288472 609
474 3300005614 Ga0068856_100000241 Ga0068856_10000024110 609
475 3300005614 Ga0068856_100035650 Ga0068856_1000356503 609
476 3300005614 Ga0068856_100069313 Ga0068856_1000693131 609
477 3300005718 Ga0068866_10002202 Ga0068866_100022026 609
478 3300005842 Ga0068858_100021531 Ga0068858_1000215314 609
479 3300006028 Ga0070717_10001525 Ga0070717_1000152512 609
480 3300006028 Ga0070717_10059163 Ga0070717_100591632 609
481 3300006237 Ga0097621_100000055 Ga0097621_10000005510 609
482 3300006358 Ga0068871_100000898 Ga0068871_1000008986 609
483 3300006880 Ga0075429_100018197 Ga0075429_1000181972 609
484 3300006914 Ga0075436_100001265 Ga0075436_10000126515 609
485 3300009174 Ga0105241_10001564 Ga0105241_100015646 609
486 3300009177 Ga0105248_10002319 Ga0105248_100023193 609
487 3300013105 Ga0157369_10014181 Ga0157369_100141817 609
488 3300013296 Ga0157374_10000674 Ga0157374_100006748 609
489 3300013297 Ga0157378_10000072 Ga0157378_100000729 609
490 3300013307 Ga0157372_10000877 Ga0157372_1000087721 609
491 3300013307 Ga0157372_10012518 Ga0157372_100125186 609
492 3300015262 Ga0182007_10014693 Ga0182007_100146932 609
493 3300024227 Ga0228598_1000466 Ga0228598_10004664 609
494 3300025899 Ga0207642_10008381 Ga0207642_100083812 609
495 3300025903 Ga0207680_10035246 Ga0207680_100352461 609
496 3300025928 Ga0207700_10045813 Ga0207700_100458132 609
497 3300025933 Ga0207706_10001905 Ga0207706_1000190514 609
498 3300025941 Ga0207711_10001067 Ga0207711_100010677 609
499 3300025941 Ga0207711_10007191 Ga0207711_100071912 609
500 3300025949 Ga0207667_10001808 Ga0207667_1000180811 609
501 3300025949 Ga0207667_10119254 Ga0207667_101192542 609
502 3300025981 Ga0207640_10086021 Ga0207640_100860212 609
503 3300026067 Ga0207678_10000143 Ga0207678_1000014326 609
504 3300026078 Ga0207702_10000152 Ga0207702_1000015265 609
505 3300026078 Ga0207702_10003040 Ga0207702_100030407 609
506 3300026088 Ga0207641_10061604 Ga0207641_100616043 609
507 3300026089 Ga0207648_10000388 Ga0207648_1000038831 609
508 3300028379 Ga0268266_10005371 Ga0268266_100053715 609
509 3300031090 Ga0265760_10002732 Ga0265760_100027323 609
510 3300046455 Ga0495603_0013668 Ga0495603_0013668_1188_3236 609
511 3300046472 Ga0495580_0000421 Ga0495580_0000421_13121_15217 609
512 3300046472 Ga0495580_0034709 Ga0495580_0034709_641_2689 609
513 3300046535 Ga0495586_0039686 Ga0495586_0039686_52_2100 609
514 3300047320 Ga0495672_0001806 Ga0495672_0001806_8369_10408 609
515 3300047673 Ga0495593_0021786 Ga0495593_0021786_860_2908 609
516 3300048915 Ga0496112_0026198 Ga0496112_0026198_24_2048 609
517 3300048915 Ga0496112_0064802 Ga0496112_0064802_1455_3482 609
518 3300050508 nmdc:mga09592_7123_c1 nmdc:mga09592_7123_c1_171_2240 609
519 3300050514 nmdc:mga08x19_1360_c1 nmdc:mga08x19_1360_c1_10831_12888 609
520 3300054114 Ga0501084_0084179 Ga0501084_0084179_430_2469 609
521 3300061734 Ga0530510_0050215 Ga0530510_0050215_665_2704 609
522 3300001991 JGI24743J22301_10000234 JGI24743J22301_100002344 610
523 3300005293 Ga0065715_10008447 Ga0065715_100084472 610
524 3300005328 Ga0070676_10002079 Ga0070676_100020796 610
525 3300005329 Ga0070683_100000388 Ga0070683_10000038813 610
526 3300005334 Ga0068869_100001749 Ga0068869_1000017493 610
527 3300005337 Ga0070682_100014018 Ga0070682_1000140183 610
528 3300005338 Ga0068868_100001390 Ga0068868_1000013907 610
529 3300005344 Ga0070661_100001681 Ga0070661_1000016812 610
530 3300005365 Ga0070688_100000493 Ga0070688_1000004935 610
531 3300005366 Ga0070659_100028963 Ga0070659_1000289632 610
532 3300005436 Ga0070713_100028764 Ga0070713_1000287643 610
533 3300005436 Ga0070713_100115143 Ga0070713_1001151432 610
534 3300005439 Ga0070711_100014425 Ga0070711_1000144255 610
535 3300005445 Ga0070708_100016018 Ga0070708_1000160186 610
536 3300005456 Ga0070678_100010083 Ga0070678_1000100833 610
537 3300005535 Ga0070684_100000706 Ga0070684_10000070611 610
538 3300005539 Ga0068853_100052976 Ga0068853_1000529763 610
539 3300005564 Ga0070664_100004044 Ga0070664_1000040443 610
540 3300005578 Ga0068854_100026268 Ga0068854_1000262682 610
541 3300005615 Ga0070702_100016981 Ga0070702_1000169813 610
542 3300005834 Ga0068851_10001335 Ga0068851_100013355 610
543 3300006028 Ga0070717_10026871 Ga0070717_100268714 610
544 3300006028 Ga0070717_10098850 Ga0070717_100988502 610
545 3300006173 Ga0070716_100000009 Ga0070716_10000000958 610
546 3300006173 Ga0070716_100000171 Ga0070716_10000017118 610
547 3300013100 Ga0157373_10009903 Ga0157373_100099034 610
548 3300013105 Ga0157369_10013357 Ga0157369_100133576 610
549 3300013307 Ga0157372_10028726 Ga0157372_100287265 610
550 3300014969 Ga0157376_10006248 Ga0157376_100062486 610
551 3300017792 Ga0163161_10029585 Ga0163161_100295852 610
552 3300025321 Ga0207656_10002035 Ga0207656_100020353 610
553 3300025904 Ga0207647_10003423 Ga0207647_100034233 610
554 3300025907 Ga0207645_10001672 Ga0207645_100016727 610
555 3300025920 Ga0207649_10000899 Ga0207649_100008998 610
556 3300025925 Ga0207650_10000058 Ga0207650_1000005812 610
557 3300025929 Ga0207664_10025988 Ga0207664_100259882 610
558 3300025932 Ga0207690_10044512 Ga0207690_100445122 610
559 3300025937 Ga0207669_10025192 Ga0207669_100251922 610
560 3300025939 Ga0207665_10000001 Ga0207665_1000000186 610
561 3300025939 Ga0207665_10000039 Ga0207665_1000003969 610
562 3300025939 Ga0207665_10066363 Ga0207665_100663631 610
563 3300025945 Ga0207679_10000141 Ga0207679_1000014126 610
564 3300025960 Ga0207651_10031970 Ga0207651_100319702 610
565 3300026088 Ga0207641_10001695 Ga0207641_100016956 610
566 3300026095 Ga0207676_10000242 Ga0207676_1000024227 610
567 3300026121 Ga0207683_10000687 Ga0207683_100006879 610
568 3300030760 Ga0265762_1001187 Ga0265762_10011874 610
569 3300031090 Ga0265760_10000739 Ga0265760_100007397 610
570 3300046472 Ga0495580_0007434 Ga0495580_0007434_4396_6426 610
571 3300046514 Ga0495618_0001605 Ga0495618_0001605_3343_5409 610
572 iso_pu_bacteria 2888373701 2888374552 610

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00122

E1-E2_ATPase

E1-E2 ATPase

137

317

0.93

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

530

589

0.89

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

334

563

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u7q-assembly1.cif.gz_A the solution structure of the nucleotide binding domain of kdpb 0.9309 260 395
1u7q-assembly1.cif.gz_A the solution structure of the nucleotide binding domain of kdpb 0.9244 260 395
2voy-assembly1.cif.gz_J cryoem model of copa, the copper transporting atpase from archaeoglobus fulgidus 0.8248 259 389
2voy-assembly1.cif.gz_J cryoem model of copa, the copper transporting atpase from archaeoglobus fulgidus 0.7999 259 389
2voy-assembly1.cif.gz_I cryoem model of copa, the copper transporting atpase from archaeoglobus fulgidus 0.7969 394 506
ID Description Score Start End Superfamily
af_P9WPU3_333_476_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.9517 260 393 3.40.1110.10
af_Q2FWI0_295_426_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.9306 260 392 3.40.1110.10
af_Q2FWI0_295_426_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.917 260 392 3.40.1110.10
af_P9WPU3_333_476_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.8812 260 393 3.40.1110.10
af_P9WPS3_469_590_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.8718 260 391 3.40.1110.10
ID Description Score Start End GO Terms
AF-X1K4Z3-F1-model_v4 CBS domain-containing protein 0.9075 259 475 GO:0005524
GO:0008556
GO:0016020
GO:0016887
AF-A0A6B3FGJ3-F1-model_v4 HAD family hydrolase 0.8861 256 424 GO:0005524
GO:0008556
GO:0016020
GO:0016787
AF-X1K4Z3-F1-model_v4 CBS domain-containing protein 0.8448 259 475 GO:0005524
GO:0008556
GO:0016020
GO:0016887
AF-A0A519JCB6-F1-model_v4 K(+)-transporting ATPase subunit B 0.8361 128 522 GO:0005524
GO:0008556
GO:0016020
GO:0016887
AF-A0A6B3FGJ3-F1-model_v4 HAD family hydrolase 0.8354 256 424 GO:0005524
GO:0008556
GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
66.14 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map