F464851

General Info

Members Datasets Scaffolds Average Seq Length
570 316 1140 229

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0000439|Ga0439448_0000439_6002_6691
Length 229
Sequence MATRTDPDPAPRLPLTRERVLRAAVALADREGVAVSMRKLAKELGVEAMSLYHHVAGKNALLDGMVDHVFSEIDLPAAEQGWKAAMRQRAISARAALRRHPWAIALMESRSTPGPANLRHHDAVIGCLRQAGFSVALTAHAYSILDAYIYGFALQEASLPFDTPEETAELAESIMADFPAADAYPHLAELATRHVLQPGYDYGDEYEFGLSLILDGLERAASAPGGREP

Samples

Sample ID Description Type Environment
1 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
218 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
219 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
223 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
224 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
225 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
226 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
227 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
228 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
229 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
230 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
231 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
234 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
235 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
314 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
315 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
316 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.53
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 2.11
Rhizosphere 96.49
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439448_0000439 3300042005 Bacteria 9561
2 JGI25407J50210_10040672 3300003373 Bacteria 1191
3 Ga0070658_10004100 3300005327 Bacteria 11939
4 Ga0070658_10399335 3300005327 Bacteria 1181
5 Ga0070676_10013449 3300005328 Bacteria 4485
6 Ga0070683_100014490 3300005329 Bacteria 6899
7 Ga0070683_100269243 3300005329 Bacteria 1620
8 Ga0070690_100214320 3300005330 Bacteria 1346
9 Ga0070670_100051674 3300005331 Bacteria 3529
10 Ga0070670_100678892 3300005331 Bacteria 925
11 Ga0068869_100005238 3300005334 Bacteria 8145
12 Ga0068869_100088597 3300005334 Bacteria 2323
13 Ga0068869_100226006 3300005334 Bacteria 1485
14 Ga0070666_10041017 3300005335 Bacteria 3091
15 Ga0070680_100337253 3300005336 Bacteria 1281
16 Ga0070680_100512813 3300005336 Bacteria 1026
17 Ga0070682_100005314 3300005337 Bacteria 7167
18 Ga0070682_100017663 3300005337 Bacteria 4161
19 Ga0070682_100018883 3300005337 Bacteria 4038
20 Ga0068868_100047712 3300005338 Bacteria 3358
21 Ga0068868_100425740 3300005338 Bacteria 1150
22 Ga0070660_100020031 3300005339 Bacteria 4910
23 Ga0070689_100047294 3300005340 Bacteria 3318
24 Ga0070689_100099729 3300005340 Bacteria 2298
25 Ga0070691_10159483 3300005341 Bacteria 1162
26 Ga0070661_100002385 3300005344 Bacteria 12889
27 Ga0070661_100021596 3300005344 Bacteria 4599
28 Ga0070661_100042335 3300005344 Bacteria 3324
29 Ga0070692_10010336 3300005345 Bacteria 4242
30 Ga0070668_100148762 3300005347 Bacteria 1892
31 Ga0070668_100193083 3300005347 Bacteria 1668
32 Ga0070675_100004355 3300005354 Bacteria 10792
33 Ga0070675_100009168 3300005354 Bacteria 7686
34 Ga0070671_100008795 3300005355 Bacteria 8098
35 Ga0070671_100445668 3300005355 Bacteria 1110
36 Ga0070674_100038807 3300005356 Bacteria 3212
37 Ga0070688_100313860 3300005365 Bacteria 1137
38 Ga0070659_100001561 3300005366 Bacteria 16505
39 Ga0070659_100143724 3300005366 Bacteria 1943
40 Ga0070659_100220376 3300005366 Bacteria 1565
41 Ga0070667_100017709 3300005367 Bacteria 5904
42 Ga0070667_100168431 3300005367 Bacteria 1933
43 Ga0070667_100232702 3300005367 Bacteria 1643
44 Ga0070703_10061417 3300005406 Bacteria 1231
45 Ga0070709_10068848 3300005434 Bacteria 2277
46 Ga0070714_100038604 3300005435 Bacteria 4015
47 Ga0070714_100116955 3300005435 Bacteria 2367
48 Ga0070713_100424766 3300005436 Bacteria 1245
49 Ga0070713_100903558 3300005436 Bacteria 849
50 Ga0070710_10009186 3300005437 Bacteria 4832
51 Ga0070701_10047673 3300005438 Bacteria 2207
52 Ga0070701_10061781 3300005438 Bacteria 1976
53 Ga0070701_10564347 3300005438 Bacteria 749
54 Ga0070711_100107746 3300005439 Bacteria 2040
55 Ga0070705_100048509 3300005440 Bacteria 2460
56 Ga0070700_100059149 3300005441 Bacteria 2411
57 Ga0070700_100305650 3300005441 Bacteria 1163
58 Ga0070694_100019400 3300005444 Bacteria 4323
59 Ga0070694_100064109 3300005444 Bacteria 2515
60 Ga0070663_100141195 3300005455 Bacteria 1839
61 Ga0070663_100208406 3300005455 Bacteria 1529
62 Ga0070678_100078375 3300005456 Bacteria 2496
63 Ga0070662_100044023 3300005457 Bacteria 3197
64 Ga0070681_10044150 3300005458 Bacteria 4461
65 Ga0070681_10217114 3300005458 Bacteria 1828
66 Ga0070681_10378783 3300005458 Bacteria 1325
67 Ga0068867_100145801 3300005459 Bacteria 1855
68 Ga0070685_10003042 3300005466 Bacteria 8545
69 Ga0070706_100006002 3300005467 Bacteria 11478
70 Ga0070706_100030772 3300005467 Bacteria 4947
71 Ga0070706_100370815 3300005467 Bacteria 1334
72 Ga0070707_100000599 3300005468 Bacteria 36185
73 Ga0070707_100004244 3300005468 Bacteria 13416
74 Ga0070707_100025495 3300005468 Bacteria 5609
75 Ga0070707_100235895 3300005468 Bacteria 1780
76 Ga0070707_100243936 3300005468 Bacteria 1748
77 Ga0070698_100006146 3300005471 Bacteria 13078
78 Ga0070698_100137863 3300005471 Bacteria 2393
79 Ga0070699_100000850 3300005518 Bacteria 28324
80 Ga0070699_100036461 3300005518 Bacteria 4254
81 Ga0070679_100010211 3300005530 Bacteria 8900
82 Ga0070679_100132803 3300005530 Bacteria 2470
83 Ga0070679_100155885 3300005530 Bacteria 2258
84 Ga0070679_100193748 3300005530 Bacteria 2000
85 Ga0070684_100006712 3300005535 Bacteria 8923
86 Ga0070684_100087699 3300005535 Bacteria 2763
87 Ga0070684_100354942 3300005535 Bacteria 1349
88 Ga0070697_100520788 3300005536 Bacteria 1041
89 Ga0068853_100126929 3300005539 Bacteria 2279
90 Ga0068853_100148646 3300005539 Bacteria 2107
91 Ga0070672_100123154 3300005543 Bacteria 2125
92 Ga0070686_100027522 3300005544 Bacteria 3441
93 Ga0070695_100031113 3300005545 Bacteria 3325
94 Ga0070695_100081326 3300005545 Bacteria 2143
95 Ga0070695_100086635 3300005545 Bacteria 2082
96 Ga0070696_100011622 3300005546 Bacteria 5897
97 Ga0070696_100017229 3300005546 Bacteria 4874
98 Ga0070696_100375140 3300005546 Bacteria 1107
99 Ga0070696_100435896 3300005546 Bacteria 1031
100 Ga0070693_100004205 3300005547 Bacteria 6801
101 Ga0070665_100042717 3300005548 Bacteria 4557
102 Ga0070704_100112948 3300005549 Unclassified 2071
103 Ga0068855_100197469 3300005563 Bacteria 2266
104 Ga0068855_100255590 3300005563 Bacteria 1953
105 Ga0070664_100013779 3300005564 Bacteria 6590
106 Ga0070664_100133283 3300005564 Bacteria 2183
107 Ga0070664_100355958 3300005564 Bacteria 1332
108 Ga0068857_100039826 3300005577 Bacteria 4165
109 Ga0068857_100089832 3300005577 Bacteria 2749
110 Ga0068857_100458539 3300005577 Bacteria 1192
111 Ga0068854_100032384 3300005578 Bacteria 3637
112 Ga0068854_100244768 3300005578 Bacteria 1429
113 Ga0068854_100403226 3300005578 Bacteria 1132
114 Ga0068854_100438759 3300005578 Bacteria 1088
115 Ga0068856_100130322 3300005614 Bacteria 2519
116 Ga0070702_100014133 3300005615 Bacteria 4045
117 Ga0068852_100003270 3300005616 Bacteria 11313
118 Ga0068852_100018594 3300005616 Bacteria 5476
119 Ga0068852_100047739 3300005616 Bacteria 3655
120 Ga0068852_100227612 3300005616 Bacteria 1776
121 Ga0068852_100495872 3300005616 Bacteria 1215
122 Ga0068859_100059026 3300005617 Bacteria 3865
123 Ga0068859_100364375 3300005617 Bacteria 1540
124 Ga0068864_100052777 3300005618 Bacteria 3505
125 Ga0068864_100388910 3300005618 Bacteria 1323
126 Ga0068866_10084356 3300005718 Bacteria 1714
127 Ga0068861_100393588 3300005719 Bacteria 1228
128 Ga0068861_100546208 3300005719 Bacteria 1055
129 Ga0068851_10008364 3300005834 Bacteria 4782
130 Ga0068870_10003223 3300005840 Bacteria 6887
131 Ga0068863_100005624 3300005841 Bacteria 12314
132 Ga0068863_100097522 3300005841 Bacteria 2791
133 Ga0068863_100381062 3300005841 Bacteria 1377
134 Ga0068858_100015256 3300005842 Bacteria 7229
135 Ga0068860_100426413 3300005843 Bacteria 1315
136 Ga0068862_100864245 3300005844 Bacteria 887
137 Ga0081538_10004615 3300005981 Bacteria 12649
138 Ga0081538_10007125 3300005981 Bacteria 9714
139 Ga0081539_10000573 3300005985 Bacteria 76094
140 Ga0081539_10005602 3300005985 Bacteria 12656
141 Ga0070717_10275029 3300006028 Bacteria 1492
142 Ga0075432_10014202 3300006058 Bacteria 2711
143 Ga0070712_100029247 3300006175 Bacteria 3692
144 Ga0097621_100107535 3300006237 Bacteria 2354
145 Ga0097621_100153042 3300006237 Bacteria 1978
146 Ga0075370_10111373 3300006353 Bacteria 1590
147 Ga0068871_100040053 3300006358 Bacteria 3752
148 Ga0075428_100085686 3300006844 Bacteria 3436
149 Ga0075428_100548343 3300006844 Bacteria 1236
150 Ga0075430_100070185 3300006846 Bacteria 2939
151 Ga0075430_100087630 3300006846 Bacteria 2605
152 Ga0075433_10014770 3300006852 Bacteria 6392
153 Ga0075433_10029988 3300006852 Bacteria 4637
154 Ga0075433_10344621 3300006852 Bacteria 1317
155 Ga0075434_100005039 3300006871 Bacteria 11997
156 Ga0075434_100079830 3300006871 Bacteria 3268
157 Ga0075434_100219367 3300006871 Bacteria 1921
158 Ga0068865_100012745 3300006881 Bacteria 5300
159 Ga0068865_100344712 3300006881 Bacteria 1205
160 Ga0075436_100009457 3300006914 Bacteria 6662
161 Ga0075436_100022484 3300006914 Bacteria 4331
162 Ga0097620_100059027 3300006931 Bacteria 3865
163 Ga0097620_100364375 3300006931 Bacteria 1540
164 Ga0075435_100004261 3300007076 Bacteria 9826
165 Ga0075435_100062026 3300007076 Bacteria 3034
166 Ga0099794_10277107 3300007265 Bacteria 867
167 Ga0105251_10081207 3300009011 Bacteria 1498
168 Ga0105240_10434435 3300009093 Bacteria 1472
169 Ga0111539_10053701 3300009094 Bacteria 4796
170 Ga0105245_10014174 3300009098 Bacteria 6948
171 Ga0105245_10042191 3300009098 Bacteria 4070
172 Ga0105245_10775995 3300009098 Bacteria 995
173 Ga0105247_10114484 3300009101 Bacteria 1740
174 Ga0114129_10249663 3300009147 Bacteria 2382
175 Ga0114129_10498390 3300009147 Bacteria 1591
176 Ga0105243_10003812 3300009148 Bacteria 12062
177 Ga0105243_10071017 3300009148 Bacteria 2814
178 Ga0105243_10194570 3300009148 Bacteria 1774
179 Ga0105241_10562556 3300009174 Bacteria 1025
180 Ga0105242_10004004 3300009176 Bacteria 11449
181 Ga0105248_10004471 3300009177 Bacteria 15472
182 Ga0105248_10093649 3300009177 Bacteria 3383
183 Ga0105237_10022785 3300009545 Bacteria 6426
184 Ga0105237_10166533 3300009545 Bacteria 2203
185 Ga0105237_10469267 3300009545 Bacteria 1265
186 Ga0105238_10362634 3300009551 Bacteria 1439
187 Ga0105238_10442102 3300009551 Bacteria 1297
188 Ga0105249_10038868 3300009553 Bacteria 4319
189 Ga0105249_10211162 3300009553 Bacteria 1905
190 Ga0105239_10035908 3300010375 Bacteria 5442
191 Ga0105239_10244187 3300010375 Bacteria 2016
192 Ga0105239_10909276 3300010375 Bacteria 1010
193 Ga0105246_10031761 3300011119 Bacteria 3496
194 Ga0105246_10034717 3300011119 Bacteria 3363
195 Ga0105246_10115468 3300011119 Bacteria 1980
196 Ga0157338_1004866 3300012515 Bacteria 1182
197 Ga0157371_10057864 3300013102 Bacteria 2750
198 Ga0157374_10068405 3300013296 Bacteria 3341
199 Ga0157374_10222991 3300013296 Bacteria 1850
200 Ga0157372_10097467 3300013307 Bacteria 3354
201 Ga0157372_10364964 3300013307 Bacteria 1683
202 Ga0157372_10372619 3300013307 Bacteria 1664
203 Ga0157375_10203047 3300013308 Bacteria 2138
204 Ga0163163_10194567 3300014325 Bacteria 2076
205 Ga0157380_10052390 3300014326 Bacteria 3231
206 Ga0157380_10184690 3300014326 Bacteria 1835
207 Ga0182008_10162915 3300014497 Bacteria 1123
208 Ga0157377_10035496 3300014745 Bacteria 2735
209 Ga0157376_10253065 3300014969 Bacteria 1646
210 Ga0206353_10313762 3300020082 Bacteria 5098
211 Ga0206353_10523475 3300020082 Bacteria 1345
212 Ga0228598_1051842 3300024227 Bacteria 814
213 Ga0207656_10013112 3300025321 Bacteria 3162
214 Ga0207713_1053831 3300025735 Bacteria 1582
215 Ga0207713_1103174 3300025735 Bacteria 981
216 Ga0207653_10016628 3300025885 Bacteria 2311
217 Ga0207692_10039409 3300025898 Bacteria 2324
218 Ga0207642_10036167 3300025899 Bacteria 2117
219 Ga0207688_10003888 3300025901 Bacteria 8147
220 Ga0207688_10029561 3300025901 Bacteria 3018
221 Ga0207688_10044161 3300025901 Bacteria 2484
222 Ga0207680_10136622 3300025903 Bacteria 1621
223 Ga0207680_10431487 3300025903 Bacteria 934
224 Ga0207685_10051562 3300025905 Bacteria 1590
225 Ga0207699_10022364 3300025906 Bacteria 3424
226 Ga0207699_10257801 3300025906 Bacteria 1204
227 Ga0207645_10020300 3300025907 Bacteria 4350
228 Ga0207643_10005530 3300025908 Bacteria 6753
229 Ga0207643_10041063 3300025908 Bacteria 2606
230 Ga0207705_10022944 3300025909 Bacteria 4450
231 Ga0207705_10028415 3300025909 Bacteria 3986
232 Ga0207705_10068401 3300025909 Bacteria 2571
233 Ga0207684_10001902 3300025910 Bacteria 21686
234 Ga0207684_10177357 3300025910 Bacteria 1837
235 Ga0207654_10001930 3300025911 Bacteria 10746
236 Ga0207654_10075959 3300025911 Bacteria 2009
237 Ga0207654_10344039 3300025911 Bacteria 1025
238 Ga0207654_10541490 3300025911 Bacteria 826
239 Ga0207707_10045182 3300025912 Bacteria 3838
240 Ga0207671_10014285 3300025914 Bacteria 6280
241 Ga0207671_10292799 3300025914 Bacteria 1285
242 Ga0207663_10065740 3300025916 Bacteria 2319
243 Ga0207660_10054427 3300025917 Bacteria 2856
244 Ga0207660_10466912 3300025917 Bacteria 1022
245 Ga0207662_10064502 3300025918 Bacteria 2204
246 Ga0207657_10013826 3300025919 Bacteria 7899
247 Ga0207657_10059082 3300025919 Bacteria 3297
248 Ga0207657_10068617 3300025919 Bacteria 3011
249 Ga0207649_10019878 3300025920 Bacteria 3844
250 Ga0207652_10079605 3300025921 Bacteria 2863
251 Ga0207652_10100441 3300025921 Bacteria 2554
252 Ga0207652_10552830 3300025921 Bacteria 1034
253 Ga0207652_10946581 3300025921 Bacteria 759
254 Ga0207646_10003079 3300025922 Bacteria 19177
255 Ga0207646_10009922 3300025922 Bacteria 9364
256 Ga0207646_10284818 3300025922 Bacteria 1493
257 Ga0207646_10310923 3300025922 Bacteria 1424
258 Ga0207694_10265074 3300025924 Bacteria 1408
259 Ga0207694_10312397 3300025924 Bacteria 1296
260 Ga0207650_10011227 3300025925 Bacteria 6161
261 Ga0207659_10031804 3300025926 Bacteria 3616
262 Ga0207659_10080637 3300025926 Bacteria 2404
263 Ga0207687_10007643 3300025927 Bacteria 7107
264 Ga0207687_10277212 3300025927 Bacteria 1343
265 Ga0207700_10014168 3300025928 Bacteria 5216
266 Ga0207700_10501141 3300025928 Bacteria 1074
267 Ga0207664_10028335 3300025929 Bacteria 4255
268 Ga0207664_10120473 3300025929 Bacteria 2195
269 Ga0207664_10542384 3300025929 Bacteria 1043
270 Ga0207644_10206930 3300025931 Bacteria 1550
271 Ga0207690_10001177 3300025932 Bacteria 16551
272 Ga0207690_10116018 3300025932 Bacteria 1936
273 Ga0207690_10604821 3300025932 Bacteria 895
274 Ga0207706_10020971 3300025933 Bacteria 5868
275 Ga0207706_10060998 3300025933 Bacteria 3321
276 Ga0207706_10128232 3300025933 Bacteria 2231
277 Ga0207686_10028609 3300025934 Bacteria 3278
278 Ga0207709_10089757 3300025935 Bacteria 2005
279 Ga0207709_10483959 3300025935 Bacteria 963
280 Ga0207709_10873845 3300025935 Bacteria 729
281 Ga0207669_10029924 3300025937 Bacteria 3019
282 Ga0207704_10014197 3300025938 Bacteria 4015
283 Ga0207704_10142910 3300025938 Bacteria 1677
284 Ga0207665_10201174 3300025939 Bacteria 1451
285 Ga0207691_10053995 3300025940 Bacteria 3666
286 Ga0207691_10076464 3300025940 Bacteria 3017
287 Ga0207711_10037807 3300025941 Bacteria 4102
288 Ga0207711_10173142 3300025941 Bacteria 1960
289 Ga0207689_10010561 3300025942 Bacteria 7950
290 Ga0207689_10039689 3300025942 Bacteria 3897
291 Ga0207661_10002328 3300025944 Bacteria 13086
292 Ga0207661_10019623 3300025944 Bacteria 5044
293 Ga0207661_10040903 3300025944 Bacteria 3647
294 Ga0207661_10239302 3300025944 Bacteria 1610
295 Ga0207679_10007835 3300025945 Bacteria 6786
296 Ga0207679_10266137 3300025945 Bacteria 1464
297 Ga0207667_10043067 3300025949 Bacteria 4792
298 Ga0207667_10262131 3300025949 Bacteria 1767
299 Ga0207667_10609657 3300025949 Bacteria 1100
300 Ga0207651_10019748 3300025960 Bacteria 4048
301 Ga0207712_10029103 3300025961 Bacteria 3702
302 Ga0207712_10093158 3300025961 Bacteria 2222
303 Ga0207668_10100298 3300025972 Bacteria 2150
304 Ga0207640_10005842 3300025981 Bacteria 6713
305 Ga0207640_10306712 3300025981 Bacteria 1258
306 Ga0207658_10017773 3300025986 Bacteria 4899
307 Ga0207658_10090214 3300025986 Bacteria 2375
308 Ga0207658_10422391 3300025986 Bacteria 1176
309 Ga0207677_10045835 3300026023 Bacteria 2922
310 Ga0207677_10071450 3300026023 Bacteria 2450
311 Ga0207677_10111103 3300026023 Bacteria 2041
312 Ga0207703_10061475 3300026035 Bacteria 3075
313 Ga0207639_10020320 3300026041 Bacteria 4751
314 Ga0207678_10004579 3300026067 Bacteria 12437
315 Ga0207678_10006554 3300026067 Bacteria 10319
316 Ga0207708_10004728 3300026075 Bacteria 10019
317 Ga0207708_10183153 3300026075 Bacteria 1663
318 Ga0207708_10519827 3300026075 Bacteria 1000
319 Ga0207702_10006891 3300026078 Bacteria 9734
320 Ga0207702_10051036 3300026078 Bacteria 3494
321 Ga0207702_10058614 3300026078 Bacteria 3277
322 Ga0207702_10447172 3300026078 Bacteria 1253
323 Ga0207641_10136976 3300026088 Bacteria 2205
324 Ga0207648_10097920 3300026089 Bacteria 2567
325 Ga0207676_10009026 3300026095 Bacteria 7097
326 Ga0207674_10010832 3300026116 Bacteria 10280
327 Ga0207674_10075231 3300026116 Bacteria 3387
328 Ga0207674_10078506 3300026116 Bacteria 3306
329 Ga0207674_10276867 3300026116 Bacteria 1626
330 Ga0207675_100030454 3300026118 Bacteria 5026
331 Ga0207675_100071643 3300026118 Bacteria 3241
332 Ga0207675_100088917 3300026118 Bacteria 2902
333 Ga0207675_100194664 3300026118 Bacteria 1946
334 Ga0207683_10003830 3300026121 Bacteria 13033
335 Ga0207683_10018962 3300026121 Bacteria 5870
336 Ga0207698_10000255 3300026142 Bacteria 32639
337 Ga0207698_10662284 3300026142 Bacteria 1035
338 Ga0207428_10008872 3300027907 Bacteria 9060
339 Ga0207428_10057411 3300027907 Bacteria 3090
340 Ga0207428_10136479 3300027907 Bacteria 1875
341 Ga0268266_10541318 3300028379 Bacteria 1115
342 Ga0268265_10342434 3300028380 Bacteria 1362
343 Ga0268264_10393677 3300028381 Bacteria 1330
344 Ga0265760_10036133 3300031090 Bacteria 1465
345 Ga0265340_10000633 3300031247 Bacteria 19679
346 Ga0307513_10035352 3300031456 Bacteria 5591
347 Ga0307408_100028288 3300031548 Bacteria 3873
348 Ga0307408_100119329 3300031548 Bacteria 2041
349 Ga0307408_100205037 3300031548 Bacteria 1599
350 Ga0316576_10084503 3300031727 Bacteria 2359
351 Ga0307405_10001757 3300031731 Bacteria 9266
352 Ga0307405_10213995 3300031731 Bacteria 1409
353 Ga0307413_10024546 3300031824 Bacteria 3289
354 Ga0307410_10013234 3300031852 Bacteria 4805
355 Ga0307410_10277047 3300031852 Bacteria 1315
356 Ga0307406_10017864 3300031901 Bacteria 4137
357 Ga0307406_10366204 3300031901 Bacteria 1132
358 Ga0307406_10963121 3300031901 Bacteria 730
359 Ga0307407_10127512 3300031903 Bacteria 1623
360 Ga0307407_10297343 3300031903 Bacteria 1124
361 Ga0307407_10758816 3300031903 Bacteria 735
362 Ga0307412_10109455 3300031911 Bacteria 1970
363 Ga0307412_10355856 3300031911 Bacteria 1177
364 Ga0307412_10801343 3300031911 Bacteria 818
365 Ga0307409_100021961 3300031995 Bacteria 4389
366 Ga0307409_100022348 3300031995 Bacteria 4359
367 Ga0307409_100071479 3300031995 Bacteria 2759
368 Ga0307409_100305466 3300031995 Bacteria 1482
369 Ga0307409_100564057 3300031995 Bacteria 1120
370 Ga0307416_100057086 3300032002 Bacteria 3155
371 Ga0307416_100174659 3300032002 Bacteria 2005
372 Ga0307416_100187501 3300032002 Bacteria 1946
373 Ga0307416_100291732 3300032002 Bacteria 1615
374 Ga0307414_10436398 3300032004 Bacteria 1145
375 Ga0307411_10079136 3300032005 Bacteria 2256
376 Ga0307411_10149482 3300032005 Bacteria 1734
377 Ga0307411_10743057 3300032005 Bacteria 859
378 Ga0307415_100133081 3300032126 Bacteria 1886
379 Ga0307415_100212790 3300032126 Bacteria 1543
380 Ga0373926_0029773 3300035083 Bacteria 1920
381 Ga0373934_0000186 3300035086 Bacteria 22808
382 Ga0373923_0008371 3300035111 Bacteria 3684
383 Ga0373923_0025783 3300035111 Bacteria 2333
384 Ga0373923_0175685 3300035111 Bacteria 982
385 Ga0373945_0026543 3300035116 Bacteria 2018
386 Ga0373953_0000637 3300035117 Bacteria 9734
387 Ga0373953_0029441 3300035117 Bacteria 2123
388 Ga0373954_0001768 3300035118 Bacteria 8880
389 Ga0373954_0067512 3300035118 Bacteria 1694
390 Ga0373956_0002082 3300035119 Bacteria 8293
391 Ga0373956_0006467 3300035119 Bacteria 4699
392 Ga0373957_0000515 3300035120 Bacteria 9741
393 Ga0373957_0004920 3300035120 Bacteria 4108
394 Ga0373943_0025244 3300035170 Bacteria 2777
395 Ga0373955_0000006 3300035172 Bacteria 101050
396 Ga0373955_0001455 3300035172 Bacteria 10053
397 Ga0373955_0071028 3300035172 Bacteria 1946
398 Ga0373955_0250820 3300035172 Bacteria 1061
399 Ga0373924_0004890 3300035410 Bacteria 4708
400 Ga0373924_0025708 3300035410 Bacteria 2328
401 Ga0373927_0161625 3300035695 Bacteria 1467
402 Ga0373933_0000463 3300035724 Bacteria 25388
403 Ga0373933_0001318 3300035724 Bacteria 14588
404 Ga0373937_0000731 3300036401 Bacteria 28392
405 Ga0373937_0015060 3300036401 Bacteria 6831
406 Ga0373925_0026416 3300037068 Bacteria 4248
407 Ga0373925_0080041 3300037068 Bacteria 2483
408 Ga0395900_0098016 3300037418 Bacteria 3012
409 Ga0395901_0186709 3300038443 Bacteria 2174
410 Ga0395901_0258319 3300038443 Bacteria 1813
411 Ga0395901_0268814 3300038443 Bacteria 1774
412 Ga0395901_0606863 3300038443 Unclassified 1103
413 Ga0439439_0037199 3300041406 Bacteria 1254
414 Ga0451793_0276978 3300041452 Bacteria 1365
415 Ga0451833_1121258 3300041491 Bacteria 1947
416 Ga0451841_0113861 3300041498 Bacteria 3799
417 Ga0451851_1202267 3300041507 Bacteria 1654
418 Ga0451853_2821443 3300041512 Bacteria 1416
419 Ga0439449_0019454 3300042007 Bacteria 2545
420 Ga0439450_000771 3300042008 Bacteria 4369
421 Ga0439450_040029 3300042008 Bacteria 1085
422 Ga0439454_000293 3300042011 Bacteria 3698
423 Ga0439457_001086 3300042014 Bacteria 8205
424 Ga0439463_001394 3300042016 Bacteria 6425
425 Ga0439463_031926 3300042016 Bacteria 1330
426 Ga0450913_001082 3300042117 Bacteria 1406
427 Ga0450917_006124 3300042120 Bacteria 903
428 Ga0450890_026463 3300042127 Bacteria 808
429 Ga0450902_001590 3300042137 Bacteria 3117
430 Ga0439458_0005004 3300042157 Bacteria 2999
431 Ga0439444_0000868 3300042437 Bacteria 3672
432 Ga0439464_0000097 3300042439 Bacteria 12959
433 Ga0439460_0000221 3300042461 Bacteria 11405
434 Ga0450916_033519 3300042530 Bacteria 757
435 Ga0439440_0000634 3300042993 Bacteria 5978
436 Ga0439440_0016638 3300042993 Bacteria 1613
437 Ga0439440_0094139 3300042993 Bacteria 807
438 Ga0466966_0001303 3300044684 Bacteria 15980
439 Ga0466961_0042833 3300044693 Bacteria 2901
440 Ga0466970_0251196 3300044765 Bacteria 991
441 Ga0466959_0007812 3300045049 Bacteria 7527
442 Ga0466967_0073683 3300045976 Bacteria 3064
443 Ga0466967_0287579 3300045976 Bacteria 1578
444 Ga0495592_0000567 3300046454 Bacteria 26216
445 Ga0495603_0025979 3300046455 Bacteria 3541
446 Ga0495629_0007717 3300046459 Bacteria 7917
447 Ga0495629_0033015 3300046459 Bacteria 3662
448 Ga0495641_0012280 3300046461 Bacteria 4802
449 Ga0495641_0015600 3300046461 Bacteria 4045
450 Ga0495651_0000013 3300046462 Bacteria 137933
451 Ga0495651_0045080 3300046462 Bacteria 3416
452 Ga0495651_0102579 3300046462 Bacteria 2127
453 Ga0495653_0006306 3300046463 Bacteria 9731
454 Ga0495653_0021372 3300046463 Bacteria 5243
455 Ga0495580_0015687 3300046472 Bacteria 5709
456 Ga0495580_0385596 3300046472 Bacteria 946
457 Ga0495582_0009726 3300046473 Bacteria 5296
458 Ga0495582_0026349 3300046473 Bacteria 3187
459 Ga0495662_0119629 3300046476 Bacteria 1292
460 Ga0495664_0159695 3300046477 Bacteria 1367
461 Ga0495608_0000114 3300046511 Bacteria 57810
462 Ga0495608_0035323 3300046511 Bacteria 3372
463 Ga0495618_0036909 3300046514 Bacteria 3067
464 Ga0495628_0003223 3300046516 Bacteria 14633
465 Ga0495628_0098248 3300046516 Bacteria 2261
466 Ga0495630_0377347 3300046517 Bacteria 1086
467 Ga0495630_0498175 3300046517 Bacteria 934
468 Ga0495642_0041679 3300046528 Bacteria 1868
469 Ga0495652_0000145 3300046529 Bacteria 80170
470 Ga0495652_0101943 3300046529 Bacteria 2326
471 Ga0495665_0022140 3300046531 Bacteria 3417
472 Ga0495640_0017668 3300046533 Bacteria 5308
473 Ga0495640_0041721 3300046533 Bacteria 3205
474 Ga0495586_0102794 3300046535 Bacteria 1586
475 Ga0495586_0245732 3300046535 Bacteria 1020
476 Ga0495586_0303114 3300046535 Bacteria 915
477 Ga0495587_0000063 3300046536 Bacteria 91300
478 Ga0495587_0003318 3300046536 Bacteria 10744
479 Ga0495645_0027169 3300046543 Bacteria 4157
480 Ga0495645_0270921 3300046543 Bacteria 1120
481 Ga0495645_0413328 3300046543 Bacteria 858
482 Ga0495667_0000049 3300046559 Bacteria 115812
483 Ga0495667_0057141 3300046559 Bacteria 2565
484 Ga0495667_0106311 3300046559 Bacteria 1814
485 Ga0495634_0017970 3300046642 Bacteria 5039
486 Ga0495634_0018492 3300046642 Bacteria 4962
487 Ga0495635_0033409 3300046663 Bacteria 3568
488 Ga0495657_0000513 3300046675 Bacteria 36152
489 Ga0495657_0146002 3300046675 Bacteria 1471
490 Ga0495599_0004667 3300046678 Bacteria 8126
491 Ga0495623_0000822 3300046679 Bacteria 20935
492 Ga0495623_0023209 3300046679 Bacteria 4003
493 Ga0495623_0033851 3300046679 Bacteria 3278
494 Ga0495646_0003993 3300046680 Bacteria 9238
495 Ga0495646_0007651 3300046680 Bacteria 6866
496 Ga0495646_0050477 3300046680 Bacteria 2521
497 Ga0495647_0015566 3300046681 Bacteria 2667
498 Ga0495658_0039144 3300046683 Bacteria 2629
499 Ga0495658_0164247 3300046683 Bacteria 1371
500 Ga0495613_0013663 3300046689 Bacteria 6024
501 Ga0495613_0177843 3300046689 Bacteria 1507
502 Ga0495613_0557409 3300046689 Bacteria 766
503 Ga0495624_0011705 3300046690 Bacteria 6026
504 Ga0495589_0014477 3300046794 Bacteria 4061
505 Ga0495600_0007814 3300046809 Bacteria 6548
506 Ga0495600_0008537 3300046809 Bacteria 6299
507 Ga0495600_0076643 3300046809 Bacteria 2183
508 Ga0495600_0135582 3300046809 Bacteria 1599
509 Ga0495581_0007986 3300047315 Bacteria 6129
510 Ga0495604_0000032 3300047317 Bacteria 137882
511 Ga0495604_0062778 3300047317 Bacteria 2836
512 Ga0495604_0352176 3300047317 Bacteria 978
513 Ga0495674_0028465 3300047319 Bacteria 5093
514 Ga0495674_0084314 3300047319 Bacteria 2723
515 Ga0495674_0168130 3300047319 Bacteria 1831
516 Ga0495676_0328835 3300047321 Bacteria 1025
517 Ga0495680_0000058 3300047322 Bacteria 91920
518 Ga0495680_0025993 3300047322 Bacteria 4835
519 Ga0495683_0220426 3300047323 Bacteria 846
520 Ga0495675_0003923 3300047444 Bacteria 9009
521 Ga0495675_0009644 3300047444 Bacteria 6013
522 Ga0495685_004865 3300047447 Bacteria 4360
523 Ga0495684_0020320 3300047471 Bacteria 5115
524 Ga0495593_0011244 3300047673 Bacteria 5144
525 Ga0495593_0037152 3300047673 Bacteria 2636
526 Ga0495602_0000092 3300048088 Bacteria 85286
527 Ga0496102_0042663 3300048905 Bacteria 4111
528 Ga0496103_0127235 3300048906 Bacteria 1625
529 Ga0496104_0087959 3300048907 Bacteria 2967
530 Ga0496105_0003046 3300048908 Bacteria 12322
531 Ga0496108_0028680 3300048911 Bacteria 4605
532 Ga0496109_0022612 3300048912 Bacteria 5569
533 Ga0496110_0032314 3300048913 Bacteria 4518
534 Ga0496111_0001084 3300048914 Bacteria 15034
535 Ga0496111_0428340 3300048914 Bacteria 977
536 Ga0496112_0059272 3300048915 Bacteria 3771
537 Ga0496114_0190359 3300048917 Bacteria 1795
538 Ga0501042_0573901 3300049578 Bacteria 820
539 Ga0501047_0059358 3300049581 Bacteria 3693
540 Ga0501076_0046267 3300049592 Bacteria 3438
541 Ga0501217_025535 3300049661 Bacteria 1422
542 nmdc:mga07m45_219656_c1 3300050496 Bacteria 1105
543 nmdc:mga09592_287193_c1 3300050508 Bacteria 1426
544 nmdc:mga06r32_60784_c1 3300050510 Bacteria 3636
545 nmdc:mga08y16_135776_c1 3300050511 Bacteria 2557
546 nmdc:mga08y16_23481_c1 3300050511 Bacteria 6515
547 nmdc:mga08y16_57931_c1 3300050511 Bacteria 4048
548 nmdc:mga0n895_13012_c1 3300050512 Bacteria 7485
549 nmdc:mga0rr50_19925_c1 3300050513 Bacteria 4540
550 nmdc:mga0rr50_83049_c1 3300050513 Bacteria 2476
551 nmdc:mga08x19_21765_c1 3300050514 Bacteria 3962
552 nmdc:mga08x19_31809_c1 3300050514 Bacteria 3323
553 nmdc:mga0a205_31094_c1 3300050515 Bacteria 3551
554 nmdc:mga0a205_354223_c1 3300050515 Bacteria 1335
555 nmdc:mga0a205_3808_c1 3300050515 Bacteria 13520
556 Ga0495601_0070021 3300053077 Bacteria 2238
557 Ga0495601_0084506 3300053077 Bacteria 2039
558 Ga0495612_0004713 3300053078 Bacteria 5647
559 Ga0495612_0031636 3300053078 Bacteria 2134
560 Ga0495655_0056500 3300053083 Bacteria 1056
561 Ga0495595_0000358 3300053084 Bacteria 17329
562 Ga0495595_0021300 3300053084 Bacteria 2831
563 Ga0495595_0040819 3300053084 Bacteria 2121
564 Ga0495619_0023161 3300053085 Bacteria 3979
565 Ga0495619_0100907 3300053085 Bacteria 1964
566 Ga0495619_0151412 3300053085 Bacteria 1600
567 2862993961 2862993130 Bacteria 3860849
568 2905927169 2905926851 Bacteria 4423176
569 8048413493 8048406513 Bacteria 8936924
570 8056056952 8056054917 Bacteria 5736694
571 Ga0439448_0000439
572 JGI25407J50210_10040672
573 Ga0070658_10004100
574 Ga0070658_10399335
575 Ga0070676_10013449
576 Ga0070683_100014490
577 Ga0070683_100269243
578 Ga0070690_100214320
579 Ga0070670_100051674
580 Ga0070670_100678892
581 Ga0068869_100005238
582 Ga0068869_100088597
583 Ga0068869_100226006
584 Ga0070666_10041017
585 Ga0070680_100337253
586 Ga0070680_100512813
587 Ga0070682_100005314
588 Ga0070682_100017663
589 Ga0070682_100018883
590 Ga0068868_100047712
591 Ga0068868_100425740
592 Ga0070660_100020031
593 Ga0070689_100047294
594 Ga0070689_100099729
595 Ga0070691_10159483
596 Ga0070661_100002385
597 Ga0070661_100021596
598 Ga0070661_100042335
599 Ga0070692_10010336
600 Ga0070668_100148762
601 Ga0070668_100193083
602 Ga0070675_100004355
603 Ga0070675_100009168
604 Ga0070671_100008795
605 Ga0070671_100445668
606 Ga0070674_100038807
607 Ga0070688_100313860
608 Ga0070659_100001561
609 Ga0070659_100143724
610 Ga0070659_100220376
611 Ga0070667_100017709
612 Ga0070667_100168431
613 Ga0070667_100232702
614 Ga0070703_10061417
615 Ga0070709_10068848
616 Ga0070714_100038604
617 Ga0070714_100116955
618 Ga0070713_100424766
619 Ga0070713_100903558
620 Ga0070710_10009186
621 Ga0070701_10047673
622 Ga0070701_10061781
623 Ga0070701_10564347
624 Ga0070711_100107746
625 Ga0070705_100048509
626 Ga0070700_100059149
627 Ga0070700_100305650
628 Ga0070694_100019400
629 Ga0070694_100064109
630 Ga0070663_100141195
631 Ga0070663_100208406
632 Ga0070678_100078375
633 Ga0070662_100044023
634 Ga0070681_10044150
635 Ga0070681_10217114
636 Ga0070681_10378783
637 Ga0068867_100145801
638 Ga0070685_10003042
639 Ga0070706_100006002
640 Ga0070706_100030772
641 Ga0070706_100370815
642 Ga0070707_100000599
643 Ga0070707_100004244
644 Ga0070707_100025495
645 Ga0070707_100235895
646 Ga0070707_100243936
647 Ga0070698_100006146
648 Ga0070698_100137863
649 Ga0070699_100000850
650 Ga0070699_100036461
651 Ga0070679_100010211
652 Ga0070679_100132803
653 Ga0070679_100155885
654 Ga0070679_100193748
655 Ga0070684_100006712
656 Ga0070684_100087699
657 Ga0070684_100354942
658 Ga0070697_100520788
659 Ga0068853_100126929
660 Ga0068853_100148646
661 Ga0070672_100123154
662 Ga0070686_100027522
663 Ga0070695_100031113
664 Ga0070695_100081326
665 Ga0070695_100086635
666 Ga0070696_100011622
667 Ga0070696_100017229
668 Ga0070696_100375140
669 Ga0070696_100435896
670 Ga0070693_100004205
671 Ga0070665_100042717
672 Ga0070704_100112948
673 Ga0068855_100197469
674 Ga0068855_100255590
675 Ga0070664_100013779
676 Ga0070664_100133283
677 Ga0070664_100355958
678 Ga0068857_100039826
679 Ga0068857_100089832
680 Ga0068857_100458539
681 Ga0068854_100032384
682 Ga0068854_100244768
683 Ga0068854_100403226
684 Ga0068854_100438759
685 Ga0068856_100130322
686 Ga0070702_100014133
687 Ga0068852_100003270
688 Ga0068852_100018594
689 Ga0068852_100047739
690 Ga0068852_100227612
691 Ga0068852_100495872
692 Ga0068859_100059026
693 Ga0068859_100364375
694 Ga0068864_100052777
695 Ga0068864_100388910
696 Ga0068866_10084356
697 Ga0068861_100393588
698 Ga0068861_100546208
699 Ga0068851_10008364
700 Ga0068870_10003223
701 Ga0068863_100005624
702 Ga0068863_100097522
703 Ga0068863_100381062
704 Ga0068858_100015256
705 Ga0068860_100426413
706 Ga0068862_100864245
707 Ga0081538_10004615
708 Ga0081538_10007125
709 Ga0081539_10000573
710 Ga0081539_10005602
711 Ga0070717_10275029
712 Ga0075432_10014202
713 Ga0070712_100029247
714 Ga0097621_100107535
715 Ga0097621_100153042
716 Ga0075370_10111373
717 Ga0068871_100040053
718 Ga0075428_100085686
719 Ga0075428_100548343
720 Ga0075430_100070185
721 Ga0075430_100087630
722 Ga0075433_10014770
723 Ga0075433_10029988
724 Ga0075433_10344621
725 Ga0075434_100005039
726 Ga0075434_100079830
727 Ga0075434_100219367
728 Ga0068865_100012745
729 Ga0068865_100344712
730 Ga0075436_100009457
731 Ga0075436_100022484
732 Ga0097620_100059027
733 Ga0097620_100364375
734 Ga0075435_100004261
735 Ga0075435_100062026
736 Ga0099794_10277107
737 Ga0105251_10081207
738 Ga0105240_10434435
739 Ga0111539_10053701
740 Ga0105245_10014174
741 Ga0105245_10042191
742 Ga0105245_10775995
743 Ga0105247_10114484
744 Ga0114129_10249663
745 Ga0114129_10498390
746 Ga0105243_10003812
747 Ga0105243_10071017
748 Ga0105243_10194570
749 Ga0105241_10562556
750 Ga0105242_10004004
751 Ga0105248_10004471
752 Ga0105248_10093649
753 Ga0105237_10022785
754 Ga0105237_10166533
755 Ga0105237_10469267
756 Ga0105238_10362634
757 Ga0105238_10442102
758 Ga0105249_10038868
759 Ga0105249_10211162
760 Ga0105239_10035908
761 Ga0105239_10244187
762 Ga0105239_10909276
763 Ga0105246_10031761
764 Ga0105246_10034717
765 Ga0105246_10115468
766 Ga0157338_1004866
767 Ga0157371_10057864
768 Ga0157374_10068405
769 Ga0157374_10222991
770 Ga0157372_10097467
771 Ga0157372_10364964
772 Ga0157372_10372619
773 Ga0157375_10203047
774 Ga0163163_10194567
775 Ga0157380_10052390
776 Ga0157380_10184690
777 Ga0182008_10162915
778 Ga0157377_10035496
779 Ga0157376_10253065
780 Ga0206353_10313762
781 Ga0206353_10523475
782 Ga0228598_1051842
783 Ga0207656_10013112
784 Ga0207713_1053831
785 Ga0207713_1103174
786 Ga0207653_10016628
787 Ga0207692_10039409
788 Ga0207642_10036167
789 Ga0207688_10003888
790 Ga0207688_10029561
791 Ga0207688_10044161
792 Ga0207680_10136622
793 Ga0207680_10431487
794 Ga0207685_10051562
795 Ga0207699_10022364
796 Ga0207699_10257801
797 Ga0207645_10020300
798 Ga0207643_10005530
799 Ga0207643_10041063
800 Ga0207705_10022944
801 Ga0207705_10028415
802 Ga0207705_10068401
803 Ga0207684_10001902
804 Ga0207684_10177357
805 Ga0207654_10001930
806 Ga0207654_10075959
807 Ga0207654_10344039
808 Ga0207654_10541490
809 Ga0207707_10045182
810 Ga0207671_10014285
811 Ga0207671_10292799
812 Ga0207663_10065740
813 Ga0207660_10054427
814 Ga0207660_10466912
815 Ga0207662_10064502
816 Ga0207657_10013826
817 Ga0207657_10059082
818 Ga0207657_10068617
819 Ga0207649_10019878
820 Ga0207652_10079605
821 Ga0207652_10100441
822 Ga0207652_10552830
823 Ga0207652_10946581
824 Ga0207646_10003079
825 Ga0207646_10009922
826 Ga0207646_10284818
827 Ga0207646_10310923
828 Ga0207694_10265074
829 Ga0207694_10312397
830 Ga0207650_10011227
831 Ga0207659_10031804
832 Ga0207659_10080637
833 Ga0207687_10007643
834 Ga0207687_10277212
835 Ga0207700_10014168
836 Ga0207700_10501141
837 Ga0207664_10028335
838 Ga0207664_10120473
839 Ga0207664_10542384
840 Ga0207644_10206930
841 Ga0207690_10001177
842 Ga0207690_10116018
843 Ga0207690_10604821
844 Ga0207706_10020971
845 Ga0207706_10060998
846 Ga0207706_10128232
847 Ga0207686_10028609
848 Ga0207709_10089757
849 Ga0207709_10483959
850 Ga0207709_10873845
851 Ga0207669_10029924
852 Ga0207704_10014197
853 Ga0207704_10142910
854 Ga0207665_10201174
855 Ga0207691_10053995
856 Ga0207691_10076464
857 Ga0207711_10037807
858 Ga0207711_10173142
859 Ga0207689_10010561
860 Ga0207689_10039689
861 Ga0207661_10002328
862 Ga0207661_10019623
863 Ga0207661_10040903
864 Ga0207661_10239302
865 Ga0207679_10007835
866 Ga0207679_10266137
867 Ga0207667_10043067
868 Ga0207667_10262131
869 Ga0207667_10609657
870 Ga0207651_10019748
871 Ga0207712_10029103
872 Ga0207712_10093158
873 Ga0207668_10100298
874 Ga0207640_10005842
875 Ga0207640_10306712
876 Ga0207658_10017773
877 Ga0207658_10090214
878 Ga0207658_10422391
879 Ga0207677_10045835
880 Ga0207677_10071450
881 Ga0207677_10111103
882 Ga0207703_10061475
883 Ga0207639_10020320
884 Ga0207678_10004579
885 Ga0207678_10006554
886 Ga0207708_10004728
887 Ga0207708_10183153
888 Ga0207708_10519827
889 Ga0207702_10006891
890 Ga0207702_10051036
891 Ga0207702_10058614
892 Ga0207702_10447172
893 Ga0207641_10136976
894 Ga0207648_10097920
895 Ga0207676_10009026
896 Ga0207674_10010832
897 Ga0207674_10075231
898 Ga0207674_10078506
899 Ga0207674_10276867
900 Ga0207675_100030454
901 Ga0207675_100071643
902 Ga0207675_100088917
903 Ga0207675_100194664
904 Ga0207683_10003830
905 Ga0207683_10018962
906 Ga0207698_10000255
907 Ga0207698_10662284
908 Ga0207428_10008872
909 Ga0207428_10057411
910 Ga0207428_10136479
911 Ga0268266_10541318
912 Ga0268265_10342434
913 Ga0268264_10393677
914 Ga0265760_10036133
915 Ga0265340_10000633
916 Ga0307513_10035352
917 Ga0307408_100028288
918 Ga0307408_100119329
919 Ga0307408_100205037
920 Ga0316576_10084503
921 Ga0307405_10001757
922 Ga0307405_10213995
923 Ga0307413_10024546
924 Ga0307410_10013234
925 Ga0307410_10277047
926 Ga0307406_10017864
927 Ga0307406_10366204
928 Ga0307406_10963121
929 Ga0307407_10127512
930 Ga0307407_10297343
931 Ga0307407_10758816
932 Ga0307412_10109455
933 Ga0307412_10355856
934 Ga0307412_10801343
935 Ga0307409_100021961
936 Ga0307409_100022348
937 Ga0307409_100071479
938 Ga0307409_100305466
939 Ga0307409_100564057
940 Ga0307416_100057086
941 Ga0307416_100174659
942 Ga0307416_100187501
943 Ga0307416_100291732
944 Ga0307414_10436398
945 Ga0307411_10079136
946 Ga0307411_10149482
947 Ga0307411_10743057
948 Ga0307415_100133081
949 Ga0307415_100212790
950 Ga0373926_0029773
951 Ga0373934_0000186
952 Ga0373923_0008371
953 Ga0373923_0025783
954 Ga0373923_0175685
955 Ga0373945_0026543
956 Ga0373953_0000637
957 Ga0373953_0029441
958 Ga0373954_0001768
959 Ga0373954_0067512
960 Ga0373956_0002082
961 Ga0373956_0006467
962 Ga0373957_0000515
963 Ga0373957_0004920
964 Ga0373943_0025244
965 Ga0373955_0000006
966 Ga0373955_0001455
967 Ga0373955_0071028
968 Ga0373955_0250820
969 Ga0373924_0004890
970 Ga0373924_0025708
971 Ga0373927_0161625
972 Ga0373933_0000463
973 Ga0373933_0001318
974 Ga0373937_0000731
975 Ga0373937_0015060
976 Ga0373925_0026416
977 Ga0373925_0080041
978 Ga0395900_0098016
979 Ga0395901_0186709
980 Ga0395901_0258319
981 Ga0395901_0268814
982 Ga0395901_0606863
983 Ga0439439_0037199
984 Ga0451793_0276978
985 Ga0451833_1121258
986 Ga0451841_0113861
987 Ga0451851_1202267
988 Ga0451853_2821443
989 Ga0439449_0019454
990 Ga0439450_000771
991 Ga0439450_040029
992 Ga0439454_000293
993 Ga0439457_001086
994 Ga0439463_001394
995 Ga0439463_031926
996 Ga0450913_001082
997 Ga0450917_006124
998 Ga0450890_026463
999 Ga0450902_001590
1000 Ga0439458_0005004
1001 Ga0439444_0000868
1002 Ga0439464_0000097
1003 Ga0439460_0000221
1004 Ga0450916_033519
1005 Ga0439440_0000634
1006 Ga0439440_0016638
1007 Ga0439440_0094139
1008 Ga0466966_0001303
1009 Ga0466961_0042833
1010 Ga0466970_0251196
1011 Ga0466959_0007812
1012 Ga0466967_0073683
1013 Ga0466967_0287579
1014 Ga0495592_0000567
1015 Ga0495603_0025979
1016 Ga0495629_0007717
1017 Ga0495629_0033015
1018 Ga0495641_0012280
1019 Ga0495641_0015600
1020 Ga0495651_0000013
1021 Ga0495651_0045080
1022 Ga0495651_0102579
1023 Ga0495653_0006306
1024 Ga0495653_0021372
1025 Ga0495580_0015687
1026 Ga0495580_0385596
1027 Ga0495582_0009726
1028 Ga0495582_0026349
1029 Ga0495662_0119629
1030 Ga0495664_0159695
1031 Ga0495608_0000114
1032 Ga0495608_0035323
1033 Ga0495618_0036909
1034 Ga0495628_0003223
1035 Ga0495628_0098248
1036 Ga0495630_0377347
1037 Ga0495630_0498175
1038 Ga0495642_0041679
1039 Ga0495652_0000145
1040 Ga0495652_0101943
1041 Ga0495665_0022140
1042 Ga0495640_0017668
1043 Ga0495640_0041721
1044 Ga0495586_0102794
1045 Ga0495586_0245732
1046 Ga0495586_0303114
1047 Ga0495587_0000063
1048 Ga0495587_0003318
1049 Ga0495645_0027169
1050 Ga0495645_0270921
1051 Ga0495645_0413328
1052 Ga0495667_0000049
1053 Ga0495667_0057141
1054 Ga0495667_0106311
1055 Ga0495634_0017970
1056 Ga0495634_0018492
1057 Ga0495635_0033409
1058 Ga0495657_0000513
1059 Ga0495657_0146002
1060 Ga0495599_0004667
1061 Ga0495623_0000822
1062 Ga0495623_0023209
1063 Ga0495623_0033851
1064 Ga0495646_0003993
1065 Ga0495646_0007651
1066 Ga0495646_0050477
1067 Ga0495647_0015566
1068 Ga0495658_0039144
1069 Ga0495658_0164247
1070 Ga0495613_0013663
1071 Ga0495613_0177843
1072 Ga0495613_0557409
1073 Ga0495624_0011705
1074 Ga0495589_0014477
1075 Ga0495600_0007814
1076 Ga0495600_0008537
1077 Ga0495600_0076643
1078 Ga0495600_0135582
1079 Ga0495581_0007986
1080 Ga0495604_0000032
1081 Ga0495604_0062778
1082 Ga0495604_0352176
1083 Ga0495674_0028465
1084 Ga0495674_0084314
1085 Ga0495674_0168130
1086 Ga0495676_0328835
1087 Ga0495680_0000058
1088 Ga0495680_0025993
1089 Ga0495683_0220426
1090 Ga0495675_0003923
1091 Ga0495675_0009644
1092 Ga0495685_004865
1093 Ga0495684_0020320
1094 Ga0495593_0011244
1095 Ga0495593_0037152
1096 Ga0495602_0000092
1097 Ga0496102_0042663
1098 Ga0496103_0127235
1099 Ga0496104_0087959
1100 Ga0496105_0003046
1101 Ga0496108_0028680
1102 Ga0496109_0022612
1103 Ga0496110_0032314
1104 Ga0496111_0001084
1105 Ga0496111_0428340
1106 Ga0496112_0059272
1107 Ga0496114_0190359
1108 Ga0501042_0573901
1109 Ga0501047_0059358
1110 Ga0501076_0046267
1111 Ga0501217_025535
1112 nmdc:mga07m45_219656_c1
1113 nmdc:mga09592_287193_c1
1114 nmdc:mga06r32_60784_c1
1115 nmdc:mga08y16_135776_c1
1116 nmdc:mga08y16_23481_c1
1117 nmdc:mga08y16_57931_c1
1118 nmdc:mga0n895_13012_c1
1119 nmdc:mga0rr50_19925_c1
1120 nmdc:mga0rr50_83049_c1
1121 nmdc:mga08x19_21765_c1
1122 nmdc:mga08x19_31809_c1
1123 nmdc:mga0a205_31094_c1
1124 nmdc:mga0a205_354223_c1
1125 nmdc:mga0a205_3808_c1
1126 Ga0495601_0070021
1127 Ga0495601_0084506
1128 Ga0495612_0004713
1129 Ga0495612_0031636
1130 Ga0495655_0056500
1131 Ga0495595_0000358
1132 Ga0495595_0021300
1133 Ga0495595_0040819
1134 Ga0495619_0023161
1135 Ga0495619_0100907
1136 Ga0495619_0151412
1137 2862993961
1138 2905927169
1139 8048413493
1140 8056056952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

20

65

0.96

PF02909

TetR_C_1

Tetracyclin repressor-like, C-terminal domain

75

221

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b6c-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor tetr family protein actr in complex with (s)-dnpa 0.8497 13 220
2opt-assembly1.cif.gz_A crystal structure of apo actr from streptomyces coelicolor. 0.8476 13 224
3b6c-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor tetr family protein actr in complex with (s)-dnpa 0.8383 13 220
6yr2-assembly1.cif.gz_BBB tetr(d) soaked with tigecycline p4(1)2(1)2 0.8346 15 226
2opt-assembly1.cif.gz_A crystal structure of apo actr from streptomyces coelicolor. 0.8328 13 224
ID Description Score Start End Superfamily
1qpiA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9758 16 71 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9736 16 68 1.10.10.60
5ojxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9689 16 68 1.10.10.60
2y30B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9642 16 67 1.10.10.60
3b6cA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9602 13 74 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3N0CXZ7-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9842 25 217 GO:0003677
GO:0045892
GO:0046677
GO:0046872
AF-A0A2S1ZA50-F1-model_v4 deleted 0.9815 25 217
AF-A0A371BSH9-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9777 38 223 GO:0045892
AF-A0A5P0YXQ1-F1-model_v4 TetR family transcriptional regulator 0.9767 25 176 GO:0003677
GO:0045892
GO:0046677
GO:0046872
AF-A0A239C3J6-F1-model_v4 Transcriptional regulator, TetR family 0.9763 4 221 GO:0000976
GO:0003700
GO:0045892
GO:0046677
GO:0046872

Map