F464877

General Info

Members Datasets Scaffolds Average Seq Length
570 485 286 260

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0142366|Ga0496122_0142366_30_935
Length 301
Sequence MFPTAGSRKQPRQVFDPPKGPGVASAAPVFSQTGDAHMSILSLQSLSLDYAEAGSRRKRRVLDGVNLHITSDEFVVVIGRSGSGKTSLLNIAAGFIEPSEGRVLVDGKEIDGPGVDRAVVFQDDALYPWLTAGGNVAFPLKLQGISKGERQRRAEELLVKVGLDGAGHKNIWELSGGMRQRVGIARALASGPRFLLLDEPLGALDALTRSRMQKFLLDVWAESKTGALLITHSIDEALLLATRIIVLAPNPGRIVADIKTEFGKALLEGRSVKEIKALTAFKHLHDELTALIHADEEEIAA

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
12 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
13 2512875024 Mesorhizobium loti R88b Isolate Nodule
14 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
15 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
16 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
17 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
18 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
19 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
20 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
21 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
22 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
23 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
24 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
25 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
26 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
27 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
28 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
29 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
30 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
31 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
32 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
33 2643221557 Ensifer sp. Root558 Isolate Unclassified
34 2643221568 Rhizobium sp. Root564 Isolate Unclassified
35 2643221607 Rhizobium sp. Root73 Isolate Unclassified
36 2643221610 Ensifer sp. Root74 Isolate Unclassified
37 2643221618 Ensifer sp. Root231 Isolate Unclassified
38 2643221626 Ensifer sp. Root31 Isolate Unclassified
39 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
40 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
41 2643221655 Ensifer sp. Root1252 Isolate Unclassified
42 2643221659 Ensifer sp. Root127 Isolate Unclassified
43 2643221668 Ensifer sp. Root423 Isolate Unclassified
44 2643221675 Ensifer sp. Root1298 Isolate Unclassified
45 2643221680 Ensifer sp. Root1312 Isolate Unclassified
46 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
47 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
48 2643221698 Ensifer sp. Root142 Isolate Unclassified
49 2643221712 Ensifer sp. Root258 Isolate Unclassified
50 2643221718 Rhizobium sp. Root268 Isolate Unclassified
51 2643221723 Ensifer sp. Root278 Isolate Unclassified
52 2643221726 Ensifer sp. Root954 Isolate Unclassified
53 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
54 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
55 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
56 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
57 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
58 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
59 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
60 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
61 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
62 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
63 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
64 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
65 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
66 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
67 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
68 2818991436 Collimonas arenae 515 Isolate Unclassified
69 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
70 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
71 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
72 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
73 2844163670 Ensifer sp. 1H6 Isolate Unclassified
74 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
75 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
76 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
77 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
78 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
79 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
80 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
81 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
82 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
83 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
84 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
85 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
86 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
87 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
88 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
89 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
90 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
91 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
92 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
93 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
94 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
95 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
96 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
97 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
98 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
99 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
100 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
101 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
102 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
103 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
104 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
105 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
106 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
107 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
108 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
109 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
110 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
111 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
112 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
113 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
114 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
115 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
116 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
117 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
118 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
119 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
120 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
121 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
122 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
123 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
124 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
125 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
126 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
127 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
128 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
129 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
130 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
131 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
132 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
133 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
134 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
135 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
136 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
137 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
138 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
139 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
140 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
141 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
142 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
143 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
144 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
145 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
146 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
147 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
148 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
149 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
150 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
151 2909042592 Labrys sp. LIt4 Isolate Nodule
152 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
153 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
154 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
155 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
156 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
157 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
158 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
159 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
160 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
161 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
162 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
163 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
164 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
165 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
166 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
167 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
168 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
169 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
170 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
171 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
172 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
173 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
174 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
175 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
176 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
177 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
178 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
179 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
180 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
181 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
182 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
183 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
184 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
185 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
186 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
187 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
188 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
189 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
190 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
191 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
192 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
193 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
194 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
195 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
196 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
197 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
198 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
199 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
200 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
201 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
202 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
203 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
204 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
205 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
206 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
207 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
208 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
209 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
210 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
211 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
212 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
213 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
214 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
215 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
216 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
217 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
218 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
219 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
220 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
221 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
222 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
223 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
224 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
225 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
226 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
227 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
228 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
229 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
230 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
231 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
232 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
233 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
234 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
235 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
236 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
237 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
238 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
239 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
240 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
241 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
242 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
243 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
244 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
245 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
246 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
247 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
248 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
249 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
250 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
251 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
252 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
253 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
254 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
255 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
256 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
257 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
258 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
259 3004167301 Mesorhizobium loti 582 Isolate Unclassified
260 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
261 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
262 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
263 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
264 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
265 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
266 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
267 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
268 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
269 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
270 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
271 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
272 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
273 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
274 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
275 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
276 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
277 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
278 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
279 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
280 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
281 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
282 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
283 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
284 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
285 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
286 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
287 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
288 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
289 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
290 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
291 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
292 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
293 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
294 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
295 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
296 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
297 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
298 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
299 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
300 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
301 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
302 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
303 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
304 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
305 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
306 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
307 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
308 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
309 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
310 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
311 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
312 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
313 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
314 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
315 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
316 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
317 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
318 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
319 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
320 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
321 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
322 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
323 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
324 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
325 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
326 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
327 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
328 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
329 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
330 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
331 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
332 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
333 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
334 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
335 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
336 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
337 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
338 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
343 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
344 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
345 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
346 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
349 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
350 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
351 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
353 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
354 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
355 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
357 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
358 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
359 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
361 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
362 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
381 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
384 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
385 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
386 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
387 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
388 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
389 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
390 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
391 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
392 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
393 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
394 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
395 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
396 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
397 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
398 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
399 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
400 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
401 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
402 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
403 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
404 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
405 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
406 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
407 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
408 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
409 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
410 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
411 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
412 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
413 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
414 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
415 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
416 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
417 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
418 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
419 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
420 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
421 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
422 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
423 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
424 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
425 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
426 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
427 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
428 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
429 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
430 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
431 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
432 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
433 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
434 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
435 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
436 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
437 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
438 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
439 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
440 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
441 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
442 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
443 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
444 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
445 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
446 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
447 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
448 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
449 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
450 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
451 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
454 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
455 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
456 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
457 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
458 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
459 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
460 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
461 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
462 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
463 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
464 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
465 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
466 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
467 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
468 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
469 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
470 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
471 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
472 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
473 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
474 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
475 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
476 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
477 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
478 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
479 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
480 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
481 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
482 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
483 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
484 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
485 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.18
Metatranscriptomes 0
Isolates 49.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 18.77
Nodule 34.56
Rhizoplane 2.11
Rhizosphere 28.25
Stem 0
Stem Tuber 0
Unclassified 16.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000229 3300002737 Bacteria 57303
2 JGI25157J39369_1003828 3300002741 Bacteria 2933
3 JGI25152J39213_1003426 3300002773 Bacteria 5422
4 JGI25150J39212_1001197 3300002774 Bacteria 7688
5 JGI25159J45721_1000563 3300002987 Bacteria 16655
6 JGI25159J45721_1006968 3300002987 Bacteria 3303
7 JGI25151J46595_10003579 3300003187 Bacteria 8518
8 JGI25165J46597_1000001 3300003214 Bacteria 1111887
9 JGI25153J46596_10006515 3300003215 Bacteria 5891
10 JGI25153J46596_10007864 3300003215 Bacteria 5175
11 JGI25160J50197_1000090 3300003354 Bacteria 90580
12 JGI25160J50197_1000820 3300003354 Bacteria 16655
13 JGI25160J50197_1008401 3300003354 Bacteria 3938
14 JGI25161J50226_1000289 3300003374 Bacteria 28340
15 Ga0055538_1000001 3300003751 Bacteria 1111887
16 Ga0055539_1000001 3300003752 Bacteria 1111887
17 Ga0055533_1000003 3300003756 Bacteria 1111887
18 Ga0055525_1000087 3300003759 Bacteria 149803
19 Ga0055542_1001704 3300003762 Bacteria 9531
20 Ga0055526_1001598 3300003771 Bacteria 15895
21 Ga0055524_1000085 3300003775 Bacteria 117478
22 Ga0055524_1002668 3300003775 Bacteria 9035
23 Ga0055524_1012961 3300003775 Bacteria 3171
24 Ga0055536_1001086 3300003781 Bacteria 17117
25 Ga0055528_1004598 3300003790 Bacteria 6610
26 Ga0055530_10002759 3300003791 Bacteria 10867
27 Ga0055530_10005779 3300003791 Bacteria 5745
28 Ga0055540_1000056 3300003792 Bacteria 139732
29 Ga0055531_10011299 3300003794 Bacteria 4326
30 Ga0055531_10016501 3300003794 Bacteria 3181
31 Ga0055541_1000001 3300003841 Bacteria 1111887
32 Ga0058692_1000080 3300003856 Bacteria 69934
33 Ga0058692_1005997 3300003856 Bacteria 3390
34 Ga0055543_1000023 3300004625 Bacteria 140513
35 Ga0055543_1000727 3300004625 Bacteria 16693
36 Ga0065165_1000928 3300005262 Bacteria 37588
37 Ga0065165_1002311 3300005262 Bacteria 16693
38 Ga0065703_1000148 3300005272 Bacteria 14580
39 Ga0065704_10086313 3300005289 Bacteria 3100
40 Ga0065704_10119407 3300005289 Bacteria 1800
41 Ga0070676_10225817 3300005328 Bacteria 1239
42 Ga0070682_100315208 3300005337 Bacteria 1153
43 Ga0070669_100114478 3300005353 Bacteria 2051
44 Ga0070674_100313083 3300005356 Bacteria 1256
45 Ga0070673_100741251 3300005364 Bacteria 904
46 Ga0068853_100011643 3300005539 Bacteria 7149
47 Ga0068853_100254691 3300005539 Bacteria 1612
48 Ga0070665_100354961 3300005548 Bacteria 1472
49 Ga0070665_100452476 3300005548 Bacteria 1293
50 Ga0068855_100296495 3300005563 Bacteria 1791
51 Ga0068856_100317014 3300005614 Bacteria 1577
52 Ga0068852_100491747 3300005616 Bacteria 1220
53 Ga0075365_10043686 3300006038 Bacteria 2934
54 Ga0075365_10067848 3300006038 Bacteria 2395
55 Ga0075363_100130574 3300006048 Bacteria 1409
56 Ga0075364_10064433 3300006051 Bacteria 2405
57 Ga0075362_10026824 3300006177 Bacteria 2463
58 Ga0075367_10067180 3300006178 Bacteria 2149
59 Ga0075367_10074073 3300006178 Bacteria 2053
60 Ga0075369_10162316 3300006186 Bacteria 1024
61 Ga0075370_10031152 3300006353 Bacteria 2977
62 Ga0075370_10159895 3300006353 Bacteria 1322
63 Ga0079104_1000073 3300006946 Bacteria 152269
64 Ga0105251_10080393 3300009011 Bacteria 1507
65 Ga0105251_10080404 3300009011 Bacteria 1507
66 Ga0105244_10032708 3300009036 Bacteria 2750
67 Ga0105244_10068966 3300009036 Bacteria 1766
68 Ga0105250_10022169 3300009092 Bacteria 2562
69 Ga0105240_10010228 3300009093 Bacteria 13204
70 Ga0105240_10542272 3300009093 Bacteria 1288
71 Ga0105247_10000120 3300009101 Bacteria 76928
72 Ga0105243_10000005 3300009148 Bacteria 576265
73 Ga0105243_10203139 3300009148 Bacteria 1739
74 Ga0105241_10083379 3300009174 Bacteria 2508
75 Ga0105241_10118234 3300009174 Bacteria 2131
76 Ga0105241_10771355 3300009174 Bacteria 883
77 Ga0105237_10002251 3300009545 Bacteria 24020
78 Ga0105237_10120666 3300009545 Bacteria 2616
79 Ga0105237_10257163 3300009545 Bacteria 1748
80 Ga0105238_10005845 3300009551 Bacteria 12183
81 Ga0105238_10048642 3300009551 Bacteria 4272
82 Ga0105238_10228772 3300009551 Bacteria 1836
83 Ga0105238_10291236 3300009551 Bacteria 1615
84 Ga0105239_10002342 3300010375 Bacteria 24158
85 Ga0105239_10187910 3300010375 Bacteria 2312
86 Ga0157370_10357776 3300013104 Bacteria 1345
87 Ga0157369_10037593 3300013105 Bacteria 5300
88 Ga0157369_10234699 3300013105 Bacteria 1917
89 Ga0171463_1016 3300013249 Bacteria 62129
90 Ga0157372_10334580 3300013307 Bacteria 1763
91 Ga0182008_10197887 3300014497 Bacteria 1022
92 Ga0182007_10009888 3300015262 Bacteria 3803
93 Ga0182007_10027194 3300015262 Bacteria 1975
94 Ga0182007_10030890 3300015262 Bacteria 1828
95 Ga0182005_1001910 3300015265 Bacteria 7895
96 Ga0182005_1021616 3300015265 Bacteria 1764
97 Ga0183363_1267 3300015690 Bacteria 8408
98 Ga0163161_10063114 3300017792 Bacteria 2700
99 Ga0163161_10181444 3300017792 Bacteria 1614
100 Ga0209760_100821 3300025207 Bacteria 4169
101 Ga0209436_100712 3300025208 Bacteria 13940
102 Ga0209784_100004 3300025224 Bacteria 1378156
103 Ga0209566_100004 3300025225 Bacteria 1531866
104 Ga0209674_100006 3300025226 Bacteria 1531866
105 Ga0209563_100009 3300025230 Bacteria 1378156
106 Ga0207427_100838 3300025231 Bacteria 13730
107 Ga0209437_100004 3300025233 Bacteria 1378156
108 Ga0207425_1000968 3300025245 Bacteria 13512
109 Ga0209026_1000141 3300025250 Bacteria 114545
110 Ga0209677_100005 3300025253 Bacteria 1378156
111 Ga0209677_111851 3300025253 Bacteria 1333
112 Ga0209148_1000111 3300025254 Bacteria 198095
113 Ga0209759_1000354 3300025256 Bacteria 59742
114 Ga0209129_1003607 3300025258 Bacteria 6618
115 Ga0209129_1006383 3300025258 Bacteria 3829
116 Ga0209233_1000005 3300025261 Bacteria 1531866
117 Ga0209455_1000206 3300025272 Bacteria 84430
118 Ga0209673_1023028 3300025273 Bacteria 2132
119 Ga0209673_1027416 3300025273 Bacteria 1853
120 Ga0209130_1000031 3300025284 Bacteria 322932
121 Ga0209130_1001334 3300025284 Bacteria 16707
122 Ga0209130_1014584 3300025284 Bacteria 1966
123 Ga0209675_1010838 3300025291 Bacteria 3073
124 Ga0209676_1001434 3300025292 Bacteria 22507
125 Ga0209025_1000121 3300025294 Bacteria 208700
126 Ga0209025_1005690 3300025294 Bacteria 10037
127 Ga0209025_1007351 3300025294 Bacteria 8243
128 Ga0209564_1000081 3300025295 Bacteria 261592
129 Ga0209564_1000826 3300025295 Bacteria 42101
130 Ga0209758_1011158 3300025297 Bacteria 5246
131 Ga0209758_1011779 3300025297 Bacteria 5009
132 Ga0209050_1000852 3300025298 Bacteria 41567
133 Ga0209050_1001503 3300025298 Bacteria 24644
134 Ga0209050_1014056 3300025298 Bacteria 3487
135 Ga0209256_1000036 3300025299 Bacteria 386664
136 Ga0209256_1000639 3300025299 Bacteria 47642
137 Ga0209256_1003364 3300025299 Bacteria 11321
138 Ga0207426_1000042 3300025302 Bacteria 433289
139 Ga0207426_1000110 3300025302 Bacteria 235630
140 Ga0207426_1001728 3300025302 Bacteria 16707
141 Ga0209051_1000068 3300025303 Bacteria 220063
142 Ga0209051_1013148 3300025303 Bacteria 3956
143 Ga0209257_1000146 3300025304 Bacteria 194261
144 Ga0209257_1001851 3300025304 Bacteria 23010
145 Ga0207696_1001751 3300025711 Bacteria 11233
146 Ga0207696_1004755 3300025711 Bacteria 5780
147 Ga0207655_1000736 3300025728 Bacteria 36944
148 Ga0207655_1000892 3300025728 Bacteria 31381
149 Ga0207713_1021840 3300025735 Bacteria 3058
150 Ga0207710_10000160 3300025900 Bacteria 71411
151 Ga0207647_10043176 3300025904 Bacteria 2822
152 Ga0207705_10238260 3300025909 Bacteria 1385
153 Ga0207654_10506708 3300025911 Bacteria 853
154 Ga0207695_10017107 3300025913 Bacteria 8454
155 Ga0207671_10012208 3300025914 Bacteria 6927
156 Ga0207671_10056487 3300025914 Bacteria 2909
157 Ga0207671_10382043 3300025914 Bacteria 1119
158 Ga0207681_10287162 3300025923 Bacteria 1297
159 Ga0207694_10049985 3300025924 Bacteria 3237
160 Ga0207694_10083243 3300025924 Bacteria 2515
161 Ga0207690_10401466 3300025932 Bacteria 1093
162 Ga0207709_10000001 3300025935 Bacteria 2228154
163 Ga0207667_10645174 3300025949 Bacteria 1065
164 Ga0207640_10491905 3300025981 Bacteria 1020
165 Ga0207639_10032301 3300026041 Bacteria 3852
166 Ga0207639_10895526 3300026041 Bacteria 829
167 Ga0209281_1000263 3300027111 Bacteria 101190
168 Ga0209371_1000006 3300027312 Bacteria 1055642
169 Ga0268266_10340628 3300028379 Bacteria 1407
170 Ga0307515_10022779 3300028794 Bacteria 11022
171 Ga0307515_10024806 3300028794 Bacteria 10418
172 Ga0307515_10152500 3300028794 Bacteria 2407
173 Ga0268256_1000007 3300030500 Bacteria 1055326
174 Ga0307513_10003256 3300031456 Bacteria 22138
175 Ga0307513_10024760 3300031456 Bacteria 6977
176 Ga0307514_10154346 3300031649 Bacteria 1534
177 Ga0373931_0289508 3300035691 Bacteria 1008
178 Ga0395899_0047144 3300037312 Bacteria 3209
179 Ga0395900_0000021 3300037418 Bacteria 351144
180 Ga0395900_0096725 3300037418 Bacteria 3034
181 Ga0395898_0002409 3300037466 Bacteria 22197
182 Ga0395905_0000020 3300037471 Bacteria 337672
183 Ga0395905_0000912 3300037471 Bacteria 38176
184 Ga0395905_0025305 3300037471 Bacteria 5597
185 Ga0395901_0014520 3300038443 Bacteria 8009
186 Ga0439465_0055235 3300041413 Bacteria 1307
187 Ga0466972_0018590 3300044658 Bacteria 3476
188 Ga0466960_0095649 3300044901 Bacteria 1521
189 Ga0495592_0003858 3300046454 Bacteria 10846
190 Ga0495603_0004048 3300046455 Bacteria 8724
191 Ga0495590_0028043 3300046457 Bacteria 1975
192 Ga0495638_0014130 3300046460 Bacteria 5406
193 Ga0495638_0024332 3300046460 Bacteria 3949
194 Ga0495653_0002613 3300046463 Bacteria 14327
195 Ga0495580_0001843 3300046472 Bacteria 18644
196 Ga0495583_0022612 3300046506 Bacteria 3202
197 Ga0495606_0090672 3300046507 Bacteria 1881
198 Ga0495608_0094892 3300046511 Bacteria 1927
199 Ga0495616_0131552 3300046513 Bacteria 1146
200 Ga0495618_0022216 3300046514 Bacteria 3917
201 Ga0495628_0054210 3300046516 Bacteria 3161
202 Ga0495643_0052753 3300046522 Bacteria 2182
203 Ga0495652_0023079 3300046529 Bacteria 5517
204 Ga0495652_0023215 3300046529 Bacteria 5499
205 Ga0495645_0005361 3300046543 Bacteria 8792
206 Ga0495622_0164810 3300046557 Bacteria 998
207 Ga0495668_0200198 3300046616 Bacteria 1093
208 Ga0495625_0054747 3300046660 Bacteria 2848
209 Ga0495625_0187317 3300046660 Bacteria 1373
210 Ga0495635_0041791 3300046663 Bacteria 3167
211 Ga0495599_0002568 3300046678 Bacteria 10575
212 Ga0495623_0073954 3300046679 Bacteria 2118
213 Ga0495646_0024141 3300046680 Bacteria 3829
214 Ga0495669_0189191 3300046684 Bacteria 982
215 Ga0495624_0004153 3300046690 Bacteria 10646
216 Ga0495671_0122564 3300046692 Bacteria 1268
217 Ga0495649_0029090 3300046694 Bacteria 3060
218 Ga0495589_0072572 3300046794 Bacteria 1681
219 Ga0495600_0000986 3300046809 Bacteria 15332
220 Ga0495604_0020795 3300047317 Bacteria 5240
221 Ga0495674_0030964 3300047319 Bacteria 4862
222 Ga0495687_008698 3300047443 Bacteria 5772
223 Ga0495686_0130672 3300047472 Bacteria 1489
224 Ga0495602_0022089 3300048088 Bacteria 6234
225 Ga0496100_0033872 3300048903 Bacteria 3199
226 Ga0496102_0339687 3300048905 Bacteria 1414
227 Ga0496104_0019055 3300048907 Bacteria 6270
228 Ga0496105_0079079 3300048908 Bacteria 2715
229 Ga0496106_0000401 3300048909 Bacteria 30792
230 Ga0496110_0313849 3300048913 Bacteria 1428
231 Ga0496112_0002887 3300048915 Bacteria 13988
232 Ga0496112_0015340 3300048915 Bacteria 7145
233 Ga0496114_0043549 3300048917 Bacteria 3722
234 Ga0496115_0259915 3300048918 Bacteria 1428
235 Ga0496116_0000233 3300048919 Bacteria 102081
236 Ga0496117_0001463 3300048920 Bacteria 34016
237 Ga0496118_0036064 3300048921 Bacteria 4004
238 Ga0496119_0143962 3300048922 Bacteria 1284
239 Ga0496120_0002869 3300048923 Bacteria 16553
240 Ga0496121_0007775 3300048924 Bacteria 12839
241 Ga0496121_0071759 3300048924 Bacteria 2783
242 Ga0496121_0153919 3300048924 Bacteria 1689
243 Ga0496121_0274687 3300048924 Bacteria 1156
244 Ga0496121_0296939 3300048924 Bacteria 1098
245 Ga0496122_0001329 3300048925 Bacteria 40484
246 Ga0496122_0008279 3300048925 Bacteria 11277
247 Ga0496122_0117378 3300048925 Bacteria 1728
248 Ga0496122_0142366 3300048925 Bacteria 1497
249 Ga0496123_0000018 3300048926 Bacteria 404553
250 Ga0496123_0061037 3300048926 Bacteria 2426
251 Ga0496124_0000940 3300048927 Bacteria 46669
252 Ga0496124_0070672 3300048927 Bacteria 2895
253 Ga0496124_0133467 3300048927 Bacteria 1969
254 Ga0496124_0259439 3300048927 Bacteria 1280
255 Ga0496125_0000161 3300048928 Bacteria 150707
256 Ga0496125_0000221 3300048928 Bacteria 116650
257 Ga0496125_0127500 3300048928 Bacteria 1800
258 Ga0496125_0135662 3300048928 Bacteria 1722
259 Ga0496126_0000212 3300048929 Bacteria 128871
260 Ga0496126_0001037 3300048929 Bacteria 46997
261 Ga0495678_063879 3300049459 Bacteria 1373
262 Ga0495682_0019767 3300049460 Bacteria 2530
263 Ga0501032_0154480 3300049569 Bacteria 1508
264 Ga0501043_0113091 3300049579 Bacteria 2132
265 Ga0501083_0037673 3300049744 Bacteria 3292
266 nmdc:mga00v17_244926_c1 3300050491 Bacteria 1162
267 nmdc:mga00v17_36310_c1 3300050491 Bacteria 2936
268 nmdc:mga04h51_116066_c1 3300050495 Bacteria 992
269 nmdc:mga0sz30_10544_c1 3300050516 Bacteria 2399
270 Ga0495601_0029102 3300053077 Bacteria 3424
271 Ga0500610_0075848 3300053079 Bacteria 1753
272 Ga0500644_0113422 3300053088 Bacteria 1047
273 Ga0500572_002031 3300053111 Bacteria 5040
274 Ga0500595_000833 3300053119 Bacteria 17648
275 Ga0500559_0007036 3300053136 Bacteria 5025
276 Ga0500568_0015840 3300053139 Bacteria 3364
277 Ga0500568_0043291 3300053139 Bacteria 1800
278 Ga0500574_000930 3300053141 Bacteria 4063
279 Ga0500616_0077579 3300053153 Bacteria 1677
280 Ga0500619_000066 3300053154 Bacteria 31862
281 Ga0500620_007038 3300053155 Bacteria 2748
282 Ga0500622_0000343 3300053156 Bacteria 45668
283 Ga0500622_0004607 3300053156 Bacteria 8558
284 Ga0500627_0218207 3300053158 Bacteria 851
285 Ga0500633_0007428 3300053160 Bacteria 2759
286 Ga0500636_0001782 3300053177 Bacteria 11796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053136 Ga0500559_0007036 Ga0500559_0007036_208_978 237
2 3300003775 Ga0055524_1000085 Ga0055524_100008544 240
3 3300025291 Ga0209675_1010838 Ga0209675_10108382 240
4 3300025298 Ga0209050_1014056 Ga0209050_10140562 240
5 3300025299 Ga0209256_1000036 Ga0209256_100003688 240
6 3300048917 Ga0496114_0043549 Ga0496114_0043549_143_922 240
7 3300046692 Ga0495671_0122564 Ga0495671_0122564_525_1250 241
8 3300053088 Ga0500644_0113422 Ga0500644_0113422_260_985 241
9 iso_pu_bacteria 2874123672 2874126291 247
10 iso_pu_bacteria 2841734538 2841736552 250
11 iso_pu_bacteria 2871474448 2871478538 250
12 iso_pu_bacteria 2878788777 2878792914 250
13 iso_pu_bacteria 2924762789 2924768711 250
14 iso_pu_bacteria 2937836603 2937838873 250
15 iso_pu_bacteria 2937848649 2937852718 250
16 iso_pu_bacteria 2939669807 2939671942 250
17 iso_pu_bacteria 2958071322 2958072330 250
18 iso_pu_bacteria 2977922695 2977924743 250
19 iso_pu_bacteria 2979793036 2979797134 250
20 iso_pu_bacteria 2987666974 2987667129 250
21 iso_pu_bacteria 3000376612 3000377343 250
22 iso_pu_bacteria 3004211236 3004218534 250
23 iso_pu_bacteria 3004218560 3004223620 250
24 iso_pu_bacteria 8004633249 8004638939 250
25 iso_pu_bacteria 2508501123 2509117910 251
26 iso_pu_bacteria 2509276022 2509393695 251
27 iso_pu_bacteria 2511231027 2511389560 251
28 iso_pu_bacteria 2512875016 2512933723 251
29 iso_pu_bacteria 2512875024 2512961888 251
30 iso_pu_bacteria 2513237164 2514035444 251
31 iso_pu_bacteria 2513237305 2514421956 251
32 iso_pu_bacteria 2588253730 2588519806 251
33 iso_pu_bacteria 2599185301 2599938862 251
34 iso_pu_bacteria 2693429784 2694636825 251
35 iso_pu_bacteria 2721755686 2723573294 251
36 iso_pu_bacteria 2775506902 2776269683 251
37 iso_pu_bacteria 2775506904 2776282612 251
38 iso_pu_bacteria 2842871566 2842872623 251
39 iso_pu_bacteria 2856320880 2856324071 251
40 iso_pu_bacteria 2856364286 2856367387 251
41 iso_pu_bacteria 2857349434 2857353096 251
42 iso_pu_bacteria 2869278585 2869282404 251
43 iso_pu_bacteria 2869285874 2869288528 251
44 iso_pu_bacteria 2871429161 2871431195 251
45 iso_pu_bacteria 2871495908 2871498817 251
46 iso_pu_bacteria 2874139085 2874142765 251
47 iso_pu_bacteria 2874146452 2874150570 251
48 iso_pu_bacteria 2874155637 2874158310 251
49 iso_pu_bacteria 2874168670 2874170526 251
50 iso_pu_bacteria 2876363079 2876364022 251
51 iso_pu_bacteria 2876392853 2876399058 251
52 iso_pu_bacteria 2876413966 2876416618 251
53 iso_pu_bacteria 2878738818 2878739795 251
54 iso_pu_bacteria 2878745973 2878747799 251
55 iso_pu_bacteria 2878760144 2878763035 251
56 iso_pu_bacteria 2878767105 2878770005 251
57 iso_pu_bacteria 2881147464 2881148371 251
58 iso_pu_bacteria 2881155292 2881158315 251
59 iso_pu_bacteria 2881853255 2881853750 251
60 iso_pu_bacteria 2882632389 2882635235 251
61 iso_pu_bacteria 2885305155 2885307033 251
62 iso_pu_bacteria 2885326080 2885329030 251
63 iso_pu_bacteria 2885334103 2885339785 251
64 iso_pu_bacteria 2885350715 2885357492 251
65 iso_pu_bacteria 2888337043 2888343546 251
66 iso_pu_bacteria 2888350351 2888353370 251
67 iso_pu_bacteria 2889010040 2889015086 251
68 iso_pu_bacteria 2889016732 2889019839 251
69 iso_pu_bacteria 2903448605 2903453879 251
70 iso_pu_bacteria 2903492973 2903502280 251
71 iso_pu_bacteria 2903521522 2903525819 251
72 iso_pu_bacteria 2903528002 2903532635 251
73 iso_pu_bacteria 2903540706 2903543619 251
74 iso_pu_bacteria 2904659560 2904665585 251
75 iso_pu_bacteria 2906308376 2906310972 251
76 iso_pu_bacteria 2906321335 2906323083 251
77 iso_pu_bacteria 2906354277 2906354911 251
78 iso_pu_bacteria 2909042592 2909043436 251
79 iso_pu_bacteria 2922130491 2922137750 251
80 iso_pu_bacteria 2922185730 2922192794 251
81 iso_pu_bacteria 2924718760 2924719078 251
82 iso_pu_bacteria 2924776078 2924777416 251
83 iso_pu_bacteria 2937813078 2937815511 251
84 iso_pu_bacteria 2937877337 2937880435 251
85 iso_pu_bacteria 2937972304 2937975767 251
86 iso_pu_bacteria 2937994558 2937997465 251
87 iso_pu_bacteria 2938014810 2938020423 251
88 iso_pu_bacteria 2958034702 2958038262 251
89 iso_pu_bacteria 2958041894 2958050988 251
90 iso_pu_bacteria 2958084443 2958087570 251
91 iso_pu_bacteria 2958100919 2958105006 251
92 iso_pu_bacteria 2958115193 2958116254 251
93 iso_pu_bacteria 2958130278 2958132930 251
94 iso_pu_bacteria 2958165035 2958167939 251
95 iso_pu_bacteria 2958172287 2958178342 251
96 iso_pu_bacteria 2958179912 2958182632 251
97 iso_pu_bacteria 2961077736 2961080480 251
98 iso_pu_bacteria 2961114664 2961120928 251
99 iso_pu_bacteria 2961163497 2961166407 251
100 iso_pu_bacteria 2963644680 2963645480 251
101 iso_pu_bacteria 2965018300 2965021226 251
102 iso_pu_bacteria 2965119406 2965125535 251
103 iso_pu_bacteria 2968016561 2968017402 251
104 iso_pu_bacteria 2968083720 2968085189 251
105 iso_pu_bacteria 2968110612 2968117078 251
106 iso_pu_bacteria 2968117919 2968122498 251
107 iso_pu_bacteria 2968171901 2968174808 251
108 iso_pu_bacteria 2970469710 2970472446 251
109 iso_pu_bacteria 2970554993 2970557890 251
110 iso_pu_bacteria 2970593180 2970597013 251
111 iso_pu_bacteria 2977843712 2977846724 251
112 iso_pu_bacteria 2977864932 2977869312 251
113 iso_pu_bacteria 2977942078 2977945554 251
114 iso_pu_bacteria 2979710463 2979715332 251
115 iso_pu_bacteria 2979742915 2979751256 251
116 iso_pu_bacteria 2987636660 2987641688 251
117 iso_pu_bacteria 2987652177 2987653927 251
118 iso_pu_bacteria 2987659509 2987662415 251
119 iso_pu_bacteria 2996310559 2996314975 251
120 iso_pu_bacteria 2996348954 2996349856 251
121 iso_pu_bacteria 3000135777 3000137547 251
122 iso_pu_bacteria 3002141150 3002141572 251
123 iso_pu_bacteria 3004188549 3004191466 251
124 iso_pu_bacteria 3004203850 3004209500 251
125 iso_pu_bacteria 3004275668 3004276558 251
126 iso_pu_bacteria 3004289098 3004293640 251
127 iso_pu_bacteria 3004334049 3004337081 251
128 iso_pu_bacteria 637000159 637076835 251
129 iso_pu_bacteria 8002285264 8002287304 251
130 iso_pu_bacteria 8004387939 8004390497 251
131 iso_pu_bacteria 8004445564 8004448771 251
132 iso_pu_bacteria 8004640170 8004641863 251
133 iso_pu_bacteria 8004703790 8004704750 251
134 iso_pu_bacteria 8004714634 8004717189 251
135 3300003762 Ga0055542_1001704 Ga0055542_10017045 252
136 3300005328 Ga0070676_10225817 Ga0070676_102258171 252
137 3300005356 Ga0070674_100313083 Ga0070674_1003130832 252
138 3300005364 Ga0070673_100741251 Ga0070673_1007412511 252
139 3300006177 Ga0075362_10026824 Ga0075362_100268242 252
140 3300006186 Ga0075369_10162316 Ga0075369_101623161 252
141 3300014497 Ga0182008_10197887 Ga0182008_101978872 252
142 3300015265 Ga0182005_1021616 Ga0182005_10216161 252
143 3300025253 Ga0209677_111851 Ga0209677_1118512 252
144 3300025254 Ga0209148_1000111 Ga0209148_100011142 252
145 3300025272 Ga0209455_1000206 Ga0209455_100020641 252
146 3300044658 Ga0466972_0018590 Ga0466972_0018590_571_1341 252
147 3300046507 Ga0495606_0090672 Ga0495606_0090672_599_1366 252
148 3300046616 Ga0495668_0200198 Ga0495668_0200198_298_1065 252
149 3300046660 Ga0495625_0054747 Ga0495625_0054747_1155_1922 252
150 3300050491 nmdc:mga00v17_244926_c1 nmdc:mga00v17_244926_c1_164_931 252
151 3300053079 Ga0500610_0075848 Ga0500610_0075848_954_1721 252
152 3300053155 Ga0500620_007038 Ga0500620_007038_542_1309 252
153 3300053158 Ga0500627_0218207 Ga0500627_0218207_10_777 252
154 iso_pu_bacteria 2501025502 2501078026 252
155 iso_pu_bacteria 2738543031 2739350914 252
156 iso_pu_bacteria 2960624210 2960630353 252
157 3300002741 JGI25157J39369_1003828 JGI25157J39369_10038284 253
158 3300003791 Ga0055530_10002759 Ga0055530_1000275911 253
159 3300003791 Ga0055530_10005779 Ga0055530_100057796 253
160 3300003792 Ga0055540_1000056 Ga0055540_100005683 253
161 3300003794 Ga0055531_10011299 Ga0055531_100112992 253
162 3300005539 Ga0068853_100011643 Ga0068853_1000116435 253
163 3300005548 Ga0070665_100354961 Ga0070665_1003549612 253
164 3300005548 Ga0070665_100452476 Ga0070665_1004524762 253
165 3300005563 Ga0068855_100296495 Ga0068855_1002964952 253
166 3300005614 Ga0068856_100317014 Ga0068856_1003170142 253
167 3300005616 Ga0068852_100491747 Ga0068852_1004917472 253
168 3300006038 Ga0075365_10043686 Ga0075365_100436863 253
169 3300006038 Ga0075365_10067848 Ga0075365_100678483 253
170 3300006048 Ga0075363_100130574 Ga0075363_1001305742 253
171 3300006051 Ga0075364_10064433 Ga0075364_100644333 253
172 3300006178 Ga0075367_10067180 Ga0075367_100671802 253
173 3300006353 Ga0075370_10031152 Ga0075370_100311523 253
174 3300006353 Ga0075370_10159895 Ga0075370_101598952 253
175 3300006946 Ga0079104_1000073 Ga0079104_100007355 253
176 3300009093 Ga0105240_10542272 Ga0105240_105422722 253
177 3300009148 Ga0105243_10203139 Ga0105243_102031392 253
178 3300009174 Ga0105241_10118234 Ga0105241_101182342 253
179 3300009174 Ga0105241_10771355 Ga0105241_107713551 253
180 3300009545 Ga0105237_10120666 Ga0105237_101206663 253
181 3300009545 Ga0105237_10257163 Ga0105237_102571632 253
182 3300009551 Ga0105238_10048642 Ga0105238_100486422 253
183 3300009551 Ga0105238_10228772 Ga0105238_102287722 253
184 3300009551 Ga0105238_10291236 Ga0105238_102912362 253
185 3300010375 Ga0105239_10187910 Ga0105239_101879102 253
186 3300013104 Ga0157370_10357776 Ga0157370_103577762 253
187 3300013105 Ga0157369_10234699 Ga0157369_102346992 253
188 3300013307 Ga0157372_10334580 Ga0157372_103345802 253
189 3300015262 Ga0182007_10030890 Ga0182007_100308902 253
190 3300025250 Ga0209026_1000141 Ga0209026_100014191 253
191 3300025256 Ga0209759_1000354 Ga0209759_100035432 253
192 3300025298 Ga0209050_1001503 Ga0209050_100150321 253
193 3300025303 Ga0209051_1000068 Ga0209051_1000068122 253
194 3300025304 Ga0209257_1000146 Ga0209257_100014696 253
195 3300025904 Ga0207647_10043176 Ga0207647_100431763 253
196 3300025909 Ga0207705_10238260 Ga0207705_102382602 253
197 3300025911 Ga0207654_10506708 Ga0207654_105067081 253
198 3300025914 Ga0207671_10056487 Ga0207671_100564872 253
199 3300025914 Ga0207671_10382043 Ga0207671_103820432 253
200 3300025924 Ga0207694_10049985 Ga0207694_100499856 253
201 3300025932 Ga0207690_10401466 Ga0207690_104014662 253
202 3300025949 Ga0207667_10645174 Ga0207667_106451741 253
203 3300025981 Ga0207640_10491905 Ga0207640_104919052 253
204 3300026041 Ga0207639_10895526 Ga0207639_108955261 253
205 3300027111 Ga0209281_1000263 Ga0209281_100026355 253
206 3300028379 Ga0268266_10340628 Ga0268266_103406282 253
207 3300035691 Ga0373931_0289508 Ga0373931_0289508_87_860 253
208 3300037312 Ga0395899_0047144 Ga0395899_0047144_980_1753 253
209 3300037418 Ga0395900_0000021 Ga0395900_0000021_42194_42967 253
210 3300037418 Ga0395900_0096725 Ga0395900_0096725_75_848 253
211 3300037466 Ga0395898_0002409 Ga0395898_0002409_17627_18400 253
212 3300037471 Ga0395905_0000912 Ga0395905_0000912_24044_24817 253
213 3300037471 Ga0395905_0025305 Ga0395905_0025305_3489_4262 253
214 3300038443 Ga0395901_0014520 Ga0395901_0014520_3277_4050 253
215 3300044901 Ga0466960_0095649 Ga0466960_0095649_31_804 253
216 3300047472 Ga0495686_0130672 Ga0495686_0130672_162_935 253
217 3300048905 Ga0496102_0339687 Ga0496102_0339687_49_837 253
218 3300048915 Ga0496112_0015340 Ga0496112_0015340_5623_6396 253
219 3300048918 Ga0496115_0259915 Ga0496115_0259915_103_876 253
220 3300048921 Ga0496118_0036064 Ga0496118_0036064_1487_2260 253
221 3300048922 Ga0496119_0143962 Ga0496119_0143962_499_1272 253
222 3300048923 Ga0496120_0002869 Ga0496120_0002869_15376_16164 253
223 3300048925 Ga0496122_0008279 Ga0496122_0008279_5688_6476 253
224 3300048928 Ga0496125_0127500 Ga0496125_0127500_823_1596 253
225 3300048928 Ga0496125_0135662 Ga0496125_0135662_78_866 253
226 3300050491 nmdc:mga00v17_36310_c1 nmdc:mga00v17_36310_c1_1836_2609 253
227 3300050495 nmdc:mga04h51_116066_c1 nmdc:mga04h51_116066_c1_177_950 253
228 3300050516 nmdc:mga0sz30_10544_c1 nmdc:mga0sz30_10544_c1_60_872 253
229 3300053153 Ga0500616_0077579 Ga0500616_0077579_753_1526 253
230 iso_pu_bacteria 2503198000 2503198882 253
231 iso_pu_bacteria 2509276018 2509368892 253
232 iso_pu_bacteria 2510065059 2510315220 253
233 iso_pu_bacteria 2510917013 2511092012 253
234 iso_pu_bacteria 2510917030 2511195216 253
235 iso_pu_bacteria 2562617112 2563058227 253
236 iso_pu_bacteria 2582581298 2585222313 253
237 iso_pu_bacteria 2585427529 2585544734 253
238 iso_pu_bacteria 2599185352 2600197116 253
239 iso_pu_bacteria 2643221557 2643804839 253
240 iso_pu_bacteria 2643221610 2644067378 253
241 iso_pu_bacteria 2643221668 2644378856 253
242 iso_pu_bacteria 2643221675 2644418466 253
243 iso_pu_bacteria 2643221680 2644451833 253
244 iso_pu_bacteria 2643221723 2644675179 253
245 iso_pu_bacteria 2643221726 2644691006 253
246 iso_pu_bacteria 2687453392 2688596156 253
247 iso_pu_bacteria 2711768613 2713480782 253
248 iso_pu_bacteria 2756170246 2756673553 253
249 iso_pu_bacteria 2844002411 2844003279 253
250 iso_pu_bacteria 2856328259 2856329438 253
251 iso_pu_bacteria 2856334872 2856335079 253
252 iso_pu_bacteria 2857367948 2857370409 253
253 iso_pu_bacteria 2869234852 2869239197 253
254 iso_pu_bacteria 2869242130 2869246631 253
255 iso_pu_bacteria 2869249662 2869256582 253
256 iso_pu_bacteria 2869256925 2869257583 253
257 iso_pu_bacteria 2869264136 2869270090 253
258 iso_pu_bacteria 2869271264 2869271628 253
259 iso_pu_bacteria 2871435913 2871443381 253
260 iso_pu_bacteria 2871451962 2871452046 253
261 iso_pu_bacteria 2871459585 2871465276 253
262 iso_pu_bacteria 2871466892 2871473468 253
263 iso_pu_bacteria 2871481445 2871481546 253
264 iso_pu_bacteria 2874109183 2874114847 253
265 iso_pu_bacteria 2874116593 2874123515 253
266 iso_pu_bacteria 2874131515 2874134452 253
267 iso_pu_bacteria 2874162495 2874163670 253
268 iso_pu_bacteria 2876386047 2876392591 253
269 iso_pu_bacteria 2876399893 2876401117 253
270 iso_pu_bacteria 2876406927 2876407900 253
271 iso_pu_bacteria 2876420981 2876427224 253
272 iso_pu_bacteria 2878730984 2878734942 253
273 iso_pu_bacteria 2878774303 2878774499 253
274 iso_pu_bacteria 2878781027 2878782815 253
275 iso_pu_bacteria 2891373044 2891376952 253
276 iso_pu_bacteria 2906378014 2906385750 253
277 iso_pu_bacteria 2906386501 2906391743 253
278 iso_pu_bacteria 2906393657 2906394421 253
279 iso_pu_bacteria 2906401398 2906403153 253
280 iso_pu_bacteria 2906408224 2906408992 253
281 iso_pu_bacteria 2919100787 2919102879 253
282 iso_pu_bacteria 2922151315 2922153577 253
283 iso_pu_bacteria 2922172374 2922173264 253
284 iso_pu_bacteria 2922178524 2922182117 253
285 iso_pu_bacteria 2924710171 2924717802 253
286 iso_pu_bacteria 2924733363 2924740596 253
287 iso_pu_bacteria 2924741084 2924741755 253
288 iso_pu_bacteria 2924748358 2924753114 253
289 iso_pu_bacteria 2937822353 2937822827 253
290 iso_pu_bacteria 2937861824 2937864388 253
291 iso_pu_bacteria 2958108152 2958113858 253
292 iso_pu_bacteria 2958122699 2958129574 253
293 iso_pu_bacteria 2958158011 2958161391 253
294 iso_pu_bacteria 2961136820 2961141616 253
295 iso_pu_bacteria 2961183825 2961187707 253
296 iso_pu_bacteria 2965025482 2965026808 253
297 iso_pu_bacteria 2965032056 2965033246 253
298 iso_pu_bacteria 2965040258 2965046121 253
299 iso_pu_bacteria 2965047637 2965053988 253
300 iso_pu_bacteria 2965089291 2965091076 253
301 iso_pu_bacteria 2965102966 2965109663 253
302 iso_pu_bacteria 2965110997 2965114060 253
303 iso_pu_bacteria 2968138860 2968139756 253
304 iso_pu_bacteria 2970489779 2970493570 253
305 iso_pu_bacteria 2970510686 2970511146 253
306 iso_pu_bacteria 2970532167 2970536323 253
307 iso_pu_bacteria 2970547951 2970550903 253
308 iso_pu_bacteria 2970627176 2970629597 253
309 iso_pu_bacteria 2977851361 2977853500 253
310 iso_pu_bacteria 2977872689 2977876735 253
311 iso_pu_bacteria 2977898635 2977902950 253
312 iso_pu_bacteria 2977907340 2977908328 253
313 iso_pu_bacteria 2977915119 2977920408 253
314 iso_pu_bacteria 2977935797 2977935829 253
315 iso_pu_bacteria 2977950692 2977952144 253
316 iso_pu_bacteria 2977957713 2977958475 253
317 iso_pu_bacteria 2979764755 2979768882 253
318 iso_pu_bacteria 2979772303 2979775666 253
319 iso_pu_bacteria 2987645492 2987646913 253
320 iso_pu_bacteria 2987673487 2987679618 253
321 iso_pu_bacteria 2989349275 2989353810 253
322 iso_pu_bacteria 2996386984 2996392778 253
323 iso_pu_bacteria 3003930520 3003935662 253
324 iso_pu_bacteria 3004167301 3004173472 253
325 iso_pu_bacteria 3004195979 3004199174 253
326 iso_pu_bacteria 3004232784 3004238285 253
327 iso_pu_bacteria 3004239961 3004248070 253
328 iso_pu_bacteria 3004268573 3004273027 253
329 iso_pu_bacteria 649633066 649870716 253
330 iso_pu_bacteria 8004300914 8004305905 253
331 iso_pu_bacteria 8004312739 8004314949 253
332 iso_pu_bacteria 8004361976 8004368350 253
333 iso_pu_bacteria 8004727605 8004734609 253
334 3300003856 Ga0058692_1005997 Ga0058692_10059972 254
335 3300048913 Ga0496110_0313849 Ga0496110_0313849_106_891 254
336 3300048924 Ga0496121_0296939 Ga0496121_0296939_94_879 254
337 3300048925 Ga0496122_0117378 Ga0496122_0117378_351_1142 254
338 3300048927 Ga0496124_0259439 Ga0496124_0259439_338_1123 254
339 3300048928 Ga0496125_0000221 Ga0496125_0000221_105438_106223 254
340 iso_pu_bacteria 2510461069 2510840238 254
341 iso_pu_bacteria 2510917022 2511137279 254
342 iso_pu_bacteria 2524023207 2524452001 254
343 iso_pu_bacteria 2582581283 2585164363 254
344 iso_pu_bacteria 2582581306 2585264604 254
345 iso_pu_bacteria 2582581307 2585274106 254
346 iso_pu_bacteria 2582581865 2585389972 254
347 iso_pu_bacteria 2585427531 2585560556 254
348 iso_pu_bacteria 2585427608 2585898768 254
349 iso_pu_bacteria 2585427609 2585903661 254
350 iso_pu_bacteria 2585428125 2587981220 254
351 iso_pu_bacteria 2643221568 2643853945 254
352 iso_pu_bacteria 2643221607 2644051702 254
353 iso_pu_bacteria 2643221618 2644104274 254
354 iso_pu_bacteria 2643221626 2644148037 254
355 iso_pu_bacteria 2643221636 2644200186 254
356 iso_pu_bacteria 2643221655 2644310234 254
357 iso_pu_bacteria 2643221659 2644333440 254
358 iso_pu_bacteria 2643221686 2644480570 254
359 iso_pu_bacteria 2643221689 2644498720 254
360 iso_pu_bacteria 2643221698 2644543710 254
361 iso_pu_bacteria 2643221712 2644616779 254
362 iso_pu_bacteria 2690316117 2692318988 254
363 iso_pu_bacteria 2751185821 2753459284 254
364 iso_pu_bacteria 2775507049 2776916038 254
365 iso_pu_bacteria 2791355253 2793281447 254
366 iso_pu_bacteria 2842509118 2842510547 254
367 iso_pu_bacteria 2844163670 2844165047 254
368 iso_pu_bacteria 2847417321 2847422510 254
369 iso_pu_bacteria 2848992105 2848998081 254
370 iso_pu_bacteria 2852387548 2852390981 254
371 iso_pu_bacteria 2855872281 2855875847 254
372 iso_pu_bacteria 2941499720 2941503969 254
373 iso_pu_bacteria 2957443900 2957444697 254
374 iso_pu_bacteria 2960617483 2960621128 254
375 iso_pu_bacteria 2960660292 2960661412 254
376 iso_pu_bacteria 2977523885 2977524912 254
377 iso_pu_bacteria 2978969890 2978970099 254
378 iso_pu_bacteria 2984587000 2984587128 254
379 iso_pu_bacteria 643692032 643823618 254
380 3300002773 JGI25152J39213_1003426 JGI25152J39213_10034263 255
381 3300002774 JGI25150J39212_1001197 JGI25150J39212_10011972 255
382 3300002987 JGI25159J45721_1000563 JGI25159J45721_10005634 255
383 3300002987 JGI25159J45721_1006968 JGI25159J45721_10069683 255
384 3300003187 JGI25151J46595_10003579 JGI25151J46595_100035795 255
385 3300003215 JGI25153J46596_10006515 JGI25153J46596_100065152 255
386 3300003215 JGI25153J46596_10007864 JGI25153J46596_100078644 255
387 3300003354 JGI25160J50197_1000820 JGI25160J50197_100082014 255
388 3300003354 JGI25160J50197_1008401 JGI25160J50197_10084013 255
389 3300003374 JGI25161J50226_1000289 JGI25161J50226_100028925 255
390 3300003771 Ga0055526_1001598 Ga0055526_100159814 255
391 3300003775 Ga0055524_1002668 Ga0055524_10026686 255
392 3300003775 Ga0055524_1012961 Ga0055524_10129613 255
393 3300003781 Ga0055536_1001086 Ga0055536_10010864 255
394 3300003790 Ga0055528_1004598 Ga0055528_10045985 255
395 3300003794 Ga0055531_10016501 Ga0055531_100165013 255
396 3300004625 Ga0055543_1000023 Ga0055543_1000023103 255
397 3300004625 Ga0055543_1000727 Ga0055543_100072714 255
398 3300005262 Ga0065165_1002311 Ga0065165_100231114 255
399 3300013105 Ga0157369_10037593 Ga0157369_100375934 255
400 3300013249 Ga0171463_1016 Ga0171463_101665 255
401 3300015690 Ga0183363_1267 Ga0183363_12675 255
402 3300025208 Ga0209436_100712 Ga0209436_1007125 255
403 3300025245 Ga0207425_1000968 Ga0207425_10009684 255
404 3300025258 Ga0209129_1003607 Ga0209129_10036073 255
405 3300025258 Ga0209129_1006383 Ga0209129_10063833 255
406 3300025273 Ga0209673_1023028 Ga0209673_10230282 255
407 3300025273 Ga0209673_1027416 Ga0209673_10274161 255
408 3300025284 Ga0209130_1000031 Ga0209130_1000031133 255
409 3300025284 Ga0209130_1001334 Ga0209130_100133414 255
410 3300025292 Ga0209676_1001434 Ga0209676_10014345 255
411 3300025294 Ga0209025_1000121 Ga0209025_1000121126 255
412 3300025294 Ga0209025_1005690 Ga0209025_10056905 255
413 3300025294 Ga0209025_1007351 Ga0209025_10073515 255
414 3300025295 Ga0209564_1000081 Ga0209564_100008122 255
415 3300025295 Ga0209564_1000826 Ga0209564_100082629 255
416 3300025297 Ga0209758_1011158 Ga0209758_10111584 255
417 3300025297 Ga0209758_1011779 Ga0209758_10117793 255
418 3300025298 Ga0209050_1000852 Ga0209050_100085221 255
419 3300025299 Ga0209256_1000639 Ga0209256_100063937 255
420 3300025299 Ga0209256_1003364 Ga0209256_10033649 255
421 3300025302 Ga0207426_1000042 Ga0207426_1000042277 255
422 3300025302 Ga0207426_1001728 Ga0207426_100172814 255
423 3300025303 Ga0209051_1013148 Ga0209051_10131483 255
424 3300025304 Ga0209257_1001851 Ga0209257_10018515 255
425 3300028794 Ga0307515_10022779 Ga0307515_100227793 255
426 3300031456 Ga0307513_10024760 Ga0307513_100247605 255
427 3300031649 Ga0307514_10154346 Ga0307514_101543462 255
428 3300041413 Ga0439465_0055235 Ga0439465_0055235_188_982 255
429 3300046460 Ga0495638_0014130 Ga0495638_0014130_2106_2900 255
430 3300046522 Ga0495643_0052753 Ga0495643_0052753_122_916 255
431 3300046694 Ga0495649_0029090 Ga0495649_0029090_275_1069 255
432 3300048909 Ga0496106_0000401 Ga0496106_0000401_20642_21436 255
433 3300048919 Ga0496116_0000233 Ga0496116_0000233_84361_85164 255
434 3300048920 Ga0496117_0001463 Ga0496117_0001463_30266_31072 255
435 3300048924 Ga0496121_0007775 Ga0496121_0007775_8198_9037 255
436 3300048925 Ga0496122_0001329 Ga0496122_0001329_13847_14653 255
437 3300048925 Ga0496122_0142366 Ga0496122_0142366_30_935 255
438 3300048926 Ga0496123_0000018 Ga0496123_0000018_24993_25799 255
439 3300048926 Ga0496123_0061037 Ga0496123_0061037_94_888 255
440 3300048927 Ga0496124_0000940 Ga0496124_0000940_18408_19214 255
441 3300048927 Ga0496124_0070672 Ga0496124_0070672_1571_2365 255
442 3300048927 Ga0496124_0133467 Ga0496124_0133467_855_1658 255
443 3300048928 Ga0496125_0000161 Ga0496125_0000161_91612_92418 255
444 3300048929 Ga0496126_0000212 Ga0496126_0000212_85170_85976 255
445 3300048929 Ga0496126_0001037 Ga0496126_0001037_28039_28842 255
446 3300049569 Ga0501032_0154480 Ga0501032_0154480_334_1128 255
447 3300049579 Ga0501043_0113091 Ga0501043_0113091_1280_2074 255
448 3300049744 Ga0501083_0037673 Ga0501083_0037673_194_988 255
449 3300053139 Ga0500568_0015840 Ga0500568_0015840_588_1382 255
450 3300053139 Ga0500568_0043291 Ga0500568_0043291_149_943 255
451 3300053156 Ga0500622_0000343 Ga0500622_0000343_43341_44135 255
452 3300053156 Ga0500622_0004607 Ga0500622_0004607_3648_4442 255
453 3300053160 Ga0500633_0007428 Ga0500633_0007428_471_1265 255
454 3300006178 Ga0075367_10074073 Ga0075367_100740732 256
455 3300028794 Ga0307515_10024806 Ga0307515_100248063 256
456 3300028794 Ga0307515_10152500 Ga0307515_101525002 256
457 3300031456 Ga0307513_10003256 Ga0307513_100032565 256
458 3300046460 Ga0495638_0024332 Ga0495638_0024332_495_1292 256
459 3300046660 Ga0495625_0187317 Ga0495625_0187317_553_1350 256
460 3300048924 Ga0496121_0274687 Ga0496121_0274687_79_882 256
461 3300053111 Ga0500572_002031 Ga0500572_002031_3861_4685 256
462 3300053177 Ga0500636_0001782 Ga0500636_0001782_4750_5574 256
463 iso_pu_bacteria 2643221637 2644206991 256
464 iso_pu_bacteria 2643221718 2644650639 256
465 3300003354 JGI25160J50197_1000090 JGI25160J50197_100009061 257
466 3300005262 Ga0065165_1000928 Ga0065165_100092813 257
467 3300005337 Ga0070682_100315208 Ga0070682_1003152082 257
468 3300025284 Ga0209130_1014584 Ga0209130_10145843 257
469 3300025302 Ga0207426_1000110 Ga0207426_100011068 257
470 3300037471 Ga0395905_0000020 Ga0395905_0000020_72512_73291 257
471 3300046455 Ga0495603_0004048 Ga0495603_0004048_1196_1975 257
472 3300046457 Ga0495590_0028043 Ga0495590_0028043_458_1237 257
473 3300046472 Ga0495580_0001843 Ga0495580_0001843_10024_10803 257
474 3300046506 Ga0495583_0022612 Ga0495583_0022612_2134_2913 257
475 3300046513 Ga0495616_0131552 Ga0495616_0131552_317_1096 257
476 3300046557 Ga0495622_0164810 Ga0495622_0164810_146_925 257
477 3300046684 Ga0495669_0189191 Ga0495669_0189191_149_928 257
478 3300046794 Ga0495589_0072572 Ga0495589_0072572_625_1404 257
479 3300047319 Ga0495674_0030964 Ga0495674_0030964_2047_2826 257
480 3300047443 Ga0495687_008698 Ga0495687_008698_1302_2081 257
481 3300048903 Ga0496100_0033872 Ga0496100_0033872_1220_1999 257
482 3300048907 Ga0496104_0019055 Ga0496104_0019055_770_1549 257
483 3300048908 Ga0496105_0079079 Ga0496105_0079079_1874_2653 257
484 3300048915 Ga0496112_0002887 Ga0496112_0002887_9623_10402 257
485 3300048924 Ga0496121_0071759 Ga0496121_0071759_989_1768 257
486 3300048924 Ga0496121_0153919 Ga0496121_0153919_182_961 257
487 3300049459 Ga0495678_063879 Ga0495678_063879_99_878 257
488 3300049460 Ga0495682_0019767 Ga0495682_0019767_318_1097 257
489 iso_pu_bacteria 2919506607 2919508114 257
490 3300005539 Ga0068853_100254691 Ga0068853_1002546912 258
491 3300009093 Ga0105240_10010228 Ga0105240_100102282 258
492 3300009174 Ga0105241_10083379 Ga0105241_100833792 258
493 3300009545 Ga0105237_10002251 Ga0105237_1000225111 258
494 3300009551 Ga0105238_10005845 Ga0105238_1000584511 258
495 3300010375 Ga0105239_10002342 Ga0105239_1000234211 258
496 3300025913 Ga0207695_10017107 Ga0207695_100171077 258
497 3300025914 Ga0207671_10012208 Ga0207671_100122084 258
498 3300025924 Ga0207694_10083243 Ga0207694_100832432 258
499 3300026041 Ga0207639_10032301 Ga0207639_100323014 258
500 iso_pu_bacteria 2551306352 2552749018 258
501 iso_pu_bacteria 2639762793 2640733964 258
502 iso_pu_bacteria 2675903507 2678230946 258
503 iso_pu_bacteria 2773857761 2774388508 258
504 iso_pu_bacteria 2773857770 2774438838 258
505 iso_pu_bacteria 2919182534 2919183855 258
506 3300003856 Ga0058692_1000080 Ga0058692_100008058 260
507 3300005272 Ga0065703_1000148 Ga0065703_10001483 260
508 3300005289 Ga0065704_10086313 Ga0065704_100863132 260
509 3300005289 Ga0065704_10119407 Ga0065704_101194072 260
510 3300005353 Ga0070669_100114478 Ga0070669_1001144781 260
511 3300009011 Ga0105251_10080393 Ga0105251_100803931 260
512 3300009011 Ga0105251_10080404 Ga0105251_100804041 260
513 3300009036 Ga0105244_10032708 Ga0105244_100327082 260
514 3300009036 Ga0105244_10068966 Ga0105244_100689662 260
515 3300009092 Ga0105250_10022169 Ga0105250_100221692 260
516 3300009101 Ga0105247_10000120 Ga0105247_1000012061 260
517 3300009148 Ga0105243_10000005 Ga0105243_1000000562 260
518 3300017792 Ga0163161_10063114 Ga0163161_100631143 260
519 3300017792 Ga0163161_10181444 Ga0163161_101814441 260
520 3300025711 Ga0207696_1001751 Ga0207696_10017512 260
521 3300025711 Ga0207696_1004755 Ga0207696_10047552 260
522 3300025728 Ga0207655_1000736 Ga0207655_100073615 260
523 3300025728 Ga0207655_1000892 Ga0207655_100089215 260
524 3300025735 Ga0207713_1021840 Ga0207713_10218402 260
525 3300025900 Ga0207710_10000160 Ga0207710_1000016058 260
526 3300025923 Ga0207681_10287162 Ga0207681_102871622 260
527 3300025935 Ga0207709_10000001 Ga0207709_100000011364 260
528 3300027312 Ga0209371_1000006 Ga0209371_1000006516 260
529 3300030500 Ga0268256_1000007 Ga0268256_1000007516 260
530 iso_pu_bacteria 2916699645 2916702794 261
531 iso_pu_bacteria 2818991436 2819545003 263
532 3300046529 Ga0495652_0023079 Ga0495652_0023079_506_1312 266
533 3300002737 JGI25162J39368_1000229 JGI25162J39368_100022944 267
534 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001991 267
535 3300003751 Ga0055538_1000001 Ga0055538_100000143 267
536 3300003752 Ga0055539_1000001 Ga0055539_100000143 267
537 3300003756 Ga0055533_1000003 Ga0055533_1000003991 267
538 3300003759 Ga0055525_1000087 Ga0055525_1000087102 267
539 3300003841 Ga0055541_1000001 Ga0055541_1000001991 267
540 3300015262 Ga0182007_10009888 Ga0182007_100098884 267
541 3300015262 Ga0182007_10027194 Ga0182007_100271942 267
542 3300015265 Ga0182005_1001910 Ga0182005_10019106 267
543 3300025207 Ga0209760_100821 Ga0209760_1008215 267
544 3300025224 Ga0209784_100004 Ga0209784_100004985 267
545 3300025225 Ga0209566_100004 Ga0209566_1000041142 267
546 3300025226 Ga0209674_100006 Ga0209674_1000061142 267
547 3300025230 Ga0209563_100009 Ga0209563_100009985 267
548 3300025231 Ga0207427_100838 Ga0207427_1008383 267
549 3300025233 Ga0209437_100004 Ga0209437_100004985 267
550 3300025253 Ga0209677_100005 Ga0209677_100005985 267
551 3300025261 Ga0209233_1000005 Ga0209233_10000051142 267
552 3300046454 Ga0495592_0003858 Ga0495592_0003858_6248_7051 267
553 3300046463 Ga0495653_0002613 Ga0495653_0002613_6961_7764 267
554 3300046511 Ga0495608_0094892 Ga0495608_0094892_227_1030 267
555 3300046514 Ga0495618_0022216 Ga0495618_0022216_920_1723 267
556 3300046516 Ga0495628_0054210 Ga0495628_0054210_1527_2330 267
557 3300046529 Ga0495652_0023215 Ga0495652_0023215_3592_4395 267
558 3300046543 Ga0495645_0005361 Ga0495645_0005361_4943_5746 267
559 3300046663 Ga0495635_0041791 Ga0495635_0041791_834_1637 267
560 3300046678 Ga0495599_0002568 Ga0495599_0002568_4381_5184 267
561 3300046679 Ga0495623_0073954 Ga0495623_0073954_453_1256 267
562 3300046680 Ga0495646_0024141 Ga0495646_0024141_1848_2651 267
563 3300046690 Ga0495624_0004153 Ga0495624_0004153_8916_9719 267
564 3300046809 Ga0495600_0000986 Ga0495600_0000986_13216_14019 267
565 3300047317 Ga0495604_0020795 Ga0495604_0020795_913_1716 267
566 3300048088 Ga0495602_0022089 Ga0495602_0022089_3339_4142 267
567 3300053077 Ga0495601_0029102 Ga0495601_0029102_673_1476 267
568 3300053119 Ga0500595_000833 Ga0500595_000833_11982_12785 267
569 3300053141 Ga0500574_000930 Ga0500574_000930_1947_2750 267
570 3300053154 Ga0500619_000066 Ga0500619_000066_4429_5232 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

62

202

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.9371 2 216
8hpr-assembly1.cif.gz_C lpqy-sugabc in state 4 0.9348 2 216
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.9282 2 216
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.9267 2 216
8hpr-assembly1.cif.gz_D lpqy-sugabc in state 4 0.9267 2 216
ID Description Score Start End Superfamily
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9493 1 238 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9416 1 238 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9264 2 67 3.40.50.300
af_Q2G1I6_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9258 1 250 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9251 2 246 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5R2N6U7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9719 2 215 GO:0005524
GO:0005886
GO:0016887
AF-A0A3S4EYC5-F1-model_v4 Taurine transporter ATP-binding subunit 0.9707 2 250 GO:0005524
GO:0005886
GO:0016887
AF-A0A839FCK8-F1-model_v4 Taurine transport system ATP-binding protein 0.9699 2 250 GO:0005524
GO:0005886
GO:0016887
AF-A0A4R9X8B1-F1-model_v4 ATP-binding cassette domain-containing protein 0.9698 2 250 GO:0005524
GO:0005886
GO:0015411
GO:0016887
AF-A0A5F2GF88-F1-model_v4 ATP-binding cassette domain-containing protein 0.9659 2 250 GO:0005524
GO:0005886
GO:0015411
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.17 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map