F464992

General Info

Members Datasets Scaffolds Average Seq Length
571 188 1086 114

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0007274|Ga0495585_0007274_5343_5759
Length 138
Sequence MPARAMSARPAPLRNVPNYWKRIVMNKTTLSIFAALFLSGVAGSTIAGEVPASFDAKNCKVDYPKASLMNEEQGTTSMSFLINPDGSVADSKVEKSSGFKGLDKAAIKSLSACKFKPGTKDGAPAQTWTKVDYAWKLD

Samples

Sample ID Description Type Environment
1 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
65 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
66 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
67 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
68 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
69 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
81 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
82 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
89 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
90 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
142 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
143 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
171 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
176 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
179 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
180 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
181 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
182 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
183 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
184 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
185 2842711865 Duganella sp. R-73148 Isolate Unclassified
186 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
187 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
188 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 2.63
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.76
Nodule 0.88
Rhizoplane 2.45
Rhizosphere 75.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495585_0007274 3300046492 Bacteria 6795
2 JGI25158J39367_1003234 3300002739 Bacteria 2545
3 JGI25152J39213_1000474 3300002773 Bacteria 23243
4 JGI25152J39213_1014662 3300002773 Bacteria 1578
5 JGI25150J39212_1001053 3300002774 Bacteria 8383
6 JGI25150J39212_1001853 3300002774 Bacteria 5590
7 JGI25159J45721_1001591 3300002987 Bacteria 9280
8 JGI25159J45721_1001764 3300002987 Bacteria 8692
9 JGI25159J45721_1004625 3300002987 Bacteria 4509
10 JGI25153J46596_10003041 3300003215 Bacteria 9476
11 rootL2_10052559 3300003322 Bacteria 1273
12 rootL2_10052560 3300003322 Bacteria 1807
13 rootH1_10137248 3300003323 Bacteria 1441
14 rootH1_10177635 3300003323 Bacteria 1483
15 JGI25160J50197_1006935 3300003354 Bacteria 4508
16 JGI25161J50226_1001015 3300003374 Bacteria 9771
17 JGI25161J50226_1002196 3300003374 Bacteria 5192
18 JGI25161J50226_1028049 3300003374 Bacteria 544
19 Ga0055529_1000246 3300003763 Bacteria 66899
20 Ga0055526_1000042 3300003771 Bacteria 124886
21 Ga0055526_1001099 3300003771 Bacteria 19652
22 Ga0055526_1001938 3300003771 Bacteria 14318
23 Ga0055526_1016908 3300003771 Bacteria 2820
24 Ga0055537_1000076 3300003773 Bacteria 70798
25 Ga0055537_1008270 3300003773 Bacteria 2416
26 Ga0055537_1015745 3300003773 Bacteria 1312
27 Ga0055524_1003067 3300003775 Bacteria 8260
28 Ga0055524_1003700 3300003775 Bacteria 7320
29 Ga0055524_1006549 3300003775 Bacteria 5039
30 Ga0055524_1007630 3300003775 Bacteria 4575
31 Ga0055534_1000124 3300003784 Bacteria 57565
32 Ga0055534_1004212 3300003784 Bacteria 4242
33 Ga0055534_1007407 3300003784 Bacteria 2618
34 Ga0055528_1000042 3300003790 Bacteria 104874
35 Ga0055528_1004249 3300003790 Bacteria 6935
36 Ga0055530_10004200 3300003791 Bacteria 7580
37 Ga0055530_10005122 3300003791 Bacteria 6402
38 Ga0055530_10007605 3300003791 Bacteria 4527
39 Ga0055531_10003350 3300003794 Bacteria 10242
40 Ga0055543_1001371 3300004625 Bacteria 9809
41 Ga0065165_1000003 3300005262 Bacteria 390701
42 Ga0065165_1003921 3300005262 Bacteria 9809
43 Ga0065165_1107715 3300005262 Bacteria 689
44 Ga0065715_10192739 3300005293 Bacteria 1406
45 Ga0070658_10644812 3300005327 Bacteria 919
46 Ga0070682_100335022 3300005337 Bacteria 1123
47 Ga0070679_101355193 3300005530 Bacteria 657
48 Ga0068853_100953112 3300005539 Bacteria 825
49 Ga0070664_100090185 3300005564 Bacteria 2653
50 Ga0075370_10176645 3300006353 Bacteria 1256
51 Ga0079104_1008197 3300006946 Bacteria 3691
52 Ga0099826_10000005 3300006948 Bacteria 465206
53 Ga0105244_10296867 3300009036 Bacteria 748
54 Ga0105248_11229427 3300009177 Bacteria 847
55 Ga0157327_1061427 3300012512 Bacteria 561
56 Ga0157371_10000010 3300013102 Bacteria 384921
57 Ga0157372_10600858 3300013307 Bacteria 1282
58 Ga0182008_10000676 3300014497 Bacteria 24655
59 Ga0182008_10008419 3300014497 Bacteria 5631
60 Ga0157379_11602210 3300014968 Bacteria 636
61 Ga0182006_1000004 3300015261 Bacteria 622190
62 Ga0182007_10000216 3300015262 Bacteria 38572
63 Ga0182005_1000011 3300015265 Bacteria 420605
64 Ga0163161_10004416 3300017792 Bacteria 9809
65 Ga0213872_10000017 3300021361 Bacteria 178787
66 Ga0213872_10002819 3300021361 Bacteria 9946
67 Ga0213872_10004431 3300021361 Bacteria 7459
68 Ga0209436_101552 3300025208 Bacteria 7807
69 Ga0209436_103170 3300025208 Bacteria 4497
70 Ga0209437_104316 3300025233 Bacteria 2517
71 Ga0207425_1000106 3300025245 Bacteria 78155
72 Ga0207425_1000110 3300025245 Bacteria 77431
73 Ga0207425_1000494 3300025245 Bacteria 24699
74 Ga0209646_1000097 3300025246 Bacteria 181432
75 Ga0209129_1000193 3300025258 Bacteria 81616
76 Ga0209129_1003187 3300025258 Bacteria 7338
77 Ga0209129_1065188 3300025258 Bacteria 533
78 Ga0209565_1000018 3300025263 Bacteria 460940
79 Ga0209565_1000276 3300025263 Bacteria 51942
80 Ga0209565_1001128 3300025263 Bacteria 12873
81 Ga0209565_1002776 3300025263 Bacteria 6061
82 Ga0209565_1004739 3300025263 Bacteria 4081
83 Ga0209565_1006752 3300025263 Bacteria 3180
84 Ga0209455_1000187 3300025272 Bacteria 94529
85 Ga0209673_1000006 3300025273 Bacteria 650600
86 Ga0209673_1029100 3300025273 Bacteria 1764
87 Ga0209130_1000036 3300025284 Bacteria 284111
88 Ga0209130_1000188 3300025284 Bacteria 86963
89 Ga0209130_1002620 3300025284 Bacteria 8665
90 Ga0209130_1004570 3300025284 Bacteria 5198
91 Ga0209675_1000005 3300025291 Bacteria 849192
92 Ga0209675_1003083 3300025291 Bacteria 8153
93 Ga0209675_1013880 3300025291 Bacteria 2486
94 Ga0209564_1000144 3300025295 Bacteria 175328
95 Ga0209564_1000343 3300025295 Bacteria 89036
96 Ga0209564_1002480 3300025295 Bacteria 14454
97 Ga0209564_1010118 3300025295 Bacteria 4388
98 Ga0209758_1000353 3300025297 Bacteria 83330
99 Ga0209050_1000316 3300025298 Bacteria 98257
100 Ga0209050_1000519 3300025298 Bacteria 64306
101 Ga0209050_1001736 3300025298 Bacteria 21692
102 Ga0209050_1005304 3300025298 Bacteria 8193
103 Ga0209256_1000070 3300025299 Bacteria 245034
104 Ga0209256_1000090 3300025299 Bacteria 212541
105 Ga0209256_1000184 3300025299 Bacteria 121336
106 Ga0209256_1000503 3300025299 Bacteria 57448
107 Ga0209256_1011238 3300025299 Bacteria 3610
108 Ga0209256_1011865 3300025299 Bacteria 3422
109 Ga0207426_1008229 3300025302 Bacteria 4242
110 Ga0207426_1055586 3300025302 Bacteria 1159
111 Ga0207426_1109604 3300025302 Bacteria 698
112 Ga0209051_1029820 3300025303 Bacteria 2128
113 Ga0209051_1061649 3300025303 Bacteria 1177
114 Ga0209257_1000123 3300025304 Bacteria 219092
115 Ga0209257_1011138 3300025304 Bacteria 4387
116 Ga0207655_1240784 3300025728 Bacteria 517
117 Ga0207684_10891598 3300025910 Bacteria 748
118 Ga0207711_10906944 3300025941 Bacteria 819
119 Ga0207679_10770197 3300025945 Bacteria 876
120 Ga0207698_10228480 3300026142 Bacteria 1687
121 Ga0209281_1004564 3300027111 Bacteria 4115
122 Ga0209282_1000003 3300027666 Bacteria 856377
123 Ga0316177_1203831 3300030731 Bacteria 843
124 Ga0316180_1101360 3300030736 Bacteria 2700
125 Ga0316183_1003333 3300030742 Bacteria 1431
126 Ga0316182_1149700 3300030745 Bacteria 2489
127 Ga0307513_10443473 3300031456 Bacteria 1024
128 Ga0307408_100000484 3300031548 Bacteria 34826
129 Ga0307408_100000685 3300031548 Bacteria 27849
130 Ga0307408_100019614 3300031548 Bacteria 4554
131 Ga0307408_100644970 3300031548 Bacteria 946
132 Ga0265314_10253200 3300031711 Bacteria 1010
133 Ga0307518_10143919 3300031838 Bacteria 1658
134 Ga0307416_100009809 3300032002 Bacteria 6294
135 Ga0307414_10069271 3300032004 Bacteria 2535
136 Ga0307510_10497911 3300033180 Bacteria 661
137 Ga0436361_0227838 3300039447 Bacteria 14652
138 Ga0436361_0746602 3300039447 Bacteria 58377
139 Ga0436361_1095030 3300039447 Bacteria 3498
140 Ga0436361_1193285 3300039447 Bacteria 1685
141 Ga0439448_0157908 3300042005 Bacteria 789
142 Ga0439449_0144326 3300042007 Bacteria 887
143 Ga0439454_081191 3300042011 Bacteria 588
144 Ga0450890_034212 3300042127 Bacteria 733
145 Ga0450906_085241 3300042145 Bacteria 571
146 Ga0466972_0278726 3300044658 Bacteria 781
147 Ga0466982_0328298 3300044672 Bacteria 859
148 Ga0466965_0020886 3300044683 Bacteria 3151
149 Ga0466968_0018579 3300044735 Bacteria 2790
150 Ga0466967_0008253 3300045976 Bacteria 7606
151 Ga0495617_000005 3300046452 Bacteria 404687
152 Ga0495617_000656 3300046452 Bacteria 17375
153 Ga0495617_015657 3300046452 Bacteria 2567
154 Ga0495617_106951 3300046452 Bacteria 906
155 Ga0495627_000033 3300046453 Bacteria 220621
156 Ga0495627_006189 3300046453 Bacteria 4715
157 Ga0495590_0000011 3300046457 Bacteria 307470
158 Ga0495590_0008175 3300046457 Bacteria 4004
159 Ga0495629_0028849 3300046459 Bacteria 3938
160 Ga0495629_0134000 3300046459 Bacteria 1725
161 Ga0495638_0000080 3300046460 Bacteria 155967
162 Ga0495638_0012529 3300046460 Bacteria 5806
163 Ga0495638_0066066 3300046460 Bacteria 2224
164 Ga0495638_0152570 3300046460 Bacteria 1339
165 Ga0495653_0000008 3300046463 Bacteria 307868
166 Ga0495650_0000109 3300046471 Bacteria 199925
167 Ga0495650_0000125 3300046471 Bacteria 178542
168 Ga0495650_0000451 3300046471 Bacteria 65206
169 Ga0495650_0000701 3300046471 Bacteria 42968
170 Ga0495605_0000879 3300046474 Bacteria 20792
171 Ga0495605_0007575 3300046474 Bacteria 6154
172 Ga0495605_0037640 3300046474 Bacteria 2431
173 Ga0495605_0077902 3300046474 Bacteria 1554
174 Ga0495605_0111076 3300046474 Bacteria 1251
175 Ga0495584_0000015 3300046491 Bacteria 169335
176 Ga0495584_0000258 3300046491 Bacteria 37841
177 Ga0495584_0001068 3300046491 Bacteria 16997
178 Ga0495584_0012614 3300046491 Bacteria 4314
179 Ga0495584_0017848 3300046491 Bacteria 3609
180 Ga0495584_0041832 3300046491 Bacteria 2312
181 Ga0495584_0055633 3300046491 Bacteria 1990
182 Ga0495584_0061519 3300046491 Bacteria 1887
183 Ga0495584_0067900 3300046491 Bacteria 1791
184 Ga0495584_0070265 3300046491 Bacteria 1760
185 Ga0495584_0089640 3300046491 Bacteria 1550
186 Ga0495584_0248523 3300046491 Bacteria 904
187 Ga0495584_0253074 3300046491 Bacteria 895
188 Ga0495585_0000278 3300046492 Bacteria 51304
189 Ga0495585_0000434 3300046492 Bacteria 39978
190 Ga0495585_0000645 3300046492 Bacteria 32066
191 Ga0495585_0009982 3300046492 Bacteria 5674
192 Ga0495585_0026117 3300046492 Bacteria 3338
193 Ga0495585_0030748 3300046492 Bacteria 3053
194 Ga0495585_0039054 3300046492 Bacteria 2669
195 Ga0495585_0048428 3300046492 Bacteria 2363
196 Ga0495585_0069993 3300046492 Bacteria 1914
197 Ga0495585_0098702 3300046492 Bacteria 1564
198 Ga0495585_0160649 3300046492 Bacteria 1166
199 Ga0495585_0168295 3300046492 Bacteria 1133
200 Ga0495585_0255318 3300046492 Bacteria 873
201 Ga0495585_0260465 3300046492 Bacteria 862
202 Ga0495585_0282318 3300046492 Bacteria 820
203 Ga0495585_0460388 3300046492 Bacteria 607
204 Ga0495594_0000076 3300046499 Bacteria 43373
205 Ga0495594_0001606 3300046499 Bacteria 11771
206 Ga0495594_0079990 3300046499 Bacteria 1824
207 Ga0495594_0547704 3300046499 Bacteria 656
208 Ga0495596_0000384 3300046500 Bacteria 28244
209 Ga0495596_0001295 3300046500 Bacteria 14457
210 Ga0495596_0009421 3300046500 Bacteria 4295
211 Ga0495596_0022101 3300046500 Bacteria 2591
212 Ga0495596_0109174 3300046500 Bacteria 1074
213 Ga0495596_0118594 3300046500 Bacteria 1028
214 Ga0495607_0000543 3300046501 Bacteria 36933
215 Ga0495607_0038772 3300046501 Bacteria 2851
216 Ga0495607_0041854 3300046501 Bacteria 2718
217 Ga0495607_0064535 3300046501 Bacteria 2067
218 Ga0495607_0274906 3300046501 Bacteria 801
219 Ga0495607_0350482 3300046501 Bacteria 681
220 Ga0495583_0000064 3300046506 Bacteria 192380
221 Ga0495583_0002067 3300046506 Bacteria 18138
222 Ga0495583_0004669 3300046506 Bacteria 9658
223 Ga0495583_0011039 3300046506 Bacteria 5208
224 Ga0495583_0172529 3300046506 Bacteria 888
225 Ga0495606_0000360 3300046507 Bacteria 77832
226 Ga0495606_0000452 3300046507 Bacteria 67182
227 Ga0495606_0000839 3300046507 Bacteria 46262
228 Ga0495606_0001797 3300046507 Bacteria 27296
229 Ga0495606_0002035 3300046507 Bacteria 24779
230 Ga0495606_0002556 3300046507 Bacteria 20908
231 Ga0495606_0003078 3300046507 Bacteria 18179
232 Ga0495606_0003392 3300046507 Bacteria 16936
233 Ga0495606_0013567 3300046507 Bacteria 6427
234 Ga0495606_0032040 3300046507 Bacteria 3646
235 Ga0495606_0084578 3300046507 Bacteria 1964
236 Ga0495606_0114492 3300046507 Bacteria 1622
237 Ga0495606_0185732 3300046507 Bacteria 1195
238 Ga0495606_0247332 3300046507 Bacteria 991
239 Ga0495610_0000007 3300046512 Bacteria 820919
240 Ga0495610_0004774 3300046512 Bacteria 9887
241 Ga0495610_0231468 3300046512 Bacteria 741
242 Ga0495610_0243095 3300046512 Bacteria 717
243 Ga0495610_0269671 3300046512 Bacteria 667
244 Ga0495616_0003613 3300046513 Bacteria 9884
245 Ga0495616_0005261 3300046513 Bacteria 7986
246 Ga0495616_0019077 3300046513 Bacteria 3748
247 Ga0495616_0025534 3300046513 Bacteria 3154
248 Ga0495616_0194885 3300046513 Bacteria 893
249 Ga0495616_0290098 3300046513 Bacteria 693
250 Ga0495620_0001276 3300046515 Bacteria 15358
251 Ga0495631_0039325 3300046518 Bacteria 2099
252 Ga0495631_0053407 3300046518 Bacteria 1763
253 Ga0495631_0060902 3300046518 Bacteria 1637
254 Ga0495631_0106735 3300046518 Bacteria 1204
255 Ga0495631_0171375 3300046518 Bacteria 930
256 Ga0495632_0010802 3300046519 Bacteria 5377
257 Ga0495632_0021988 3300046519 Bacteria 3427
258 Ga0495637_0008467 3300046520 Bacteria 5049
259 Ga0495643_0000589 3300046522 Bacteria 44283
260 Ga0495643_0036627 3300046522 Bacteria 2694
261 Ga0495643_0086689 3300046522 Bacteria 1622
262 Ga0495643_0241948 3300046522 Bacteria 846
263 Ga0495643_0399028 3300046522 Bacteria 607
264 Ga0495644_0004250 3300046523 Bacteria 5623
265 Ga0495644_0014219 3300046523 Bacteria 3048
266 Ga0495644_0025252 3300046523 Bacteria 2256
267 Ga0495644_0041627 3300046523 Bacteria 1730
268 Ga0495644_0134088 3300046523 Bacteria 944
269 Ga0495644_0186293 3300046523 Bacteria 798
270 Ga0495644_0337564 3300046523 Bacteria 592
271 Ga0495648_0000136 3300046524 Bacteria 87034
272 Ga0495648_0006086 3300046524 Bacteria 9900
273 Ga0495648_0290308 3300046524 Bacteria 771
274 Ga0495663_0001532 3300046525 Bacteria 7265
275 Ga0495663_0042429 3300046525 Bacteria 1386
276 Ga0495663_0113350 3300046525 Bacteria 902
277 Ga0495666_0006739 3300046526 Bacteria 5776
278 Ga0495642_0001469 3300046528 Bacteria 10538
279 Ga0495642_0003742 3300046528 Bacteria 5956
280 Ga0495642_0008605 3300046528 Bacteria 3903
281 Ga0495642_0008844 3300046528 Bacteria 3851
282 Ga0495642_0016810 3300046528 Bacteria 2854
283 Ga0495642_0062623 3300046528 Bacteria 1545
284 Ga0495642_0069844 3300046528 Bacteria 1467
285 Ga0495642_0078576 3300046528 Bacteria 1387
286 Ga0495654_0009906 3300046530 Bacteria 5209
287 Ga0495654_0023453 3300046530 Bacteria 3196
288 Ga0495654_0096216 3300046530 Bacteria 1368
289 Ga0495654_0214804 3300046530 Bacteria 816
290 Ga0495654_0242731 3300046530 Bacteria 753
291 Ga0495665_0015002 3300046531 Bacteria 4174
292 Ga0495609_0000227 3300046538 Bacteria 54650
293 Ga0495609_0001807 3300046538 Bacteria 13739
294 Ga0495609_0002406 3300046538 Bacteria 11519
295 Ga0495609_0002431 3300046538 Bacteria 11462
296 Ga0495609_0087371 3300046538 Bacteria 1358
297 Ga0495609_0112168 3300046538 Bacteria 1176
298 Ga0495609_0147079 3300046538 Bacteria 1003
299 Ga0495597_0000163 3300046542 Bacteria 59305
300 Ga0495597_0000834 3300046542 Bacteria 24225
301 Ga0495597_0002008 3300046542 Bacteria 13637
302 Ga0495597_0003339 3300046542 Bacteria 9458
303 Ga0495597_0006175 3300046542 Bacteria 6224
304 Ga0495597_0007998 3300046542 Bacteria 5320
305 Ga0495597_0066515 3300046542 Bacteria 1561
306 Ga0495597_0138856 3300046542 Bacteria 1003
307 Ga0495597_0252741 3300046542 Bacteria 692
308 Ga0495622_0027542 3300046557 Bacteria 2653
309 Ga0495622_0032451 3300046557 Bacteria 2438
310 Ga0495622_0089449 3300046557 Bacteria 1415
311 Ga0495622_0138842 3300046557 Bacteria 1104
312 Ga0495633_0000944 3300046558 Bacteria 24353
313 Ga0495633_0001347 3300046558 Bacteria 19249
314 Ga0495633_0002861 3300046558 Bacteria 11842
315 Ga0495633_0004393 3300046558 Bacteria 8990
316 Ga0495633_0005662 3300046558 Bacteria 7564
317 Ga0495633_0012640 3300046558 Bacteria 4481
318 Ga0495633_0013504 3300046558 Bacteria 4300
319 Ga0495633_0013913 3300046558 Bacteria 4219
320 Ga0495633_0019989 3300046558 Bacteria 3376
321 Ga0495633_0061227 3300046558 Bacteria 1762
322 Ga0495633_0157015 3300046558 Bacteria 1050
323 Ga0495633_0465187 3300046558 Bacteria 571
324 Ga0495633_0493700 3300046558 Bacteria 552
325 Ga0495633_0516673 3300046558 Bacteria 538
326 Ga0495656_0001573 3300046615 Bacteria 7472
327 Ga0495656_0005773 3300046615 Bacteria 4297
328 Ga0495656_0012668 3300046615 Bacteria 3118
329 Ga0495656_0148701 3300046615 Bacteria 1129
330 Ga0495656_0158355 3300046615 Bacteria 1099
331 Ga0495656_0201154 3300046615 Bacteria 988
332 Ga0495656_0797348 3300046615 Bacteria 510
333 Ga0495668_0000046 3300046616 Bacteria 224203
334 Ga0495668_0000403 3300046616 Bacteria 56555
335 Ga0495668_0001935 3300046616 Bacteria 18425
336 Ga0495668_0002614 3300046616 Bacteria 14521
337 Ga0495668_0004943 3300046616 Bacteria 9236
338 Ga0495668_0009076 3300046616 Bacteria 6137
339 Ga0495668_0042183 3300046616 Bacteria 2541
340 Ga0495668_0042701 3300046616 Bacteria 2523
341 Ga0495668_0050793 3300046616 Bacteria 2297
342 Ga0495668_0093761 3300046616 Bacteria 1644
343 Ga0495668_0394917 3300046616 Bacteria 760
344 Ga0495611_0000827 3300046648 Bacteria 17082
345 Ga0495611_0002131 3300046648 Bacteria 9258
346 Ga0495611_0010663 3300046648 Bacteria 3890
347 Ga0495611_0037381 3300046648 Bacteria 2157
348 Ga0495611_0089706 3300046648 Bacteria 1420
349 Ga0495611_0128635 3300046648 Bacteria 1181
350 Ga0495611_0140626 3300046648 Bacteria 1127
351 Ga0495611_0381093 3300046648 Bacteria 645
352 Ga0495611_0446997 3300046648 Bacteria 589
353 Ga0495611_0495339 3300046648 Bacteria 555
354 Ga0495625_0002125 3300046660 Bacteria 22109
355 Ga0495625_0013913 3300046660 Bacteria 6442
356 Ga0495625_0072766 3300046660 Bacteria 2410
357 Ga0495625_0212945 3300046660 Bacteria 1269
358 Ga0495625_0266467 3300046660 Bacteria 1107
359 Ga0495659_0000326 3300046664 Bacteria 18798
360 Ga0495659_0022912 3300046664 Bacteria 2117
361 Ga0495659_0067082 3300046664 Bacteria 1337
362 Ga0495659_0167805 3300046664 Bacteria 889
363 Ga0495659_0447370 3300046664 Bacteria 562
364 Ga0495661_0008669 3300046665 Bacteria 7027
365 Ga0495661_0010864 3300046665 Bacteria 6192
366 Ga0495661_0014975 3300046665 Bacteria 5183
367 Ga0495661_0034058 3300046665 Bacteria 3208
368 Ga0495661_0044039 3300046665 Bacteria 2738
369 Ga0495661_0054773 3300046665 Bacteria 2393
370 Ga0495661_0080496 3300046665 Bacteria 1879
371 Ga0495661_0231958 3300046665 Bacteria 951
372 Ga0495661_0302494 3300046665 Bacteria 800
373 Ga0495661_0441560 3300046665 Bacteria 627
374 Ga0495661_0535195 3300046665 Bacteria 555
375 Ga0495661_0578580 3300046665 Bacteria 529
376 Ga0495588_0013885 3300046674 Bacteria 3845
377 Ga0495588_0099453 3300046674 Bacteria 1528
378 Ga0495588_0208021 3300046674 Bacteria 1033
379 Ga0495588_0268820 3300046674 Bacteria 898
380 Ga0495588_0306025 3300046674 Bacteria 836
381 Ga0495669_0184399 3300046684 Bacteria 995
382 Ga0495669_0541604 3300046684 Bacteria 566
383 Ga0495670_0002447 3300046691 Bacteria 9172
384 Ga0495670_0005268 3300046691 Bacteria 6362
385 Ga0495670_0005416 3300046691 Bacteria 6265
386 Ga0495670_0012273 3300046691 Bacteria 4211
387 Ga0495670_0025748 3300046691 Bacteria 2910
388 Ga0495670_0063509 3300046691 Bacteria 1859
389 Ga0495670_0071162 3300046691 Bacteria 1760
390 Ga0495670_0227497 3300046691 Bacteria 991
391 Ga0495670_0267726 3300046691 Bacteria 912
392 Ga0495671_0000009 3300046692 Bacteria 369875
393 Ga0495671_0001345 3300046692 Bacteria 16667
394 Ga0495671_0023994 3300046692 Bacteria 3182
395 Ga0495671_0031831 3300046692 Bacteria 2695
396 Ga0495671_0270341 3300046692 Bacteria 819
397 Ga0495649_0216349 3300046694 Bacteria 992
398 Ga0495649_0219011 3300046694 Bacteria 985
399 Ga0495649_0383973 3300046694 Bacteria 706
400 Ga0495589_0079406 3300046794 Bacteria 1596
401 Ga0495589_0192762 3300046794 Bacteria 964
402 Ga0495589_0216303 3300046794 Bacteria 901
403 Ga0495589_0270357 3300046794 Bacteria 791
404 Ga0495600_0200688 3300046809 Bacteria 1281
405 Ga0495660_0000754 3300046810 Bacteria 24439
406 Ga0495660_0001185 3300046810 Bacteria 18363
407 Ga0495660_0004359 3300046810 Bacteria 8568
408 Ga0495660_0011659 3300046810 Bacteria 5098
409 Ga0495660_0052122 3300046810 Bacteria 2224
410 Ga0495660_0119862 3300046810 Bacteria 1332
411 Ga0495636_0000739 3300047318 Bacteria 12008
412 Ga0495636_0001315 3300047318 Bacteria 9428
413 Ga0495636_0010362 3300047318 Bacteria 3680
414 Ga0495636_0084432 3300047318 Bacteria 1371
415 Ga0495636_0085991 3300047318 Bacteria 1360
416 Ga0495636_0109786 3300047318 Bacteria 1213
417 Ga0495636_0218781 3300047318 Bacteria 874
418 Ga0495674_0001246 3300047319 Bacteria 24703
419 Ga0495672_0000005 3300047320 Bacteria 593294
420 Ga0495672_0000161 3300047320 Bacteria 96964
421 Ga0495672_0000388 3300047320 Bacteria 54085
422 Ga0495672_0022397 3300047320 Bacteria 4108
423 Ga0495672_0037316 3300047320 Bacteria 2974
424 Ga0495672_0050113 3300047320 Bacteria 2468
425 Ga0495672_0076689 3300047320 Bacteria 1876
426 Ga0495672_0306222 3300047320 Bacteria 750
427 Ga0495676_0011634 3300047321 Bacteria 7940
428 Ga0495676_0022365 3300047321 Bacteria 5501
429 Ga0495676_0047568 3300047321 Bacteria 3467
430 Ga0495683_0000145 3300047323 Bacteria 69835
431 Ga0495683_0027879 3300047323 Bacteria 2888
432 Ga0495683_0047463 3300047323 Bacteria 2155
433 Ga0495683_0067887 3300047323 Bacteria 1755
434 Ga0495687_010441 3300047443 Bacteria 5094
435 Ga0495687_044043 3300047443 Bacteria 1942
436 Ga0495677_0001439 3300047445 Bacteria 9555
437 Ga0495677_0003244 3300047445 Bacteria 6343
438 Ga0495677_0007802 3300047445 Bacteria 3988
439 Ga0495677_0016440 3300047445 Bacteria 2685
440 Ga0495677_0048777 3300047445 Bacteria 1556
441 Ga0495677_0083932 3300047445 Bacteria 1196
442 Ga0495677_0090099 3300047445 Bacteria 1155
443 Ga0495677_0188423 3300047445 Bacteria 800
444 Ga0495679_010627 3300047446 Bacteria 3605
445 Ga0495679_015706 3300047446 Bacteria 2760
446 Ga0495685_000037 3300047447 Bacteria 54783
447 Ga0495685_037347 3300047447 Bacteria 1666
448 Ga0495685_067095 3300047447 Bacteria 1204
449 Ga0495673_0000032 3300047469 Bacteria 375856
450 Ga0495673_0000057 3300047469 Bacteria 239715
451 Ga0495673_0001230 3300047469 Bacteria 21209
452 Ga0495673_0009991 3300047469 Bacteria 5198
453 Ga0495673_0163419 3300047469 Bacteria 853
454 Ga0495681_0024525 3300047470 Bacteria 3175
455 Ga0495681_0024988 3300047470 Bacteria 3133
456 Ga0495681_0040745 3300047470 Bacteria 2259
457 Ga0495681_0071083 3300047470 Bacteria 1576
458 Ga0495681_0136438 3300047470 Bacteria 1040
459 Ga0495681_0382382 3300047470 Bacteria 529
460 Ga0495686_0003057 3300047472 Bacteria 14833
461 Ga0495686_0006608 3300047472 Bacteria 8840
462 Ga0495686_0009859 3300047472 Bacteria 6847
463 Ga0495686_0089758 3300047472 Bacteria 1867
464 Ga0495614_0549173 3300048089 Bacteria 552
465 Ga0495615_0037456 3300048090 Bacteria 1194
466 Ga0495615_0067415 3300048090 Bacteria 957
467 Ga0495615_0080058 3300048090 Bacteria 894
468 Ga0495615_0171079 3300048090 Bacteria 657
469 Ga0495626_0007233 3300048091 Bacteria 6202
470 Ga0495626_0010901 3300048091 Bacteria 4826
471 Ga0495626_0013896 3300048091 Bacteria 4170
472 Ga0495626_0025280 3300048091 Bacteria 2906
473 Ga0495626_0026822 3300048091 Bacteria 2803
474 Ga0496102_0000302 3300048905 Bacteria 62812
475 Ga0496102_0041820 3300048905 Bacteria 4152
476 Ga0496102_0081026 3300048905 Bacteria 2991
477 Ga0496102_0139567 3300048905 Bacteria 2272
478 Ga0496103_0032671 3300048906 Bacteria 3176
479 Ga0496103_0412460 3300048906 Bacteria 867
480 Ga0496107_0896686 3300048910 Bacteria 646
481 Ga0496111_0015971 3300048914 Bacteria 5166
482 Ga0496115_0037500 3300048918 Bacteria 3841
483 Ga0496115_0059979 3300048918 Bacteria 3065
484 Ga0496116_0020623 3300048919 Bacteria 5000
485 Ga0496116_0061920 3300048919 Bacteria 2419
486 Ga0496116_0349483 3300048919 Bacteria 678
487 Ga0496117_0000011 3300048920 Bacteria 610930
488 Ga0496118_0000010 3300048921 Bacteria 610930
489 Ga0496120_0063281 3300048923 Bacteria 2059
490 Ga0496121_0004864 3300048924 Bacteria 17651
491 Ga0496121_0017099 3300048924 Bacteria 7435
492 Ga0496121_0231357 3300048924 Bacteria 1294
493 Ga0496121_0860513 3300048924 Bacteria 526
494 Ga0496122_0039124 3300048925 Bacteria 3786
495 Ga0496122_0268631 3300048925 Bacteria 941
496 Ga0496123_0012015 3300048926 Bacteria 7427
497 Ga0496123_0024643 3300048926 Bacteria 4566
498 Ga0496124_0020315 3300048927 Bacteria 6143
499 Ga0496124_0061016 3300048927 Bacteria 3162
500 Ga0496125_0077989 3300048928 Bacteria 2549
501 Ga0496126_0008128 3300048929 Bacteria 11357
502 Ga0496126_0659881 3300048929 Bacteria 817
503 Ga0496126_0892549 3300048929 Bacteria 675
504 Ga0501306_015929 3300049127 Bacteria 1005
505 Ga0501306_076443 3300049127 Bacteria 572
506 Ga0501309_015976 3300049129 Bacteria 1019
507 Ga0501309_028996 3300049129 Bacteria 809
508 Ga0501309_055477 3300049129 Bacteria 629
509 Ga0501310_000699 3300049130 Bacteria 2977
510 Ga0501310_016498 3300049130 Bacteria 886
511 Ga0501305_036528 3300049161 Bacteria 786
512 Ga0495678_001813 3300049459 Bacteria 15706
513 Ga0495678_002721 3300049459 Bacteria 11638
514 Ga0495678_002938 3300049459 Bacteria 10896
515 Ga0495678_052008 3300049459 Bacteria 1580
516 Ga0495678_104263 3300049459 Bacteria 978
517 Ga0495682_0002730 3300049460 Bacteria 8186
518 Ga0495682_0002992 3300049460 Bacteria 7716
519 Ga0495682_0006986 3300049460 Bacteria 4524
520 Ga0495682_0053337 3300049460 Bacteria 1468
521 Ga0495682_0210807 3300049460 Bacteria 688
522 Ga0501292_098463 3300049515 Bacteria 576
523 Ga0501311_029140 3300049527 Bacteria 791
524 Ga0501312_024668 3300049528 Bacteria 912
525 Ga0501320_064210 3300049536 Bacteria 521
526 Ga0501323_045950 3300049539 Bacteria 652
527 Ga0501227_046977 3300049665 Bacteria 1080
528 Ga0501227_084662 3300049665 Bacteria 833
529 Ga0501221_018066 3300049704 Bacteria 1354
530 Ga0501221_036441 3300049704 Bacteria 1054
531 Ga0501225_0115911 3300049705 Bacteria 793
532 Ga0501263_009166 3300049760 Bacteria 1194
533 Ga0501275_056892 3300049772 Bacteria 587
534 Ga0501276_037550 3300049773 Bacteria 529
535 Ga0501279_004607 3300049775 Bacteria 1812
536 Ga0500594_0000746 3300053118 Bacteria 6929
537 Ga0500618_059774 3300053125 Bacteria 857
538 Ga0500618_066657 3300053125 Bacteria 809
539 2601669330 2600255292 Bacteria 6300551
540 2842712844 2842711865 Bacteria 7155354
541 2857549457 2857547612 Bacteria 6179999
542 2932414589 2932410948 Bacteria 6312192
543 2932420890 2932416698 Bacteria 6315112
544 Ga0495585_0007274
545 JGI25158J39367_1003234
546 JGI25152J39213_1000474
547 JGI25152J39213_1014662
548 JGI25150J39212_1001053
549 JGI25150J39212_1001853
550 JGI25159J45721_1001591
551 JGI25159J45721_1001764
552 JGI25159J45721_1004625
553 JGI25153J46596_10003041
554 rootL2_10052559
555 rootL2_10052560
556 rootH1_10137248
557 rootH1_10177635
558 JGI25160J50197_1006935
559 JGI25161J50226_1001015
560 JGI25161J50226_1002196
561 JGI25161J50226_1028049
562 Ga0055529_1000246
563 Ga0055526_1000042
564 Ga0055526_1001099
565 Ga0055526_1001938
566 Ga0055526_1016908
567 Ga0055537_1000076
568 Ga0055537_1008270
569 Ga0055537_1015745
570 Ga0055524_1003067
571 Ga0055524_1003700
572 Ga0055524_1006549
573 Ga0055524_1007630
574 Ga0055534_1000124
575 Ga0055534_1004212
576 Ga0055534_1007407
577 Ga0055528_1000042
578 Ga0055528_1004249
579 Ga0055530_10004200
580 Ga0055530_10005122
581 Ga0055530_10007605
582 Ga0055531_10003350
583 Ga0055543_1001371
584 Ga0065165_1000003
585 Ga0065165_1003921
586 Ga0065165_1107715
587 Ga0065715_10192739
588 Ga0070658_10644812
589 Ga0070682_100335022
590 Ga0070679_101355193
591 Ga0068853_100953112
592 Ga0070664_100090185
593 Ga0075370_10176645
594 Ga0079104_1008197
595 Ga0099826_10000005
596 Ga0105244_10296867
597 Ga0105248_11229427
598 Ga0157327_1061427
599 Ga0157371_10000010
600 Ga0157372_10600858
601 Ga0182008_10000676
602 Ga0182008_10008419
603 Ga0157379_11602210
604 Ga0182006_1000004
605 Ga0182007_10000216
606 Ga0182005_1000011
607 Ga0163161_10004416
608 Ga0213872_10000017
609 Ga0213872_10002819
610 Ga0213872_10004431
611 Ga0209436_101552
612 Ga0209436_103170
613 Ga0209437_104316
614 Ga0207425_1000106
615 Ga0207425_1000110
616 Ga0207425_1000494
617 Ga0209646_1000097
618 Ga0209129_1000193
619 Ga0209129_1003187
620 Ga0209129_1065188
621 Ga0209565_1000018
622 Ga0209565_1000276
623 Ga0209565_1001128
624 Ga0209565_1002776
625 Ga0209565_1004739
626 Ga0209565_1006752
627 Ga0209455_1000187
628 Ga0209673_1000006
629 Ga0209673_1029100
630 Ga0209130_1000036
631 Ga0209130_1000188
632 Ga0209130_1002620
633 Ga0209130_1004570
634 Ga0209675_1000005
635 Ga0209675_1003083
636 Ga0209675_1013880
637 Ga0209564_1000144
638 Ga0209564_1000343
639 Ga0209564_1002480
640 Ga0209564_1010118
641 Ga0209758_1000353
642 Ga0209050_1000316
643 Ga0209050_1000519
644 Ga0209050_1001736
645 Ga0209050_1005304
646 Ga0209256_1000070
647 Ga0209256_1000090
648 Ga0209256_1000184
649 Ga0209256_1000503
650 Ga0209256_1011238
651 Ga0209256_1011865
652 Ga0207426_1008229
653 Ga0207426_1055586
654 Ga0207426_1109604
655 Ga0209051_1029820
656 Ga0209051_1061649
657 Ga0209257_1000123
658 Ga0209257_1011138
659 Ga0207655_1240784
660 Ga0207684_10891598
661 Ga0207711_10906944
662 Ga0207679_10770197
663 Ga0207698_10228480
664 Ga0209281_1004564
665 Ga0209282_1000003
666 Ga0316177_1203831
667 Ga0316180_1101360
668 Ga0316183_1003333
669 Ga0316182_1149700
670 Ga0307513_10443473
671 Ga0307408_100000484
672 Ga0307408_100000685
673 Ga0307408_100019614
674 Ga0307408_100644970
675 Ga0265314_10253200
676 Ga0307518_10143919
677 Ga0307416_100009809
678 Ga0307414_10069271
679 Ga0307510_10497911
680 Ga0436361_0227838
681 Ga0436361_0746602
682 Ga0436361_1095030
683 Ga0436361_1193285
684 Ga0439448_0157908
685 Ga0439449_0144326
686 Ga0439454_081191
687 Ga0450890_034212
688 Ga0450906_085241
689 Ga0466972_0278726
690 Ga0466982_0328298
691 Ga0466965_0020886
692 Ga0466968_0018579
693 Ga0466967_0008253
694 Ga0495617_000005
695 Ga0495617_000656
696 Ga0495617_015657
697 Ga0495617_106951
698 Ga0495627_000033
699 Ga0495627_006189
700 Ga0495590_0000011
701 Ga0495590_0008175
702 Ga0495629_0028849
703 Ga0495629_0134000
704 Ga0495638_0000080
705 Ga0495638_0012529
706 Ga0495638_0066066
707 Ga0495638_0152570
708 Ga0495653_0000008
709 Ga0495650_0000109
710 Ga0495650_0000125
711 Ga0495650_0000451
712 Ga0495650_0000701
713 Ga0495605_0000879
714 Ga0495605_0007575
715 Ga0495605_0037640
716 Ga0495605_0077902
717 Ga0495605_0111076
718 Ga0495584_0000015
719 Ga0495584_0000258
720 Ga0495584_0001068
721 Ga0495584_0012614
722 Ga0495584_0017848
723 Ga0495584_0041832
724 Ga0495584_0055633
725 Ga0495584_0061519
726 Ga0495584_0067900
727 Ga0495584_0070265
728 Ga0495584_0089640
729 Ga0495584_0248523
730 Ga0495584_0253074
731 Ga0495585_0000278
732 Ga0495585_0000434
733 Ga0495585_0000645
734 Ga0495585_0009982
735 Ga0495585_0026117
736 Ga0495585_0030748
737 Ga0495585_0039054
738 Ga0495585_0048428
739 Ga0495585_0069993
740 Ga0495585_0098702
741 Ga0495585_0160649
742 Ga0495585_0168295
743 Ga0495585_0255318
744 Ga0495585_0260465
745 Ga0495585_0282318
746 Ga0495585_0460388
747 Ga0495594_0000076
748 Ga0495594_0001606
749 Ga0495594_0079990
750 Ga0495594_0547704
751 Ga0495596_0000384
752 Ga0495596_0001295
753 Ga0495596_0009421
754 Ga0495596_0022101
755 Ga0495596_0109174
756 Ga0495596_0118594
757 Ga0495607_0000543
758 Ga0495607_0038772
759 Ga0495607_0041854
760 Ga0495607_0064535
761 Ga0495607_0274906
762 Ga0495607_0350482
763 Ga0495583_0000064
764 Ga0495583_0002067
765 Ga0495583_0004669
766 Ga0495583_0011039
767 Ga0495583_0172529
768 Ga0495606_0000360
769 Ga0495606_0000452
770 Ga0495606_0000839
771 Ga0495606_0001797
772 Ga0495606_0002035
773 Ga0495606_0002556
774 Ga0495606_0003078
775 Ga0495606_0003392
776 Ga0495606_0013567
777 Ga0495606_0032040
778 Ga0495606_0084578
779 Ga0495606_0114492
780 Ga0495606_0185732
781 Ga0495606_0247332
782 Ga0495610_0000007
783 Ga0495610_0004774
784 Ga0495610_0231468
785 Ga0495610_0243095
786 Ga0495610_0269671
787 Ga0495616_0003613
788 Ga0495616_0005261
789 Ga0495616_0019077
790 Ga0495616_0025534
791 Ga0495616_0194885
792 Ga0495616_0290098
793 Ga0495620_0001276
794 Ga0495631_0039325
795 Ga0495631_0053407
796 Ga0495631_0060902
797 Ga0495631_0106735
798 Ga0495631_0171375
799 Ga0495632_0010802
800 Ga0495632_0021988
801 Ga0495637_0008467
802 Ga0495643_0000589
803 Ga0495643_0036627
804 Ga0495643_0086689
805 Ga0495643_0241948
806 Ga0495643_0399028
807 Ga0495644_0004250
808 Ga0495644_0014219
809 Ga0495644_0025252
810 Ga0495644_0041627
811 Ga0495644_0134088
812 Ga0495644_0186293
813 Ga0495644_0337564
814 Ga0495648_0000136
815 Ga0495648_0006086
816 Ga0495648_0290308
817 Ga0495663_0001532
818 Ga0495663_0042429
819 Ga0495663_0113350
820 Ga0495666_0006739
821 Ga0495642_0001469
822 Ga0495642_0003742
823 Ga0495642_0008605
824 Ga0495642_0008844
825 Ga0495642_0016810
826 Ga0495642_0062623
827 Ga0495642_0069844
828 Ga0495642_0078576
829 Ga0495654_0009906
830 Ga0495654_0023453
831 Ga0495654_0096216
832 Ga0495654_0214804
833 Ga0495654_0242731
834 Ga0495665_0015002
835 Ga0495609_0000227
836 Ga0495609_0001807
837 Ga0495609_0002406
838 Ga0495609_0002431
839 Ga0495609_0087371
840 Ga0495609_0112168
841 Ga0495609_0147079
842 Ga0495597_0000163
843 Ga0495597_0000834
844 Ga0495597_0002008
845 Ga0495597_0003339
846 Ga0495597_0006175
847 Ga0495597_0007998
848 Ga0495597_0066515
849 Ga0495597_0138856
850 Ga0495597_0252741
851 Ga0495622_0027542
852 Ga0495622_0032451
853 Ga0495622_0089449
854 Ga0495622_0138842
855 Ga0495633_0000944
856 Ga0495633_0001347
857 Ga0495633_0002861
858 Ga0495633_0004393
859 Ga0495633_0005662
860 Ga0495633_0012640
861 Ga0495633_0013504
862 Ga0495633_0013913
863 Ga0495633_0019989
864 Ga0495633_0061227
865 Ga0495633_0157015
866 Ga0495633_0465187
867 Ga0495633_0493700
868 Ga0495633_0516673
869 Ga0495656_0001573
870 Ga0495656_0005773
871 Ga0495656_0012668
872 Ga0495656_0148701
873 Ga0495656_0158355
874 Ga0495656_0201154
875 Ga0495656_0797348
876 Ga0495668_0000046
877 Ga0495668_0000403
878 Ga0495668_0001935
879 Ga0495668_0002614
880 Ga0495668_0004943
881 Ga0495668_0009076
882 Ga0495668_0042183
883 Ga0495668_0042701
884 Ga0495668_0050793
885 Ga0495668_0093761
886 Ga0495668_0394917
887 Ga0495611_0000827
888 Ga0495611_0002131
889 Ga0495611_0010663
890 Ga0495611_0037381
891 Ga0495611_0089706
892 Ga0495611_0128635
893 Ga0495611_0140626
894 Ga0495611_0381093
895 Ga0495611_0446997
896 Ga0495611_0495339
897 Ga0495625_0002125
898 Ga0495625_0013913
899 Ga0495625_0072766
900 Ga0495625_0212945
901 Ga0495625_0266467
902 Ga0495659_0000326
903 Ga0495659_0022912
904 Ga0495659_0067082
905 Ga0495659_0167805
906 Ga0495659_0447370
907 Ga0495661_0008669
908 Ga0495661_0010864
909 Ga0495661_0014975
910 Ga0495661_0034058
911 Ga0495661_0044039
912 Ga0495661_0054773
913 Ga0495661_0080496
914 Ga0495661_0231958
915 Ga0495661_0302494
916 Ga0495661_0441560
917 Ga0495661_0535195
918 Ga0495661_0578580
919 Ga0495588_0013885
920 Ga0495588_0099453
921 Ga0495588_0208021
922 Ga0495588_0268820
923 Ga0495588_0306025
924 Ga0495669_0184399
925 Ga0495669_0541604
926 Ga0495670_0002447
927 Ga0495670_0005268
928 Ga0495670_0005416
929 Ga0495670_0012273
930 Ga0495670_0025748
931 Ga0495670_0063509
932 Ga0495670_0071162
933 Ga0495670_0227497
934 Ga0495670_0267726
935 Ga0495671_0000009
936 Ga0495671_0001345
937 Ga0495671_0023994
938 Ga0495671_0031831
939 Ga0495671_0270341
940 Ga0495649_0216349
941 Ga0495649_0219011
942 Ga0495649_0383973
943 Ga0495589_0079406
944 Ga0495589_0192762
945 Ga0495589_0216303
946 Ga0495589_0270357
947 Ga0495600_0200688
948 Ga0495660_0000754
949 Ga0495660_0001185
950 Ga0495660_0004359
951 Ga0495660_0011659
952 Ga0495660_0052122
953 Ga0495660_0119862
954 Ga0495636_0000739
955 Ga0495636_0001315
956 Ga0495636_0010362
957 Ga0495636_0084432
958 Ga0495636_0085991
959 Ga0495636_0109786
960 Ga0495636_0218781
961 Ga0495674_0001246
962 Ga0495672_0000005
963 Ga0495672_0000161
964 Ga0495672_0000388
965 Ga0495672_0022397
966 Ga0495672_0037316
967 Ga0495672_0050113
968 Ga0495672_0076689
969 Ga0495672_0306222
970 Ga0495676_0011634
971 Ga0495676_0022365
972 Ga0495676_0047568
973 Ga0495683_0000145
974 Ga0495683_0027879
975 Ga0495683_0047463
976 Ga0495683_0067887
977 Ga0495687_010441
978 Ga0495687_044043
979 Ga0495677_0001439
980 Ga0495677_0003244
981 Ga0495677_0007802
982 Ga0495677_0016440
983 Ga0495677_0048777
984 Ga0495677_0083932
985 Ga0495677_0090099
986 Ga0495677_0188423
987 Ga0495679_010627
988 Ga0495679_015706
989 Ga0495685_000037
990 Ga0495685_037347
991 Ga0495685_067095
992 Ga0495673_0000032
993 Ga0495673_0000057
994 Ga0495673_0001230
995 Ga0495673_0009991
996 Ga0495673_0163419
997 Ga0495681_0024525
998 Ga0495681_0024988
999 Ga0495681_0040745
1000 Ga0495681_0071083
1001 Ga0495681_0136438
1002 Ga0495681_0382382
1003 Ga0495686_0003057
1004 Ga0495686_0006608
1005 Ga0495686_0009859
1006 Ga0495686_0089758
1007 Ga0495614_0549173
1008 Ga0495615_0037456
1009 Ga0495615_0067415
1010 Ga0495615_0080058
1011 Ga0495615_0171079
1012 Ga0495626_0007233
1013 Ga0495626_0010901
1014 Ga0495626_0013896
1015 Ga0495626_0025280
1016 Ga0495626_0026822
1017 Ga0496102_0000302
1018 Ga0496102_0041820
1019 Ga0496102_0081026
1020 Ga0496102_0139567
1021 Ga0496103_0032671
1022 Ga0496103_0412460
1023 Ga0496107_0896686
1024 Ga0496111_0015971
1025 Ga0496115_0037500
1026 Ga0496115_0059979
1027 Ga0496116_0020623
1028 Ga0496116_0061920
1029 Ga0496116_0349483
1030 Ga0496117_0000011
1031 Ga0496118_0000010
1032 Ga0496120_0063281
1033 Ga0496121_0004864
1034 Ga0496121_0017099
1035 Ga0496121_0231357
1036 Ga0496121_0860513
1037 Ga0496122_0039124
1038 Ga0496122_0268631
1039 Ga0496123_0012015
1040 Ga0496123_0024643
1041 Ga0496124_0020315
1042 Ga0496124_0061016
1043 Ga0496125_0077989
1044 Ga0496126_0008128
1045 Ga0496126_0659881
1046 Ga0496126_0892549
1047 Ga0501306_015929
1048 Ga0501306_076443
1049 Ga0501309_015976
1050 Ga0501309_028996
1051 Ga0501309_055477
1052 Ga0501310_000699
1053 Ga0501310_016498
1054 Ga0501305_036528
1055 Ga0495678_001813
1056 Ga0495678_002721
1057 Ga0495678_002938
1058 Ga0495678_052008
1059 Ga0495678_104263
1060 Ga0495682_0002730
1061 Ga0495682_0002992
1062 Ga0495682_0006986
1063 Ga0495682_0053337
1064 Ga0495682_0210807
1065 Ga0501292_098463
1066 Ga0501311_029140
1067 Ga0501312_024668
1068 Ga0501320_064210
1069 Ga0501323_045950
1070 Ga0501227_046977
1071 Ga0501227_084662
1072 Ga0501221_018066
1073 Ga0501221_036441
1074 Ga0501225_0115911
1075 Ga0501263_009166
1076 Ga0501275_056892
1077 Ga0501276_037550
1078 Ga0501279_004607
1079 Ga0500594_0000746
1080 Ga0500618_059774
1081 Ga0500618_066657
1082 2601669330
1083 2842712844
1084 2857549457
1085 2932414589
1086 2932420890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03544

TonB_C

Gram-negative bacterial TonB protein C-terminal

60

137

0.96

PF13103

TonB_2

TonB C terminal

57

129

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2grx-assembly2.cif.gz_D crystal structure of tonb in complex with fhua, e. coli outer membrane receptor for ferrichrome 0.8434 33 111
7zc8-assembly1.cif.gz_B crystal structure of the c-terminal domain of fusb, a tonb homologue 0.8334 33 111
6i97-assembly1.cif.gz_E structure of the ferrioxamine b transporter foxa from pseudomonas aeruginosa in complex with ferrioxamine b and a c-terminal tonb fragment 0.8219 22 111
2gsk-assembly1.cif.gz_B structure of the btub:tonb complex 0.819 24 111
1u07-assembly1.cif.gz_B crystal structure of the 92-residue c-term. part of tonb with significant structural changes compared to shorter fragments 0.8103 23 111
ID Description Score Start End Superfamily
af_P30855_519_685_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.845 50 65 3.30.450.20
2grxD00 Alpha Beta;2-Layer Sandwich;TolA/TonB C-terminal domain;TonB 0.8434 33 111 3.30.2420.10
1u07A00 Alpha Beta;2-Layer Sandwich;TolA/TonB C-terminal domain;TonB 0.8188 23 111 3.30.2420.10
2grxD00 Alpha Beta;2-Layer Sandwich;TolA/TonB C-terminal domain;TonB 0.7957 33 111 3.30.2420.10
1u07A00 Alpha Beta;2-Layer Sandwich;TolA/TonB C-terminal domain;TonB 0.7381 23 111 3.30.2420.10
ID Description Score Start End GO Terms
AF-A0A1I2QG81-F1-model_v4 Protein TonB 0.9602 22 111 GO:0015031
GO:0015891
GO:0030288
GO:0031992
GO:0055085
GO:0098797
AF-A0A4R7PDL4-F1-model_v4 Outer membrane transport energization protein TonB 0.9592 21 109 GO:0005886
GO:0015031
GO:0055085
AF-A0A4Q5XII9-F1-model_v4 Energy transducer TonB 0.9575 22 111 GO:0005886
GO:0015031
GO:0015891
GO:0030288
GO:0031992
GO:0055085
AF-A0A2E0AZW3-F1-model_v4 deleted 0.9574 22 110
AF-A0A850N888-F1-model_v4 deleted 0.9558 18 111

Map