F464871

General Info

Members Datasets Scaffolds Average Seq Length
570 431 1140 127

Family's Representative Sequence

Representative Sequence 3300047469|Ga0495673_0026536|Ga0495673_0026536_997_1389
Length 130
Sequence MSSEADAIVSAIIAKWCAGFATLDAAALSSLYAKNAFFFGSNPKLYRGRDGVADYFNGLPRWRKPSAVFSDVEAGQAGPDIINMAATISFDLAGERPDLIVKMSWVIMCEDGGWKIVNHHASSQAPLIEQ

Samples

Sample ID Description Type Environment
1 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
77 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
78 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
79 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
80 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
121 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
122 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
132 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
133 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
236 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
237 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
238 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
239 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
240 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
246 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
247 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
248 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
249 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
250 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
251 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
252 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
253 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
254 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
255 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
259 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
260 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
261 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
264 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
267 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
268 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
269 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
270 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
271 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
274 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
275 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
276 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
277 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
278 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
279 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
280 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
281 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
282 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
283 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
284 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
285 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
286 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
287 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
288 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
289 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
290 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
291 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
292 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
293 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
294 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
295 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
296 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
297 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
298 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
299 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
300 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
301 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
302 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
303 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
304 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
305 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
306 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
307 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
308 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
309 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
310 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
311 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
312 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
313 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
314 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
315 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
316 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
317 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
318 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
319 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
320 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
321 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
322 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
323 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
324 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
325 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
326 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
327 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
328 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
329 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
330 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
331 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
332 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
333 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
334 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
335 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
336 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
337 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
338 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
339 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
340 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
341 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
342 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
343 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
344 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
345 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
346 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
347 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
348 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
349 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
350 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
351 2922368715
352 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
353 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
354 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
355 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
356 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
357 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
358 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
359 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
360 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
361 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
362 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
363 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
364 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
365 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
366 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
367 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
368 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
369 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
370 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
371 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
372 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
373 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
374 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
375 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
376 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
377 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
378 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
379 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
380 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
381 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
382 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
383 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
384 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
385 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
386 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
387 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
388 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
389 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
390 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
391 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
392 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
393 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
394 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
395 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
396 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
397 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
398 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
399 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
400 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
401 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
402 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
403 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
404 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
405 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
406 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
407 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
408 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
409 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
410 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
411 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
412 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
413 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
414 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
415 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
416 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
417 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
418 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
419 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
420 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
421 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
422 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
423 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
424 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
425 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
426 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
427 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
428 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
429 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
430 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
431 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.76
Metatranscriptomes 0
Isolates 27.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.63
Nodule 20.7
Rhizoplane 4.56
Rhizosphere 38.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495673_0026536 3300047469 Bacteria 2769
2 JGI25153J46596_10001003 3300003215 Bacteria 17167
3 JGI25153J46596_10103649 3300003215 Bacteria 665
4 rootH2_10122174 3300003320 Bacteria 1452
5 JGI25160J50197_1015385 3300003354 Bacteria 2512
6 JGI25160J50197_1030414 3300003354 Bacteria 1408
7 Ga0055539_1016852 3300003752 Bacteria 885
8 Ga0055542_1019309 3300003762 Bacteria 1020
9 Ga0055526_1043047 3300003771 Bacteria 1104
10 Ga0055531_10001608 3300003794 Bacteria 16412
11 Ga0055543_1012515 3300004625 Bacteria 1703
12 Ga0055543_1065342 3300004625 Bacteria 578
13 Ga0065165_1003099 3300005262 Bacteria 12366
14 Ga0065165_1003447 3300005262 Bacteria 11112
15 Ga0065165_1003661 3300005262 Bacteria 10494
16 Ga0065165_1031740 3300005262 Bacteria 1664
17 Ga0070658_10066473 3300005327 Bacteria 2945
18 Ga0070658_10554638 3300005327 Bacteria 994
19 Ga0070670_100048064 3300005331 Bacteria 3672
20 Ga0070666_10585201 3300005335 Bacteria 814
21 Ga0068868_101164205 3300005338 Bacteria 712
22 Ga0070660_100432420 3300005339 Bacteria 1090
23 Ga0070660_100853862 3300005339 Bacteria 767
24 Ga0070689_100635794 3300005340 Bacteria 927
25 Ga0070661_100837109 3300005344 Bacteria 757
26 Ga0070668_100028355 3300005347 Bacteria 4251
27 Ga0070669_100128847 3300005353 Bacteria 1939
28 Ga0070671_100074831 3300005355 Bacteria 2829
29 Ga0070673_100222632 3300005364 Bacteria 1634
30 Ga0070688_100378497 3300005365 Bacteria 1043
31 Ga0070667_100101974 3300005367 Bacteria 2479
32 Ga0070713_101211370 3300005436 Bacteria 731
33 Ga0070711_100568039 3300005439 Bacteria 943
34 Ga0070663_100028927 3300005455 Bacteria 3779
35 Ga0070662_100570378 3300005457 Bacteria 950
36 Ga0068867_100207735 3300005459 Bacteria 1571
37 Ga0070679_101680066 3300005530 Bacteria 583
38 Ga0068853_100069258 3300005539 Bacteria 3069
39 Ga0068853_100693893 3300005539 Bacteria 971
40 Ga0070693_100992668 3300005547 Bacteria 635
41 Ga0070665_100016109 3300005548 Bacteria 7502
42 Ga0070665_100107390 3300005548 Bacteria 2793
43 Ga0070665_100472416 3300005548 Bacteria 1265
44 Ga0068855_100164987 3300005563 Bacteria 2512
45 Ga0070664_100828543 3300005564 Bacteria 866
46 Ga0068857_100111553 3300005577 Bacteria 2459
47 Ga0068856_100113971 3300005614 Bacteria 2702
48 Ga0068852_100352429 3300005616 Bacteria 1437
49 Ga0068852_100508286 3300005616 Bacteria 1201
50 Ga0068859_100811241 3300005617 Bacteria 1023
51 Ga0068861_101186287 3300005719 Bacteria 738
52 Ga0068851_10184571 3300005834 Bacteria 1157
53 Ga0068858_100035703 3300005842 Bacteria 4609
54 Ga0068858_100556077 3300005842 Bacteria 1111
55 Ga0068862_100144859 3300005844 Bacteria 2111
56 Ga0081540_1048871 3300005983 Bacteria 2115
57 Ga0070717_10420096 3300006028 Bacteria 1203
58 Ga0075365_10012658 3300006038 Bacteria 5020
59 Ga0075365_10023412 3300006038 Bacteria 3884
60 Ga0075365_10076045 3300006038 Bacteria 2267
61 Ga0075365_10104875 3300006038 Bacteria 1939
62 Ga0075365_10130383 3300006038 Bacteria 1740
63 Ga0075365_10325992 3300006038 Bacteria 1082
64 Ga0075368_10026210 3300006042 Bacteria 2242
65 Ga0075363_100037524 3300006048 Bacteria 2545
66 Ga0075364_10098980 3300006051 Bacteria 1940
67 Ga0075362_10015736 3300006177 Bacteria 3082
68 Ga0075367_10047660 3300006178 Bacteria 2522
69 Ga0075369_10036578 3300006186 Bacteria 2089
70 Ga0075369_10569912 3300006186 Bacteria 541
71 Ga0075366_10005406 3300006195 Bacteria 6920
72 Ga0075370_10005808 3300006353 Bacteria 6165
73 Ga0075370_10105621 3300006353 Bacteria 1632
74 Ga0097620_100811371 3300006931 Bacteria 1023
75 Ga0099823_1026469 3300006944 Bacteria 5120
76 Ga0105240_10050391 3300009093 Bacteria 5250
77 Ga0105245_10290420 3300009098 Bacteria 1601
78 Ga0105247_10006742 3300009101 Bacteria 7085
79 Ga0105247_10564435 3300009101 Bacteria 839
80 Ga0105243_10469865 3300009148 Bacteria 1184
81 Ga0105243_10777510 3300009148 Bacteria 941
82 Ga0105241_10100237 3300009174 Bacteria 2301
83 Ga0105241_10222004 3300009174 Bacteria 1589
84 Ga0105248_10035623 3300009177 Bacteria 5568
85 Ga0105237_10016436 3300009545 Bacteria 7687
86 Ga0105237_10049311 3300009545 Bacteria 4233
87 Ga0105237_10388926 3300009545 Bacteria 1400
88 Ga0105237_11316516 3300009545 Bacteria 729
89 Ga0105238_10190127 3300009551 Bacteria 2029
90 Ga0105238_11233620 3300009551 Bacteria 773
91 Ga0105249_11214541 3300009553 Bacteria 825
92 Ga0105239_10354177 3300010375 Bacteria 1657
93 Ga0105239_10513179 3300010375 Bacteria 1363
94 Ga0105239_10547108 3300010375 Bacteria 1318
95 Ga0105239_11288554 3300010375 Bacteria 843
96 Ga0105239_11693218 3300010375 Bacteria 732
97 Ga0105239_11730929 3300010375 Bacteria 724
98 Ga0105239_11975652 3300010375 Bacteria 677
99 Ga0105246_10017794 3300011119 Bacteria 4520
100 Ga0105246_11282676 3300011119 Bacteria 678
101 Ga0157369_11136318 3300013105 Bacteria 798
102 Ga0157374_10022746 3300013296 Bacteria 5597
103 Ga0157374_10241474 3300013296 Bacteria 1776
104 Ga0157378_10425542 3300013297 Bacteria 1313
105 Ga0163162_10677163 3300013306 Bacteria 1154
106 Ga0163162_12325906 3300013306 Bacteria 616
107 Ga0157375_13408457 3300013308 Bacteria 529
108 Ga0163163_10012880 3300014325 Bacteria 7636
109 Ga0182008_10297620 3300014497 Bacteria 843
110 Ga0157377_11199322 3300014745 Bacteria 587
111 Ga0182006_1143908 3300015261 Bacteria 813
112 Ga0214544_1010213 3300021320 Bacteria 13992
113 Ga0214542_1005735 3300021321 Bacteria 23325
114 Ga0214545_1005338 3300021324 Bacteria 23325
115 Ga0214543_1005480 3300021327 Bacteria 23325
116 Ga0209563_103703 3300025230 Bacteria 3096
117 Ga0207425_1006639 3300025245 Bacteria 3141
118 Ga0209677_102973 3300025253 Bacteria 5892
119 Ga0209148_1000155 3300025254 Bacteria 143807
120 Ga0209148_1026243 3300025254 Bacteria 906
121 Ga0209233_1002355 3300025261 Bacteria 7031
122 Ga0209233_1011360 3300025261 Bacteria 2626
123 Ga0209233_1065408 3300025261 Bacteria 689
124 Ga0209455_1002042 3300025272 Bacteria 8184
125 Ga0209564_1004534 3300025295 Bacteria 8439
126 Ga0209564_1020572 3300025295 Bacteria 2412
127 Ga0209564_1030893 3300025295 Bacteria 1650
128 Ga0209758_1000021 3300025297 Bacteria 697691
129 Ga0209758_1000371 3300025297 Bacteria 78923
130 Ga0209758_1001143 3300025297 Bacteria 34037
131 Ga0209758_1001291 3300025297 Bacteria 30796
132 Ga0209758_1025979 3300025297 Bacteria 2551
133 Ga0209758_1042076 3300025297 Bacteria 1698
134 Ga0209758_1096950 3300025297 Bacteria 848
135 Ga0209256_1004196 3300025299 Bacteria 9264
136 Ga0209256_1039589 3300025299 Bacteria 1211
137 Ga0209256_1052800 3300025299 Bacteria 975
138 Ga0207426_1000352 3300025302 Bacteria 84141
139 Ga0207426_1001433 3300025302 Bacteria 19799
140 Ga0207426_1017517 3300025302 Bacteria 2546
141 Ga0209051_1027992 3300025303 Bacteria 2235
142 Ga0209257_1001227 3300025304 Bacteria 31899
143 Ga0209257_1018654 3300025304 Bacteria 2654
144 Ga0209257_1029519 3300025304 Bacteria 1785
145 Ga0207688_10238498 3300025901 Bacteria 1099
146 Ga0207647_10001318 3300025904 Bacteria 19063
147 Ga0207705_10084497 3300025909 Bacteria 2317
148 Ga0207705_10422833 3300025909 Bacteria 1032
149 Ga0207705_10614150 3300025909 Bacteria 845
150 Ga0207654_10156252 3300025911 Bacteria 1469
151 Ga0207654_10912988 3300025911 Bacteria 637
152 Ga0207695_10000015 3300025913 Bacteria 803205
153 Ga0207695_11165027 3300025913 Bacteria 651
154 Ga0207671_10001316 3300025914 Bacteria 29070
155 Ga0207671_10012678 3300025914 Bacteria 6764
156 Ga0207671_10465592 3300025914 Bacteria 1007
157 Ga0207663_10488020 3300025916 Bacteria 955
158 Ga0207657_10688629 3300025919 Bacteria 794
159 Ga0207694_10161483 3300025924 Bacteria 1810
160 Ga0207694_11161205 3300025924 Bacteria 653
161 Ga0207650_10036616 3300025925 Bacteria 3571
162 Ga0207687_11197807 3300025927 Bacteria 653
163 Ga0207690_10656488 3300025932 Bacteria 860
164 Ga0207706_10880450 3300025933 Bacteria 757
165 Ga0207709_10673607 3300025935 Bacteria 825
166 Ga0207711_10357284 3300025941 Bacteria 1353
167 Ga0207679_10155513 3300025945 Bacteria 1867
168 Ga0207667_10126455 3300025949 Bacteria 2633
169 Ga0207712_10111339 3300025961 Bacteria 2054
170 Ga0207640_10405251 3300025981 Bacteria 1112
171 Ga0207677_10482023 3300026023 Bacteria 1069
172 Ga0207703_10030606 3300026035 Bacteria 4255
173 Ga0207703_11873271 3300026035 Bacteria 576
174 Ga0207639_10095125 3300026041 Bacteria 2393
175 Ga0207678_10121651 3300026067 Bacteria 2227
176 Ga0207678_10593363 3300026067 Bacteria 971
177 Ga0207702_10063812 3300026078 Bacteria 3151
178 Ga0207702_10455543 3300026078 Bacteria 1242
179 Ga0207641_10569367 3300026088 Bacteria 1106
180 Ga0207648_10156725 3300026089 Bacteria 2010
181 Ga0207674_10984159 3300026116 Bacteria 812
182 Ga0207698_10292391 3300026142 Bacteria 1512
183 Ga0207698_10476646 3300026142 Bacteria 1210
184 Ga0209389_1000294 3300027296 Bacteria 31039
185 Ga0209489_108125 3300027361 Bacteria 14741
186 Ga0209700_100281 3300027363 Bacteria 90519
187 Ga0209813_10007243 3300027866 Bacteria 2759
188 Ga0209813_10460939 3300027866 Bacteria 521
189 Ga0268266_10096086 3300028379 Bacteria 2603
190 Ga0268266_10102447 3300028379 Bacteria 2525
191 Ga0307517_10135720 3300028786 Bacteria 1751
192 Ga0307510_10120788 3300033180 Bacteria 2326
193 Ga0307510_10241940 3300033180 Bacteria 1298
194 Ga0307510_10259689 3300033180 Bacteria 1219
195 Ga0395900_0063555 3300037418 Bacteria 3795
196 Ga0395905_0058368 3300037471 Bacteria 3608
197 Ga0395901_1011953 3300038443 Bacteria 806
198 Ga0436365_0056423 3300039437 Bacteria 691
199 Ga0436365_1592141 3300039437 Bacteria 562
200 Ga0439465_0390625 3300041413 Bacteria 529
201 Ga0451795_1050089 3300041456 Bacteria 943
202 Ga0451798_0485147 3300041458 Bacteria 1022
203 Ga0451853_2587175 3300041512 Bacteria 1348
204 Ga0466972_0000125 3300044658 Bacteria 65105
205 Ga0466972_0028232 3300044658 Bacteria 2769
206 Ga0466972_0038327 3300044658 Bacteria 2341
207 Ga0466972_0179122 3300044658 Bacteria 994
208 Ga0466972_0389646 3300044658 Bacteria 653
209 Ga0466965_0115315 3300044683 Bacteria 1383
210 Ga0466966_0011163 3300044684 Bacteria 5958
211 Ga0466961_0000015 3300044693 Bacteria 112812
212 Ga0466961_0374710 3300044693 Bacteria 865
213 Ga0466964_0039701 3300044706 Bacteria 1898
214 Ga0466968_0016289 3300044735 Bacteria 2958
215 Ga0466970_0169910 3300044765 Bacteria 1208
216 Ga0466957_0266687 3300044842 Bacteria 1142
217 Ga0466957_0811235 3300044842 Bacteria 665
218 Ga0466960_0212172 3300044901 Bacteria 1062
219 Ga0466959_0002982 3300045049 Bacteria 10934
220 Ga0466958_0104667 3300045836 Bacteria 1763
221 Ga0466967_0006941 3300045976 Bacteria 8099
222 Ga0466967_0318511 3300045976 Bacteria 1499
223 Ga0495592_0043072 3300046454 Bacteria 3379
224 Ga0495592_0681473 3300046454 Bacteria 620
225 Ga0495638_0012441 3300046460 Bacteria 5834
226 Ga0495651_0088925 3300046462 Bacteria 2320
227 Ga0495653_0336306 3300046463 Bacteria 975
228 Ga0495605_0099691 3300046474 Bacteria 1337
229 Ga0495664_0037986 3300046477 Bacteria 2842
230 Ga0495585_0295895 3300046492 Bacteria 797
231 Ga0495596_0056256 3300046500 Bacteria 1537
232 Ga0495583_0066184 3300046506 Bacteria 1599
233 Ga0495606_0045010 3300046507 Bacteria 2929
234 Ga0495606_0051490 3300046507 Bacteria 2685
235 Ga0495606_0154527 3300046507 Bacteria 1344
236 Ga0495606_0241421 3300046507 Bacteria 1007
237 Ga0495606_0401939 3300046507 Bacteria 713
238 Ga0495608_0105316 3300046511 Bacteria 1816
239 Ga0495610_0236749 3300046512 Bacteria 730
240 Ga0495616_0005246 3300046513 Bacteria 8002
241 Ga0495618_0317878 3300046514 Bacteria 965
242 Ga0495620_0029529 3300046515 Bacteria 2536
243 Ga0495620_0106674 3300046515 Bacteria 1113
244 Ga0495628_0104945 3300046516 Bacteria 2177
245 Ga0495628_0278896 3300046516 Bacteria 1242
246 Ga0495632_0308040 3300046519 Bacteria 701
247 Ga0495643_0004410 3300046522 Bacteria 9855
248 Ga0495648_0038075 3300046524 Bacteria 3082
249 Ga0495648_0238941 3300046524 Bacteria 884
250 Ga0495652_0233314 3300046529 Bacteria 1374
251 Ga0495652_1083967 3300046529 Bacteria 521
252 Ga0495654_0403278 3300046530 Bacteria 543
253 Ga0495640_0198254 3300046533 Bacteria 1273
254 Ga0495587_0085404 3300046536 Bacteria 1827
255 Ga0495609_0158108 3300046538 Bacteria 962
256 Ga0495609_0385411 3300046538 Bacteria 562
257 Ga0495597_0021164 3300046542 Bacteria 3024
258 Ga0495645_0015474 3300046543 Bacteria 5426
259 Ga0495622_0336905 3300046557 Bacteria 654
260 Ga0495667_0017287 3300046559 Bacteria 4872
261 Ga0495668_0020346 3300046616 Bacteria 3818
262 Ga0495668_0337359 3300046616 Bacteria 827
263 Ga0495634_0070533 3300046642 Bacteria 2303
264 Ga0495611_0295436 3300046648 Bacteria 747
265 Ga0495625_0121681 3300046660 Bacteria 1775
266 Ga0495625_0717568 3300046660 Bacteria 589
267 Ga0495635_0061725 3300046663 Bacteria 2574
268 Ga0495635_0082189 3300046663 Bacteria 2204
269 Ga0495661_0464373 3300046665 Bacteria 608
270 Ga0495588_0163490 3300046674 Bacteria 1177
271 Ga0495657_0020857 3300046675 Bacteria 4709
272 Ga0495623_0019154 3300046679 Bacteria 4423
273 Ga0495646_0078401 3300046680 Bacteria 1931
274 Ga0495646_0221386 3300046680 Bacteria 1023
275 Ga0495613_0068599 3300046689 Bacteria 2586
276 Ga0495613_0356310 3300046689 Bacteria 1004
277 Ga0495671_0411547 3300046692 Bacteria 647
278 Ga0495600_0012288 3300046809 Bacteria 5349
279 Ga0495600_0063412 3300046809 Bacteria 2415
280 Ga0495581_0843996 3300047315 Bacteria 524
281 Ga0495604_0001482 3300047317 Bacteria 19343
282 Ga0495604_0013135 3300047317 Bacteria 6596
283 Ga0495674_0047238 3300047319 Bacteria 3818
284 Ga0495680_0007846 3300047322 Bacteria 9742
285 Ga0495683_0029795 3300047323 Bacteria 2788
286 Ga0495687_004598 3300047443 Bacteria 9224
287 Ga0495673_0225882 3300047469 Bacteria 691
288 Ga0495684_0561998 3300047471 Bacteria 775
289 Ga0495686_0078071 3300047472 Bacteria 2027
290 Ga0495593_0216827 3300047673 Bacteria 960
291 Ga0495602_0079951 3300048088 Bacteria 2756
292 Ga0495602_0220005 3300048088 Bacteria 1434
293 Ga0495602_0226796 3300048088 Bacteria 1406
294 Ga0495626_0172852 3300048091 Bacteria 900
295 Ga0495626_0243125 3300048091 Bacteria 724
296 Ga0496101_0513211 3300048904 Bacteria 947
297 Ga0496101_0513760 3300048904 Bacteria 947
298 Ga0496102_0012960 3300048905 Bacteria 7219
299 Ga0496102_0062380 3300048905 Bacteria 3413
300 Ga0496103_0007098 3300048906 Bacteria 6688
301 Ga0496104_0018314 3300048907 Bacteria 6390
302 Ga0496104_0018831 3300048907 Bacteria 6306
303 Ga0496105_0054857 3300048908 Bacteria 3290
304 Ga0496106_0107463 3300048909 Bacteria 2170
305 Ga0496106_0186401 3300048909 Bacteria 1648
306 Ga0496107_0126864 3300048910 Bacteria 1882
307 Ga0496107_0213793 3300048910 Bacteria 1434
308 Ga0496108_0021180 3300048911 Bacteria 5343
309 Ga0496108_0770542 3300048911 Bacteria 831
310 Ga0496108_1156959 3300048911 Bacteria 656
311 Ga0496109_0027198 3300048912 Bacteria 5105
312 Ga0496110_0008469 3300048913 Bacteria 8278
313 Ga0496111_0071912 3300048914 Bacteria 2517
314 Ga0496112_0067055 3300048915 Bacteria 3541
315 Ga0496112_0109745 3300048915 Bacteria 2729
316 Ga0496113_0044808 3300048916 Bacteria 3278
317 Ga0496113_0088990 3300048916 Bacteria 2376
318 Ga0496113_0516916 3300048916 Bacteria 958
319 Ga0496114_0392816 3300048917 Bacteria 1228
320 Ga0496116_0060322 3300048919 Bacteria 2461
321 Ga0496116_0074889 3300048919 Bacteria 2127
322 Ga0496117_0069958 3300048920 Bacteria 2360
323 Ga0496117_0119529 3300048920 Bacteria 1622
324 Ga0496118_0014167 3300048921 Bacteria 7478
325 Ga0496118_0191542 3300048921 Bacteria 1222
326 Ga0496118_0279548 3300048921 Bacteria 930
327 Ga0496118_0333412 3300048921 Bacteria 817
328 Ga0496119_0015342 3300048922 Bacteria 5908
329 Ga0496119_0021247 3300048922 Bacteria 4698
330 Ga0496120_0052883 3300048923 Bacteria 2310
331 Ga0496121_0062820 3300048924 Bacteria 3039
332 Ga0496121_0123574 3300048924 Bacteria 1950
333 Ga0496121_0228865 3300048924 Bacteria 1303
334 Ga0496121_0406339 3300048924 Bacteria 890
335 Ga0496122_0079859 3300048925 Bacteria 2284
336 Ga0496124_0013689 3300048927 Bacteria 7903
337 Ga0496124_0596987 3300048927 Bacteria 719
338 Ga0496125_0099025 3300048928 Bacteria 2155
339 Ga0496126_0229883 3300048929 Bacteria 1554
340 Ga0496126_0258383 3300048929 Bacteria 1449
341 Ga0496126_0478015 3300048929 Bacteria 999
342 Ga0496126_0988975 3300048929 Bacteria 632
343 Ga0495682_0137350 3300049460 Bacteria 873
344 Ga0495682_0316074 3300049460 Bacteria 551
345 nmdc:mga03n38_154039_c1 3300050490 Bacteria 1159
346 nmdc:mga03n38_305795_c1 3300050490 Bacteria 855
347 nmdc:mga00v17_152333_c1 3300050491 Bacteria 1486
348 nmdc:mga0yw44_1054129_c1 3300050492 Bacteria 550
349 nmdc:mga0yw44_157282_c1 3300050492 Bacteria 1486
350 nmdc:mga0yw44_22477_c1 3300050492 Bacteria 3129
351 nmdc:mga0yw44_377011_c1 3300050492 Bacteria 957
352 nmdc:mga0yw44_397689_c1 3300050492 Bacteria 931
353 nmdc:mga0yw44_491404_c1 3300050492 Bacteria 833
354 nmdc:mga0yw44_74932_c1 3300050492 Bacteria 2109
355 nmdc:mga0k408_5700_c2 3300050493 Bacteria 5942
356 nmdc:mga06z11_191345_c1 3300050494 Bacteria 1185
357 nmdc:mga04h51_14433_c1 3300050495 Bacteria 2258
358 nmdc:mga04h51_498233_c1 3300050495 Bacteria 520
359 nmdc:mga07m45_357397_c1 3300050496 Bacteria 849
360 nmdc:mga07m45_77443_c1 3300050496 Bacteria 1897
361 nmdc:mga0sz30_105833_c1 3300050516 Bacteria 1231
362 nmdc:mga0sz30_12570_c1 3300050516 Bacteria 3297
363 nmdc:mga0sz30_7893_c1 3300050516 Bacteria 4005
364 Ga0500610_0229660 3300053079 Bacteria 872
365 Ga0495595_0092146 3300053084 Bacteria 1455
366 Ga0495619_0416979 3300053085 Bacteria 926
367 Ga0500578_0227325 3300053086 Bacteria 1132
368 Ga0500578_0266628 3300053086 Bacteria 1026
369 Ga0500578_0463171 3300053086 Bacteria 719
370 Ga0500643_000156 3300053087 Bacteria 68861
371 Ga0500646_0166973 3300053090 Bacteria 738
372 Ga0500646_0262885 3300053090 Bacteria 610
373 Ga0500647_0065697 3300053091 Bacteria 1745
374 Ga0500583_0009616 3300053092 Bacteria 3545
375 Ga0500640_115796 3300053095 Bacteria 1082
376 Ga0500641_0044190 3300053096 Bacteria 1811
377 Ga0500650_0118158 3300053098 Bacteria 1237
378 Ga0500650_0126347 3300053098 Bacteria 1190
379 Ga0500555_003461 3300053103 Bacteria 4498
380 Ga0500556_0005401 3300053104 Bacteria 3608
381 Ga0500557_000024 3300053105 Bacteria 84960
382 Ga0500562_016808 3300053108 Bacteria 1882
383 Ga0500572_014337 3300053111 Bacteria 1978
384 Ga0500592_005513 3300053116 Bacteria 2015
385 Ga0500595_215168 3300053119 Bacteria 528
386 Ga0500597_256345 3300053120 Bacteria 714
387 Ga0500607_069240 3300053121 Bacteria 1825
388 Ga0500621_185833 3300053126 Bacteria 749
389 Ga0500626_331624 3300053128 Bacteria 520
390 Ga0500652_053096 3300053131 Bacteria 1658
391 Ga0500655_013856 3300053133 Bacteria 1474
392 Ga0500658_0055340 3300053134 Bacteria 1633
393 Ga0500658_0273935 3300053134 Bacteria 776
394 Ga0500568_0004084 3300053139 Bacteria 7905
395 Ga0500568_0262795 3300053139 Bacteria 628
396 Ga0500577_0004805 3300053142 Bacteria 3594
397 Ga0500589_103492 3300053147 Bacteria 1233
398 Ga0500603_167328 3300053150 Bacteria 688
399 Ga0500604_0011190 3300053151 Bacteria 2407
400 Ga0500616_0024881 3300053153 Bacteria 3322
401 Ga0500619_028017 3300053154 Bacteria 1692
402 Ga0500620_069333 3300053155 Bacteria 1211
403 Ga0500622_0013797 3300053156 Bacteria 4352
404 Ga0500627_0019998 3300053158 Bacteria 2678
405 Ga0500633_0237612 3300053160 Bacteria 678
406 Ga0500638_061427 3300053162 Bacteria 1805
407 Ga0500636_0004844 3300053177 Bacteria 7634
408 Ga0500636_0374725 3300053177 Bacteria 670
409 Ga0500637_0039139 3300053178 Bacteria 2674
410 Ga0500625_062452 3300053729 Bacteria 1685
411 Ga0500645_119120 3300053730 Bacteria 737
412 Ga0500599_003756 3300053736 Bacteria 1862
413 Ga0500601_000221 3300053737 Bacteria 11241
414 Ga0500661_067935 3300055283 Bacteria 649
415 2507509255 2507262055 Bacteria 8048963
416 2508543324 2508501009 Bacteria 7784016
417 2508698909 2508501042 Bacteria 8719808
418 2511394286 2511231028 Bacteria 8046582
419 2513625747 2513237092 Bacteria 8341956
420 2513646739 2513237095 Bacteria 8976980
421 2513700597 2513237102 Bacteria 7703324
422 2513876537 2513237139 Bacteria 8737671
423 2514010881 2513237161 Bacteria 8871253
424 2515626671 2515154112 Bacteria 8294334
425 2517101917 2517093001 Bacteria 9002274
426 2528857538 2528768022 Bacteria 10457665
427 2617352868 2617270735 Bacteria 9163226
428 2617376391 2617270741 Bacteria 8201522
429 2745079273 2744054633 Bacteria 8678936
430 2793063964 2791355196 Bacteria 7323613
431 2805919816 2802429603 Bacteria 8777136
432 2818242909 2816332527 Bacteria 8933356
433 2824606017 2824600985 Bacteria 8488197
434 2824615956 2824609381 Bacteria 8672835
435 2824625576 2824617872 Bacteria 8814715
436 2824634261 2824626560 Bacteria 8813858
437 2824641732 2824635225 Bacteria 8785348
438 2824652001 2824644064 Bacteria 8743947
439 2824660340 2824653114 Bacteria 8493680
440 2824669112 2824661429 Bacteria 9877870
441 2824675468 2824671348 Bacteria 8369588
442 2824683501 2824679649 Bacteria 8248951
443 2824691647 2824687955 Bacteria 8360029
444 2824699409 2824696289 Bacteria 8335049
445 2824711228 2824704595 Bacteria 9667483
446 2824722271 2824714736 Bacteria 8717648
447 2824732571 2824723954 Bacteria 8758240
448 2824738258 2824732956 Bacteria 7810675
449 2824751887 2824746037 Bacteria 7911610
450 2824762011 2824753945 Bacteria 9787441
451 2824772468 2824763712 Bacteria 9792355
452 2824779356 2824773399 Bacteria 8360218
453 2838126461 2838122688 Bacteria 8803140
454 2841943490 2841941048 Bacteria 8688029
455 2841950562 2841949485 Bacteria 8680857
456 2841958054 2841957949 Bacteria 8652217
457 2841966877 2841966195 Bacteria 8673214
458 2841975626 2841974524 Bacteria 8931498
459 2841989988 2841983080 Bacteria 8395090
460 2842039678 2842038055 Bacteria 8002051
461 2842047376 2842045827 Bacteria 8006841
462 2844318459 2844315083 Bacteria 8138177
463 2847935343 2847930680 Bacteria 9342022
464 2847945942 2847939898 Bacteria 8606328
465 2849079934 2849076700 Bacteria 7039503
466 2857510709 2857509624 Bacteria 7472071
467 2874597378 2874590934 Bacteria 8299676
468 2874616429 2874612657 Bacteria 8252029
469 2874626708 2874620515 Bacteria 8290088
470 2874631134 2874628541 Bacteria 8630250
471 2874649288 2874645413 Bacteria 8214782
472 2876777825 2876771140 Bacteria 8287509
473 2876823154 2876818435 Bacteria 8274608
474 2879078582 2879074833 Bacteria 8279565
475 2879088584 2879083081 Bacteria 8587928
476 2879108035 2879099564 Bacteria 10442239
477 2879132941 2879127579 Bacteria 8294491
478 2879148740 2879142872 Bacteria 8267021
479 2881366767 2881364244 Bacteria 7710352
480 2885371850 2885366525 Bacteria 8326213
481 2888383403 2888378607 Bacteria 9652610
482 2888394520 2888388044 Bacteria 7304136
483 2888423804 2888419890 Bacteria 7857137
484 2903730177 2903727486 Bacteria 8281579
485 2904668286 2904666416 Bacteria 8226587
486 2904717248 2904711408 Bacteria 9771557
487 2906603561 2906602504 Bacteria 8295279
488 2906646329 2906643746 Bacteria 8722424
489 2908779507 2908775508 Bacteria 8092255
490 2922373595
491 2922395719 2922393267 Bacteria 8285685
492 2929617327 2929615660 Bacteria 9193770
493 2929627032 2929624759 Bacteria 9339455
494 2932787659 2932784394 Bacteria 9704911
495 2932813186 2932809354 Bacteria 9135765
496 2932820899 2932818245 Bacteria 9955613
497 2932835314 2932828146 Bacteria 9745859
498 2933579284 2933577622 Bacteria 9116884
499 2935611840 2935608549 Bacteria 8203142
500 2935621692 2935616580 Bacteria 9032984
501 2935642642 2935638405 Bacteria 10015038
502 2935651915 2935648319 Bacteria 8801166
503 2935660725 2935656913 Bacteria 8965014
504 2935667745 2935665750 Bacteria 9571747
505 2935682235 2935675223 Bacteria 9928132
506 2935688491 2935684952 Bacteria 9590419
507 2935695839 2935694250 Bacteria 9291695
508 2935706585 2935703347 Bacteria 10242284
509 2935715510 2935713505 Bacteria 9608509
510 2935725926 2935722832 Bacteria 9608746
511 2935734329 2935732158 Bacteria 9706831
512 2935743708 2935741537 Bacteria 9707219
513 2935754255 2935750917 Bacteria 9590372
514 2935768384 2935760218 Bacteria 9817913
515 2935773923 2935769743 Bacteria 7878163
516 2935790960 2935785616 Bacteria 7962367
517 2935799339 2935793552 Bacteria 8012592
518 2935806448 2935801545 Bacteria 9301974
519 2935813040 2935810662 Bacteria 9401221
520 2935821319 2935819856 Bacteria 8261050
521 2935830693 2935827899 Bacteria 10038562
522 2935840720 2935837841 Bacteria 9454360
523 2935850421 2935847175 Bacteria 8228321
524 2935859939 2935855204 Bacteria 9035059
525 2935869426 2935864058 Bacteria 9784707
526 2935880413 2935873716 Bacteria 9632195
527 2935914024 2935908558 Bacteria 8568796
528 2935921192 2935916978 Bacteria 9113783
529 2935931788 2935926038 Bacteria 8601059
530 2935940277 2935934488 Bacteria 8602579
531 2935947898 2935942939 Bacteria 8599779
532 2935956561 2935951376 Bacteria 8602333
533 2935960367 2935959822 Bacteria 7869783
534 2935973355 2935967501 Bacteria 8603075
535 2935977601 2935975950 Bacteria 8347125
536 2935989516 2935984226 Bacteria 8302647
537 2935999469 2935992306 Bacteria 9802711
538 2936006549 2936002035 Bacteria 9362176
539 2936014781 2936011229 Bacteria 8801034
540 2936023422 2936019824 Bacteria 8804134
541 2936032450 2936028420 Bacteria 8965941
542 2936041628 2936037263 Bacteria 9446081
543 2936050522 2936046547 Bacteria 8903709
544 2936058986 2936055302 Bacteria 8785755
545 2940560369 2940556831 Bacteria 9590747
546 2941534208 2941531003 Bacteria 7653939
547 2941541149 2941538514 Bacteria 9402094
548 3005489528 3005483717 Bacteria 7877331
549 3005511957 3005506211 Bacteria 6943378
550 3005588676 3005587118 Bacteria 7794411
551 3005598563 3005594810 Bacteria 8716512
552 3005714231 3005710791 Bacteria 7622528
553 3005721732 3005718088 Bacteria 8283608
554 8006928704 8006926726 Bacteria 6749210
555 8016514090 8016511872 Bacteria 9921665
556 8016631708 8016630954 Bacteria 9217207
557 8017062323 8017057580 Bacteria 10023680
558 8019581778 8019576017 Bacteria 10049540
559 8019589450 8019586578 Bacteria 10212056
560 8019601814 8019597564 Bacteria 10041141
561 8019616738 8019608314 Bacteria 10042931
562 8019627436 8019619141 Bacteria 9218857
563 8019635139 8019629233 Bacteria 8687553
564 8019657603 8019648815 Bacteria 10014479
565 8019662982 8019659431 Bacteria 8577854
566 8019672580 8019668869 Bacteria 8791617
567 8019683579 8019678201 Bacteria 8863603
568 8019689318 8019687851 Bacteria 8712826
569 8055747058 8055742211 Bacteria 9226248
570 8056972820 8056967851 Bacteria 9038162
571 Ga0495673_0026536
572 JGI25153J46596_10001003
573 JGI25153J46596_10103649
574 rootH2_10122174
575 JGI25160J50197_1015385
576 JGI25160J50197_1030414
577 Ga0055539_1016852
578 Ga0055542_1019309
579 Ga0055526_1043047
580 Ga0055531_10001608
581 Ga0055543_1012515
582 Ga0055543_1065342
583 Ga0065165_1003099
584 Ga0065165_1003447
585 Ga0065165_1003661
586 Ga0065165_1031740
587 Ga0070658_10066473
588 Ga0070658_10554638
589 Ga0070670_100048064
590 Ga0070666_10585201
591 Ga0068868_101164205
592 Ga0070660_100432420
593 Ga0070660_100853862
594 Ga0070689_100635794
595 Ga0070661_100837109
596 Ga0070668_100028355
597 Ga0070669_100128847
598 Ga0070671_100074831
599 Ga0070673_100222632
600 Ga0070688_100378497
601 Ga0070667_100101974
602 Ga0070713_101211370
603 Ga0070711_100568039
604 Ga0070663_100028927
605 Ga0070662_100570378
606 Ga0068867_100207735
607 Ga0070679_101680066
608 Ga0068853_100069258
609 Ga0068853_100693893
610 Ga0070693_100992668
611 Ga0070665_100016109
612 Ga0070665_100107390
613 Ga0070665_100472416
614 Ga0068855_100164987
615 Ga0070664_100828543
616 Ga0068857_100111553
617 Ga0068856_100113971
618 Ga0068852_100352429
619 Ga0068852_100508286
620 Ga0068859_100811241
621 Ga0068861_101186287
622 Ga0068851_10184571
623 Ga0068858_100035703
624 Ga0068858_100556077
625 Ga0068862_100144859
626 Ga0081540_1048871
627 Ga0070717_10420096
628 Ga0075365_10012658
629 Ga0075365_10023412
630 Ga0075365_10076045
631 Ga0075365_10104875
632 Ga0075365_10130383
633 Ga0075365_10325992
634 Ga0075368_10026210
635 Ga0075363_100037524
636 Ga0075364_10098980
637 Ga0075362_10015736
638 Ga0075367_10047660
639 Ga0075369_10036578
640 Ga0075369_10569912
641 Ga0075366_10005406
642 Ga0075370_10005808
643 Ga0075370_10105621
644 Ga0097620_100811371
645 Ga0099823_1026469
646 Ga0105240_10050391
647 Ga0105245_10290420
648 Ga0105247_10006742
649 Ga0105247_10564435
650 Ga0105243_10469865
651 Ga0105243_10777510
652 Ga0105241_10100237
653 Ga0105241_10222004
654 Ga0105248_10035623
655 Ga0105237_10016436
656 Ga0105237_10049311
657 Ga0105237_10388926
658 Ga0105237_11316516
659 Ga0105238_10190127
660 Ga0105238_11233620
661 Ga0105249_11214541
662 Ga0105239_10354177
663 Ga0105239_10513179
664 Ga0105239_10547108
665 Ga0105239_11288554
666 Ga0105239_11693218
667 Ga0105239_11730929
668 Ga0105239_11975652
669 Ga0105246_10017794
670 Ga0105246_11282676
671 Ga0157369_11136318
672 Ga0157374_10022746
673 Ga0157374_10241474
674 Ga0157378_10425542
675 Ga0163162_10677163
676 Ga0163162_12325906
677 Ga0157375_13408457
678 Ga0163163_10012880
679 Ga0182008_10297620
680 Ga0157377_11199322
681 Ga0182006_1143908
682 Ga0214544_1010213
683 Ga0214542_1005735
684 Ga0214545_1005338
685 Ga0214543_1005480
686 Ga0209563_103703
687 Ga0207425_1006639
688 Ga0209677_102973
689 Ga0209148_1000155
690 Ga0209148_1026243
691 Ga0209233_1002355
692 Ga0209233_1011360
693 Ga0209233_1065408
694 Ga0209455_1002042
695 Ga0209564_1004534
696 Ga0209564_1020572
697 Ga0209564_1030893
698 Ga0209758_1000021
699 Ga0209758_1000371
700 Ga0209758_1001143
701 Ga0209758_1001291
702 Ga0209758_1025979
703 Ga0209758_1042076
704 Ga0209758_1096950
705 Ga0209256_1004196
706 Ga0209256_1039589
707 Ga0209256_1052800
708 Ga0207426_1000352
709 Ga0207426_1001433
710 Ga0207426_1017517
711 Ga0209051_1027992
712 Ga0209257_1001227
713 Ga0209257_1018654
714 Ga0209257_1029519
715 Ga0207688_10238498
716 Ga0207647_10001318
717 Ga0207705_10084497
718 Ga0207705_10422833
719 Ga0207705_10614150
720 Ga0207654_10156252
721 Ga0207654_10912988
722 Ga0207695_10000015
723 Ga0207695_11165027
724 Ga0207671_10001316
725 Ga0207671_10012678
726 Ga0207671_10465592
727 Ga0207663_10488020
728 Ga0207657_10688629
729 Ga0207694_10161483
730 Ga0207694_11161205
731 Ga0207650_10036616
732 Ga0207687_11197807
733 Ga0207690_10656488
734 Ga0207706_10880450
735 Ga0207709_10673607
736 Ga0207711_10357284
737 Ga0207679_10155513
738 Ga0207667_10126455
739 Ga0207712_10111339
740 Ga0207640_10405251
741 Ga0207677_10482023
742 Ga0207703_10030606
743 Ga0207703_11873271
744 Ga0207639_10095125
745 Ga0207678_10121651
746 Ga0207678_10593363
747 Ga0207702_10063812
748 Ga0207702_10455543
749 Ga0207641_10569367
750 Ga0207648_10156725
751 Ga0207674_10984159
752 Ga0207698_10292391
753 Ga0207698_10476646
754 Ga0209389_1000294
755 Ga0209489_108125
756 Ga0209700_100281
757 Ga0209813_10007243
758 Ga0209813_10460939
759 Ga0268266_10096086
760 Ga0268266_10102447
761 Ga0307517_10135720
762 Ga0307510_10120788
763 Ga0307510_10241940
764 Ga0307510_10259689
765 Ga0395900_0063555
766 Ga0395905_0058368
767 Ga0395901_1011953
768 Ga0436365_0056423
769 Ga0436365_1592141
770 Ga0439465_0390625
771 Ga0451795_1050089
772 Ga0451798_0485147
773 Ga0451853_2587175
774 Ga0466972_0000125
775 Ga0466972_0028232
776 Ga0466972_0038327
777 Ga0466972_0179122
778 Ga0466972_0389646
779 Ga0466965_0115315
780 Ga0466966_0011163
781 Ga0466961_0000015
782 Ga0466961_0374710
783 Ga0466964_0039701
784 Ga0466968_0016289
785 Ga0466970_0169910
786 Ga0466957_0266687
787 Ga0466957_0811235
788 Ga0466960_0212172
789 Ga0466959_0002982
790 Ga0466958_0104667
791 Ga0466967_0006941
792 Ga0466967_0318511
793 Ga0495592_0043072
794 Ga0495592_0681473
795 Ga0495638_0012441
796 Ga0495651_0088925
797 Ga0495653_0336306
798 Ga0495605_0099691
799 Ga0495664_0037986
800 Ga0495585_0295895
801 Ga0495596_0056256
802 Ga0495583_0066184
803 Ga0495606_0045010
804 Ga0495606_0051490
805 Ga0495606_0154527
806 Ga0495606_0241421
807 Ga0495606_0401939
808 Ga0495608_0105316
809 Ga0495610_0236749
810 Ga0495616_0005246
811 Ga0495618_0317878
812 Ga0495620_0029529
813 Ga0495620_0106674
814 Ga0495628_0104945
815 Ga0495628_0278896
816 Ga0495632_0308040
817 Ga0495643_0004410
818 Ga0495648_0038075
819 Ga0495648_0238941
820 Ga0495652_0233314
821 Ga0495652_1083967
822 Ga0495654_0403278
823 Ga0495640_0198254
824 Ga0495587_0085404
825 Ga0495609_0158108
826 Ga0495609_0385411
827 Ga0495597_0021164
828 Ga0495645_0015474
829 Ga0495622_0336905
830 Ga0495667_0017287
831 Ga0495668_0020346
832 Ga0495668_0337359
833 Ga0495634_0070533
834 Ga0495611_0295436
835 Ga0495625_0121681
836 Ga0495625_0717568
837 Ga0495635_0061725
838 Ga0495635_0082189
839 Ga0495661_0464373
840 Ga0495588_0163490
841 Ga0495657_0020857
842 Ga0495623_0019154
843 Ga0495646_0078401
844 Ga0495646_0221386
845 Ga0495613_0068599
846 Ga0495613_0356310
847 Ga0495671_0411547
848 Ga0495600_0012288
849 Ga0495600_0063412
850 Ga0495581_0843996
851 Ga0495604_0001482
852 Ga0495604_0013135
853 Ga0495674_0047238
854 Ga0495680_0007846
855 Ga0495683_0029795
856 Ga0495687_004598
857 Ga0495673_0225882
858 Ga0495684_0561998
859 Ga0495686_0078071
860 Ga0495593_0216827
861 Ga0495602_0079951
862 Ga0495602_0220005
863 Ga0495602_0226796
864 Ga0495626_0172852
865 Ga0495626_0243125
866 Ga0496101_0513211
867 Ga0496101_0513760
868 Ga0496102_0012960
869 Ga0496102_0062380
870 Ga0496103_0007098
871 Ga0496104_0018314
872 Ga0496104_0018831
873 Ga0496105_0054857
874 Ga0496106_0107463
875 Ga0496106_0186401
876 Ga0496107_0126864
877 Ga0496107_0213793
878 Ga0496108_0021180
879 Ga0496108_0770542
880 Ga0496108_1156959
881 Ga0496109_0027198
882 Ga0496110_0008469
883 Ga0496111_0071912
884 Ga0496112_0067055
885 Ga0496112_0109745
886 Ga0496113_0044808
887 Ga0496113_0088990
888 Ga0496113_0516916
889 Ga0496114_0392816
890 Ga0496116_0060322
891 Ga0496116_0074889
892 Ga0496117_0069958
893 Ga0496117_0119529
894 Ga0496118_0014167
895 Ga0496118_0191542
896 Ga0496118_0279548
897 Ga0496118_0333412
898 Ga0496119_0015342
899 Ga0496119_0021247
900 Ga0496120_0052883
901 Ga0496121_0062820
902 Ga0496121_0123574
903 Ga0496121_0228865
904 Ga0496121_0406339
905 Ga0496122_0079859
906 Ga0496124_0013689
907 Ga0496124_0596987
908 Ga0496125_0099025
909 Ga0496126_0229883
910 Ga0496126_0258383
911 Ga0496126_0478015
912 Ga0496126_0988975
913 Ga0495682_0137350
914 Ga0495682_0316074
915 nmdc:mga03n38_154039_c1
916 nmdc:mga03n38_305795_c1
917 nmdc:mga00v17_152333_c1
918 nmdc:mga0yw44_1054129_c1
919 nmdc:mga0yw44_157282_c1
920 nmdc:mga0yw44_22477_c1
921 nmdc:mga0yw44_377011_c1
922 nmdc:mga0yw44_397689_c1
923 nmdc:mga0yw44_491404_c1
924 nmdc:mga0yw44_74932_c1
925 nmdc:mga0k408_5700_c2
926 nmdc:mga06z11_191345_c1
927 nmdc:mga04h51_14433_c1
928 nmdc:mga04h51_498233_c1
929 nmdc:mga07m45_357397_c1
930 nmdc:mga07m45_77443_c1
931 nmdc:mga0sz30_105833_c1
932 nmdc:mga0sz30_12570_c1
933 nmdc:mga0sz30_7893_c1
934 Ga0500610_0229660
935 Ga0495595_0092146
936 Ga0495619_0416979
937 Ga0500578_0227325
938 Ga0500578_0266628
939 Ga0500578_0463171
940 Ga0500643_000156
941 Ga0500646_0166973
942 Ga0500646_0262885
943 Ga0500647_0065697
944 Ga0500583_0009616
945 Ga0500640_115796
946 Ga0500641_0044190
947 Ga0500650_0118158
948 Ga0500650_0126347
949 Ga0500555_003461
950 Ga0500556_0005401
951 Ga0500557_000024
952 Ga0500562_016808
953 Ga0500572_014337
954 Ga0500592_005513
955 Ga0500595_215168
956 Ga0500597_256345
957 Ga0500607_069240
958 Ga0500621_185833
959 Ga0500626_331624
960 Ga0500652_053096
961 Ga0500655_013856
962 Ga0500658_0055340
963 Ga0500658_0273935
964 Ga0500568_0004084
965 Ga0500568_0262795
966 Ga0500577_0004805
967 Ga0500589_103492
968 Ga0500603_167328
969 Ga0500604_0011190
970 Ga0500616_0024881
971 Ga0500619_028017
972 Ga0500620_069333
973 Ga0500622_0013797
974 Ga0500627_0019998
975 Ga0500633_0237612
976 Ga0500638_061427
977 Ga0500636_0004844
978 Ga0500636_0374725
979 Ga0500637_0039139
980 Ga0500625_062452
981 Ga0500645_119120
982 Ga0500599_003756
983 Ga0500601_000221
984 Ga0500661_067935
985 2507509255
986 2508543324
987 2508698909
988 2511394286
989 2513625747
990 2513646739
991 2513700597
992 2513876537
993 2514010881
994 2515626671
995 2517101917
996 2528857538
997 2617352868
998 2617376391
999 2745079273
1000 2793063964
1001 2805919816
1002 2818242909
1003 2824606017
1004 2824615956
1005 2824625576
1006 2824634261
1007 2824641732
1008 2824652001
1009 2824660340
1010 2824669112
1011 2824675468
1012 2824683501
1013 2824691647
1014 2824699409
1015 2824711228
1016 2824722271
1017 2824732571
1018 2824738258
1019 2824751887
1020 2824762011
1021 2824772468
1022 2824779356
1023 2838126461
1024 2841943490
1025 2841950562
1026 2841958054
1027 2841966877
1028 2841975626
1029 2841989988
1030 2842039678
1031 2842047376
1032 2844318459
1033 2847935343
1034 2847945942
1035 2849079934
1036 2857510709
1037 2874597378
1038 2874616429
1039 2874626708
1040 2874631134
1041 2874649288
1042 2876777825
1043 2876823154
1044 2879078582
1045 2879088584
1046 2879108035
1047 2879132941
1048 2879148740
1049 2881366767
1050 2885371850
1051 2888383403
1052 2888394520
1053 2888423804
1054 2903730177
1055 2904668286
1056 2904717248
1057 2906603561
1058 2906646329
1059 2908779507
1060 2922373595
1061 2922395719
1062 2929617327
1063 2929627032
1064 2932787659
1065 2932813186
1066 2932820899
1067 2932835314
1068 2933579284
1069 2935611840
1070 2935621692
1071 2935642642
1072 2935651915
1073 2935660725
1074 2935667745
1075 2935682235
1076 2935688491
1077 2935695839
1078 2935706585
1079 2935715510
1080 2935725926
1081 2935734329
1082 2935743708
1083 2935754255
1084 2935768384
1085 2935773923
1086 2935790960
1087 2935799339
1088 2935806448
1089 2935813040
1090 2935821319
1091 2935830693
1092 2935840720
1093 2935850421
1094 2935859939
1095 2935869426
1096 2935880413
1097 2935914024
1098 2935921192
1099 2935931788
1100 2935940277
1101 2935947898
1102 2935956561
1103 2935960367
1104 2935973355
1105 2935977601
1106 2935989516
1107 2935999469
1108 2936006549
1109 2936014781
1110 2936023422
1111 2936032450
1112 2936041628
1113 2936050522
1114 2936058986
1115 2940560369
1116 2941534208
1117 2941541149
1118 3005489528
1119 3005511957
1120 3005588676
1121 3005598563
1122 3005714231
1123 3005721732
1124 8006928704
1125 8016514090
1126 8016631708
1127 8017062323
1128 8019581778
1129 8019589450
1130 8019601814
1131 8019616738
1132 8019627436
1133 8019635139
1134 8019657603
1135 8019662982
1136 8019672580
1137 8019683579
1138 8019689318
1139 8055747058
1140 8056972820

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13474

SnoaL_3

SnoaL-like domain

9

126

0.91

PF14534

DUF4440

Domain of unknown function (DUF4440)

9

116

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ask-assembly1.cif.gz_B nuclear transport factor 2 (ntf2) h66a mutant 0.8685 2 121
7o21-assembly1.cif.gz_B structure of bdellovibrio bacteriovorus bd1075 0.8657 6 123
1ar0-assembly1.cif.gz_B nuclear transport factor 2 (ntf2) e42k mutant 0.8589 2 126
1qma-assembly1.cif.gz_A nuclear transport factor 2 (ntf2) w7a mutant 0.8543 1 121
7o21-assembly1.cif.gz_A structure of bdellovibrio bacteriovorus bd1075 0.8539 6 125
ID Description Score Start End Superfamily
af_G5ECA7_6_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8619 3 122 3.10.450.50
af_G5ECA7_6_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8555 3 122 3.10.450.50
af_Q4D7W2_1_120_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8478 3 125 3.10.450.50
af_Q7KPV8_5_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8434 2 122 3.10.450.50
af_Q4D7W2_1_120_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8415 3 125 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1L3FEE7-F1-model_v4 DUF4440 domain-containing protein 0.9249 1 128
AF-A0A174HJT2-F1-model_v4 Uncharacterized protein conserved in bacteria 0.9139 65 125
AF-A0A270BGS0-F1-model_v4 SnoaL-like domain-containing protein 0.9015 7 125
AF-A0A1M5J7Q0-F1-model_v4 SnoaL-like domain-containing protein 0.9001 1 128
AF-A0A1M5J7Q0-F1-model_v4 SnoaL-like domain-containing protein 0.8933 1 128

Map