F464836
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 570 | 296 | 570 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300026023|Ga0207677_10642050|Ga0207677_106420501 |
| Length | 127 |
| Sequence | MANEMTLDTPILGGAGGDDLIKDTTTKDFVLDVVEASKQVPVLVDFWAPWCGPCRVVSPILEEINGERDDLRVVKLNVDDNQVTAVRYEVLSIPTMILFKNGELVKKVIGAQPRARIEAELEPALAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 123 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 200 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 208 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 211 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 212 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 250 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 251 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 252 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 253 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 277 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 286 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 287 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 289 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.74 |
| Metatranscriptomes | 5.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.05 |
| Nodule | 0 |
| Rhizoplane | 7.89 |
| Rhizosphere | 88.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1065058 | 3300001977 | Bacteria | 525 |
| 2 | JGI24737J22298_10195880 | 3300001990 | Bacteria | 596 |
| 3 | JGI24743J22301_10076831 | 3300001991 | Bacteria | 701 |
| 4 | JGI24749J21850_1029203 | 3300002076 | Bacteria | 789 |
| 5 | JGI24742J22300_10056958 | 3300002244 | Bacteria | 714 |
| 6 | Ga0006778J45830_1007030 | 3300003162 | Bacteria | 523 |
| 7 | JGI25407J50210_10119373 | 3300003373 | Bacteria | 650 |
| 8 | Ga0007427J51700_123134 | 3300003559 | Bacteria | 552 |
| 9 | Ga0007409J51694_1012852 | 3300003575 | Bacteria | 507 |
| 10 | Ga0058863_11847521 | 3300004799 | Bacteria | 590 |
| 11 | Ga0058861_11599725 | 3300004800 | Bacteria | 583 |
| 12 | Ga0070658_10062086 | 3300005327 | Bacteria | 3045 |
| 13 | Ga0070658_10565830 | 3300005327 | Bacteria | 984 |
| 14 | Ga0070658_10884271 | 3300005327 | Bacteria | 777 |
| 15 | Ga0070676_10433689 | 3300005328 | Bacteria | 921 |
| 16 | Ga0070683_100036702 | 3300005329 | Bacteria | 4485 |
| 17 | Ga0070683_100072034 | 3300005329 | Bacteria | 3225 |
| 18 | Ga0070683_100212246 | 3300005329 | Bacteria | 1839 |
| 19 | Ga0070683_100307037 | 3300005329 | Bacteria | 1509 |
| 20 | Ga0070683_100815340 | 3300005329 | Bacteria | 895 |
| 21 | Ga0070690_100088950 | 3300005330 | Bacteria | 2031 |
| 22 | Ga0070670_100434356 | 3300005331 | Bacteria | 1162 |
| 23 | Ga0068869_100690484 | 3300005334 | Bacteria | 870 |
| 24 | Ga0070666_10050127 | 3300005335 | Bacteria | 2807 |
| 25 | Ga0070680_100059698 | 3300005336 | Bacteria | 3121 |
| 26 | Ga0070682_100051657 | 3300005337 | Bacteria | 2570 |
| 27 | Ga0070682_100763164 | 3300005337 | Bacteria | 782 |
| 28 | Ga0070682_101319499 | 3300005337 | Bacteria | 614 |
| 29 | Ga0068868_100012973 | 3300005338 | Bacteria | 6097 |
| 30 | Ga0068868_100169079 | 3300005338 | Bacteria | 1809 |
| 31 | Ga0070660_100013384 | 3300005339 | Bacteria | 5884 |
| 32 | Ga0070660_100397988 | 3300005339 | Bacteria | 1139 |
| 33 | Ga0070689_100028871 | 3300005340 | Bacteria | 4195 |
| 34 | Ga0070691_10392570 | 3300005341 | Bacteria | 780 |
| 35 | Ga0070661_100048843 | 3300005344 | Bacteria | 3098 |
| 36 | Ga0070661_101259870 | 3300005344 | Bacteria | 619 |
| 37 | Ga0070692_10041984 | 3300005345 | Bacteria | 2346 |
| 38 | Ga0070668_100190633 | 3300005347 | Bacteria | 1679 |
| 39 | Ga0070668_100369544 | 3300005347 | Bacteria | 1218 |
| 40 | Ga0070668_100524531 | 3300005347 | Bacteria | 1028 |
| 41 | Ga0070668_100935422 | 3300005347 | Bacteria | 776 |
| 42 | Ga0070668_101522607 | 3300005347 | Bacteria | 612 |
| 43 | Ga0070669_100495672 | 3300005353 | Bacteria | 1013 |
| 44 | Ga0070675_100299450 | 3300005354 | Bacteria | 1416 |
| 45 | Ga0070671_100494031 | 3300005355 | Bacteria | 1052 |
| 46 | Ga0070671_100574777 | 3300005355 | Bacteria | 973 |
| 47 | Ga0070674_100057695 | 3300005356 | Bacteria | 2696 |
| 48 | Ga0070674_100118763 | 3300005356 | Bacteria | 1955 |
| 49 | Ga0070674_100879935 | 3300005356 | Bacteria | 779 |
| 50 | Ga0070673_101490151 | 3300005364 | Bacteria | 638 |
| 51 | Ga0070673_102051959 | 3300005364 | Bacteria | 543 |
| 52 | Ga0070688_100035388 | 3300005365 | Bacteria | 3033 |
| 53 | Ga0070659_100004246 | 3300005366 | Bacteria | 10229 |
| 54 | Ga0070659_100020667 | 3300005366 | Bacteria | 5005 |
| 55 | Ga0070659_100486326 | 3300005366 | Bacteria | 1051 |
| 56 | Ga0070659_100818757 | 3300005366 | Bacteria | 810 |
| 57 | Ga0070659_100989948 | 3300005366 | Bacteria | 738 |
| 58 | Ga0070659_101901471 | 3300005366 | Bacteria | 534 |
| 59 | Ga0070667_100073476 | 3300005367 | Bacteria | 2916 |
| 60 | Ga0070667_100516916 | 3300005367 | Bacteria | 1095 |
| 61 | Ga0070667_101644975 | 3300005367 | Bacteria | 604 |
| 62 | Ga0070703_10599708 | 3300005406 | Bacteria | 508 |
| 63 | Ga0070710_10352932 | 3300005437 | Bacteria | 974 |
| 64 | Ga0070701_10052001 | 3300005438 | Bacteria | 2126 |
| 65 | Ga0070701_10474482 | 3300005438 | Bacteria | 807 |
| 66 | Ga0070701_10689906 | 3300005438 | Bacteria | 686 |
| 67 | Ga0070711_100763851 | 3300005439 | Bacteria | 818 |
| 68 | Ga0070705_100492021 | 3300005440 | Bacteria | 929 |
| 69 | Ga0070705_100830397 | 3300005440 | Bacteria | 738 |
| 70 | Ga0070700_100766501 | 3300005441 | Bacteria | 774 |
| 71 | Ga0070694_100168673 | 3300005444 | Bacteria | 1611 |
| 72 | Ga0070694_100461333 | 3300005444 | Bacteria | 1005 |
| 73 | Ga0070678_100153293 | 3300005456 | Bacteria | 1859 |
| 74 | Ga0070678_100724073 | 3300005456 | Bacteria | 898 |
| 75 | Ga0070678_101164719 | 3300005456 | Bacteria | 714 |
| 76 | Ga0070662_101209196 | 3300005457 | Bacteria | 650 |
| 77 | Ga0070681_10025672 | 3300005458 | Bacteria | 5926 |
| 78 | Ga0068867_100111135 | 3300005459 | Bacteria | 2105 |
| 79 | Ga0068867_100153995 | 3300005459 | Bacteria | 1808 |
| 80 | Ga0068867_100405691 | 3300005459 | Bacteria | 1151 |
| 81 | Ga0070685_10042777 | 3300005466 | Bacteria | 2586 |
| 82 | Ga0070679_100015880 | 3300005530 | Bacteria | 7247 |
| 83 | Ga0070679_100985961 | 3300005530 | Bacteria | 786 |
| 84 | Ga0070684_100029841 | 3300005535 | Bacteria | 4626 |
| 85 | Ga0070684_100298493 | 3300005535 | Bacteria | 1478 |
| 86 | Ga0070684_100446237 | 3300005535 | Bacteria | 1195 |
| 87 | Ga0068853_100053246 | 3300005539 | Bacteria | 3485 |
| 88 | Ga0068853_100604032 | 3300005539 | Bacteria | 1042 |
| 89 | Ga0068853_101027634 | 3300005539 | Bacteria | 794 |
| 90 | Ga0068853_102327863 | 3300005539 | Bacteria | 519 |
| 91 | Ga0068853_102501937 | 3300005539 | Bacteria | 500 |
| 92 | Ga0070672_100569572 | 3300005543 | Bacteria | 985 |
| 93 | Ga0070686_100110942 | 3300005544 | Bacteria | 1869 |
| 94 | Ga0070686_100635466 | 3300005544 | Bacteria | 845 |
| 95 | Ga0070686_101269116 | 3300005544 | Bacteria | 614 |
| 96 | Ga0070695_100357212 | 3300005545 | Bacteria | 1096 |
| 97 | Ga0070695_100401662 | 3300005545 | Bacteria | 1039 |
| 98 | Ga0070696_100230968 | 3300005546 | Bacteria | 1392 |
| 99 | Ga0070696_101606415 | 3300005546 | Bacteria | 559 |
| 100 | Ga0070665_100011475 | 3300005548 | Bacteria | 8960 |
| 101 | Ga0070665_100179522 | 3300005548 | Bacteria | 2118 |
| 102 | Ga0070665_100866951 | 3300005548 | Bacteria | 916 |
| 103 | Ga0070665_102433212 | 3300005548 | Bacteria | 526 |
| 104 | Ga0070704_100017370 | 3300005549 | Bacteria | 4575 |
| 105 | Ga0070704_100330876 | 3300005549 | Bacteria | 1280 |
| 106 | Ga0070704_100798978 | 3300005549 | Bacteria | 843 |
| 107 | Ga0068855_100389858 | 3300005563 | Bacteria | 1528 |
| 108 | Ga0068855_100778967 | 3300005563 | Bacteria | 1018 |
| 109 | Ga0070664_100036090 | 3300005564 | Bacteria | 4152 |
| 110 | Ga0070664_100145756 | 3300005564 | Bacteria | 2088 |
| 111 | Ga0070664_100163679 | 3300005564 | Bacteria | 1969 |
| 112 | Ga0070664_100263323 | 3300005564 | Bacteria | 1552 |
| 113 | Ga0070664_100493372 | 3300005564 | Bacteria | 1128 |
| 114 | Ga0068857_100092902 | 3300005577 | Bacteria | 2702 |
| 115 | Ga0068857_100110482 | 3300005577 | Bacteria | 2470 |
| 116 | Ga0068857_100227204 | 3300005577 | Bacteria | 1706 |
| 117 | Ga0068857_101779532 | 3300005577 | Bacteria | 603 |
| 118 | Ga0068854_100243263 | 3300005578 | Bacteria | 1434 |
| 119 | Ga0068854_100531377 | 3300005578 | Bacteria | 995 |
| 120 | Ga0068854_100548696 | 3300005578 | Bacteria | 980 |
| 121 | Ga0068854_100802416 | 3300005578 | Bacteria | 821 |
| 122 | Ga0068856_100018802 | 3300005614 | Bacteria | 6700 |
| 123 | Ga0068856_100703309 | 3300005614 | Bacteria | 1031 |
| 124 | Ga0068856_100830161 | 3300005614 | Bacteria | 944 |
| 125 | Ga0068856_101293309 | 3300005614 | Bacteria | 745 |
| 126 | Ga0070702_100674221 | 3300005615 | Bacteria | 785 |
| 127 | Ga0068852_100050849 | 3300005616 | Bacteria | 3553 |
| 128 | Ga0068852_100076061 | 3300005616 | Bacteria | 2964 |
| 129 | Ga0068852_100112329 | 3300005616 | Bacteria | 2479 |
| 130 | Ga0068852_100500523 | 3300005616 | Bacteria | 1210 |
| 131 | Ga0068864_100255643 | 3300005618 | Bacteria | 1628 |
| 132 | Ga0068864_100288979 | 3300005618 | Bacteria | 1532 |
| 133 | Ga0068864_100384459 | 3300005618 | Bacteria | 1331 |
| 134 | Ga0068866_10016489 | 3300005718 | Bacteria | 3303 |
| 135 | Ga0068866_10020436 | 3300005718 | Bacteria | 3034 |
| 136 | Ga0068866_10570200 | 3300005718 | Bacteria | 760 |
| 137 | Ga0068861_100549775 | 3300005719 | Bacteria | 1052 |
| 138 | Ga0068861_100995317 | 3300005719 | Bacteria | 800 |
| 139 | Ga0068851_10180312 | 3300005834 | Bacteria | 1169 |
| 140 | Ga0068851_10262970 | 3300005834 | Bacteria | 982 |
| 141 | Ga0068870_10401825 | 3300005840 | Bacteria | 892 |
| 142 | Ga0068870_10605771 | 3300005840 | Bacteria | 745 |
| 143 | Ga0068863_100005579 | 3300005841 | Bacteria | 12365 |
| 144 | Ga0068863_100808692 | 3300005841 | Bacteria | 935 |
| 145 | Ga0068858_100043518 | 3300005842 | Bacteria | 4163 |
| 146 | Ga0068858_100187883 | 3300005842 | Bacteria | 1952 |
| 147 | Ga0068860_100061878 | 3300005843 | Bacteria | 3557 |
| 148 | Ga0068862_100188267 | 3300005844 | Bacteria | 1856 |
| 149 | Ga0068862_101213815 | 3300005844 | Bacteria | 753 |
| 150 | Ga0068862_101365838 | 3300005844 | Bacteria | 711 |
| 151 | Ga0068862_101399816 | 3300005844 | Bacteria | 703 |
| 152 | Ga0081455_10004081 | 3300005937 | Bacteria | 16534 |
| 153 | Ga0081538_10053474 | 3300005981 | Bacteria | 2400 |
| 154 | Ga0081540_1002274 | 3300005983 | Bacteria | 15785 |
| 155 | Ga0081540_1017202 | 3300005983 | Bacteria | 4484 |
| 156 | Ga0075365_10979607 | 3300006038 | Bacteria | 596 |
| 157 | Ga0075363_100868529 | 3300006048 | Bacteria | 551 |
| 158 | Ga0075432_10415468 | 3300006058 | Bacteria | 584 |
| 159 | Ga0070715_10430842 | 3300006163 | Bacteria | 740 |
| 160 | Ga0070716_101303865 | 3300006173 | Bacteria | 587 |
| 161 | Ga0070712_100112814 | 3300006175 | Bacteria | 2031 |
| 162 | Ga0070712_101771476 | 3300006175 | Bacteria | 541 |
| 163 | Ga0097621_100898277 | 3300006237 | Bacteria | 825 |
| 164 | Ga0068871_101248717 | 3300006358 | Bacteria | 698 |
| 165 | Ga0068871_101320891 | 3300006358 | Bacteria | 679 |
| 166 | Ga0075431_101681470 | 3300006847 | Bacteria | 592 |
| 167 | Ga0075433_10010256 | 3300006852 | Bacteria | 7515 |
| 168 | Ga0075434_100003617 | 3300006871 | Bacteria | 13797 |
| 169 | Ga0075434_101796442 | 3300006871 | Bacteria | 620 |
| 170 | Ga0068865_100296131 | 3300006881 | Bacteria | 1293 |
| 171 | Ga0068865_100549689 | 3300006881 | Bacteria | 969 |
| 172 | Ga0075436_100318480 | 3300006914 | Bacteria | 1117 |
| 173 | Ga0075435_100010684 | 3300007076 | Bacteria | 6720 |
| 174 | Ga0105251_10424455 | 3300009011 | Bacteria | 614 |
| 175 | Ga0105250_10118940 | 3300009092 | Bacteria | 1085 |
| 176 | Ga0105240_10031826 | 3300009093 | Bacteria | 6834 |
| 177 | Ga0105240_10310792 | 3300009093 | Bacteria | 1800 |
| 178 | Ga0105240_10332232 | 3300009093 | Bacteria | 1729 |
| 179 | Ga0105240_12602185 | 3300009093 | Bacteria | 523 |
| 180 | Ga0111539_10141088 | 3300009094 | Bacteria | 2820 |
| 181 | Ga0111539_10184849 | 3300009094 | Bacteria | 2434 |
| 182 | Ga0105245_10355229 | 3300009098 | Bacteria | 1453 |
| 183 | Ga0105247_10143443 | 3300009101 | Bacteria | 1567 |
| 184 | Ga0105247_11235661 | 3300009101 | Bacteria | 597 |
| 185 | Ga0114129_10002590 | 3300009147 | Bacteria | 25131 |
| 186 | Ga0114129_12020903 | 3300009147 | Bacteria | 697 |
| 187 | Ga0114129_12692250 | 3300009147 | Bacteria | 593 |
| 188 | Ga0105243_10014782 | 3300009148 | Bacteria | 5905 |
| 189 | Ga0105243_10022548 | 3300009148 | Bacteria | 4787 |
| 190 | Ga0105243_10713433 | 3300009148 | Bacteria | 979 |
| 191 | Ga0105241_10512758 | 3300009174 | Bacteria | 1071 |
| 192 | Ga0105241_12155775 | 3300009174 | Bacteria | 552 |
| 193 | Ga0105242_10000239 | 3300009176 | Bacteria | 43273 |
| 194 | Ga0105242_10505459 | 3300009176 | Bacteria | 1150 |
| 195 | Ga0105242_11065490 | 3300009176 | Bacteria | 820 |
| 196 | Ga0105242_11609872 | 3300009176 | Bacteria | 683 |
| 197 | Ga0105248_10309593 | 3300009177 | Bacteria | 1779 |
| 198 | Ga0105248_11056983 | 3300009177 | Bacteria | 917 |
| 199 | Ga0105237_10552458 | 3300009545 | Bacteria | 1158 |
| 200 | Ga0105237_11197643 | 3300009545 | Bacteria | 766 |
| 201 | Ga0105238_10045833 | 3300009551 | Bacteria | 4417 |
| 202 | Ga0105238_10250990 | 3300009551 | Bacteria | 1747 |
| 203 | Ga0105238_10672935 | 3300009551 | Bacteria | 1046 |
| 204 | Ga0105238_11388550 | 3300009551 | Bacteria | 729 |
| 205 | Ga0105249_10038504 | 3300009553 | Bacteria | 4339 |
| 206 | Ga0105249_10049271 | 3300009553 | Bacteria | 3841 |
| 207 | Ga0105249_10481868 | 3300009553 | Bacteria | 1283 |
| 208 | Ga0105249_10727616 | 3300009553 | Bacteria | 1054 |
| 209 | Ga0105249_10789845 | 3300009553 | Bacteria | 1013 |
| 210 | Ga0105239_10105708 | 3300010375 | Bacteria | 3118 |
| 211 | Ga0105239_10114226 | 3300010375 | Bacteria | 2995 |
| 212 | Ga0105239_10602238 | 3300010375 | Bacteria | 1253 |
| 213 | Ga0105239_10675939 | 3300010375 | Bacteria | 1180 |
| 214 | Ga0105239_11168023 | 3300010375 | Bacteria | 887 |
| 215 | Ga0105239_11744824 | 3300010375 | Bacteria | 721 |
| 216 | Ga0105246_10055690 | 3300011119 | Bacteria | 2730 |
| 217 | Ga0157373_10369487 | 3300013100 | Bacteria | 1025 |
| 218 | Ga0157371_10247795 | 3300013102 | Bacteria | 1282 |
| 219 | Ga0157371_10331575 | 3300013102 | Bacteria | 1105 |
| 220 | Ga0157371_10668544 | 3300013102 | Bacteria | 776 |
| 221 | Ga0157370_10020903 | 3300013104 | Bacteria | 6529 |
| 222 | Ga0157369_10050379 | 3300013105 | Bacteria | 4510 |
| 223 | Ga0157374_10116789 | 3300013296 | Bacteria | 2571 |
| 224 | Ga0157374_11627796 | 3300013296 | Bacteria | 670 |
| 225 | Ga0163162_10915945 | 3300013306 | Bacteria | 989 |
| 226 | Ga0163162_12205920 | 3300013306 | Bacteria | 632 |
| 227 | Ga0157372_10069929 | 3300013307 | Bacteria | 3948 |
| 228 | Ga0157372_11544001 | 3300013307 | Bacteria | 765 |
| 229 | Ga0157372_12444150 | 3300013307 | Bacteria | 600 |
| 230 | Ga0157372_12766786 | 3300013307 | Bacteria | 563 |
| 231 | Ga0157375_10400703 | 3300013308 | Bacteria | 1539 |
| 232 | Ga0157375_10635421 | 3300013308 | Bacteria | 1225 |
| 233 | Ga0157375_12653994 | 3300013308 | Bacteria | 599 |
| 234 | Ga0163163_10386072 | 3300014325 | Bacteria | 1458 |
| 235 | Ga0163163_10844071 | 3300014325 | Bacteria | 979 |
| 236 | Ga0163163_10922852 | 3300014325 | Bacteria | 936 |
| 237 | Ga0163163_11167050 | 3300014325 | Bacteria | 833 |
| 238 | Ga0157380_10130625 | 3300014326 | Bacteria | 2142 |
| 239 | Ga0157380_11175719 | 3300014326 | Bacteria | 810 |
| 240 | Ga0157380_11321769 | 3300014326 | Unclassified | 769 |
| 241 | Ga0157380_11848086 | 3300014326 | Bacteria | 664 |
| 242 | Ga0182008_10432221 | 3300014497 | Bacteria | 713 |
| 243 | Ga0157377_10240101 | 3300014745 | Bacteria | 1169 |
| 244 | Ga0157377_10262151 | 3300014745 | Bacteria | 1125 |
| 245 | Ga0157377_10742570 | 3300014745 | Bacteria | 717 |
| 246 | Ga0157377_11343838 | 3300014745 | Bacteria | 561 |
| 247 | Ga0157379_10295829 | 3300014968 | Bacteria | 1475 |
| 248 | Ga0157379_11743113 | 3300014968 | Bacteria | 611 |
| 249 | Ga0157376_12201187 | 3300014969 | Bacteria | 590 |
| 250 | Ga0182007_10177447 | 3300015262 | Bacteria | 735 |
| 251 | Ga0206356_11445486 | 3300020070 | Bacteria | 551 |
| 252 | Ga0206356_11503213 | 3300020070 | Bacteria | 2087 |
| 253 | Ga0206355_1293151 | 3300020076 | Bacteria | 616 |
| 254 | Ga0206352_10525377 | 3300020078 | Bacteria | 723 |
| 255 | Ga0206352_10713396 | 3300020078 | Bacteria | 729 |
| 256 | Ga0206350_10372490 | 3300020080 | Bacteria | 575 |
| 257 | Ga0206354_10198566 | 3300020081 | Bacteria | 1844 |
| 258 | Ga0206354_10316741 | 3300020081 | Bacteria | 554 |
| 259 | Ga0206354_10407136 | 3300020081 | Bacteria | 531 |
| 260 | Ga0206353_11262324 | 3300020082 | Bacteria | 711 |
| 261 | Ga0154015_1542708 | 3300020610 | Bacteria | 668 |
| 262 | Ga0224712_10283472 | 3300022467 | Bacteria | 772 |
| 263 | Ga0224712_10678866 | 3300022467 | Bacteria | 506 |
| 264 | Ga0207656_10296184 | 3300025321 | Bacteria | 800 |
| 265 | Ga0207642_10009247 | 3300025899 | Bacteria | 3421 |
| 266 | Ga0207710_10165255 | 3300025900 | Bacteria | 1080 |
| 267 | Ga0207688_10026391 | 3300025901 | Bacteria | 3194 |
| 268 | Ga0207647_10107039 | 3300025904 | Bacteria | 1655 |
| 269 | Ga0207647_10737996 | 3300025904 | Bacteria | 534 |
| 270 | Ga0207643_10114673 | 3300025908 | Bacteria | 1590 |
| 271 | Ga0207643_10375665 | 3300025908 | Bacteria | 895 |
| 272 | Ga0207705_10036997 | 3300025909 | Bacteria | 3493 |
| 273 | Ga0207705_10173824 | 3300025909 | Bacteria | 1623 |
| 274 | Ga0207705_10180942 | 3300025909 | Bacteria | 1591 |
| 275 | Ga0207705_11486457 | 3300025909 | Bacteria | 513 |
| 276 | Ga0207654_10506530 | 3300025911 | Bacteria | 853 |
| 277 | Ga0207654_10767660 | 3300025911 | Bacteria | 695 |
| 278 | Ga0207707_10033822 | 3300025912 | Bacteria | 4474 |
| 279 | Ga0207695_10054488 | 3300025913 | Bacteria | 4175 |
| 280 | Ga0207695_10389041 | 3300025913 | Bacteria | 1279 |
| 281 | Ga0207695_10702682 | 3300025913 | Bacteria | 892 |
| 282 | Ga0207671_10174366 | 3300025914 | Bacteria | 1671 |
| 283 | Ga0207671_10232287 | 3300025914 | Bacteria | 1447 |
| 284 | Ga0207671_11028709 | 3300025914 | Bacteria | 648 |
| 285 | Ga0207693_10181638 | 3300025915 | Bacteria | 1656 |
| 286 | Ga0207663_10827445 | 3300025916 | Bacteria | 738 |
| 287 | Ga0207660_10042285 | 3300025917 | Bacteria | 3198 |
| 288 | Ga0207660_11176702 | 3300025917 | Bacteria | 624 |
| 289 | Ga0207662_10014010 | 3300025918 | Bacteria | 4491 |
| 290 | Ga0207657_10009087 | 3300025919 | Bacteria | 10029 |
| 291 | Ga0207657_10097388 | 3300025919 | Bacteria | 2446 |
| 292 | Ga0207657_10136478 | 3300025919 | Bacteria | 2007 |
| 293 | Ga0207657_10208285 | 3300025919 | Bacteria | 1570 |
| 294 | Ga0207649_10005084 | 3300025920 | Bacteria | 7109 |
| 295 | Ga0207649_10220536 | 3300025920 | Bacteria | 1350 |
| 296 | Ga0207649_10279763 | 3300025920 | Bacteria | 1213 |
| 297 | Ga0207649_10721721 | 3300025920 | Bacteria | 774 |
| 298 | Ga0207652_10008391 | 3300025921 | Bacteria | 8311 |
| 299 | Ga0207681_10093662 | 3300025923 | Bacteria | 2151 |
| 300 | Ga0207681_11605913 | 3300025923 | Bacteria | 544 |
| 301 | Ga0207694_10034485 | 3300025924 | Bacteria | 3880 |
| 302 | Ga0207659_11712342 | 3300025926 | Bacteria | 535 |
| 303 | Ga0207687_10024765 | 3300025927 | Bacteria | 4012 |
| 304 | Ga0207687_10090019 | 3300025927 | Bacteria | 2235 |
| 305 | Ga0207687_10325248 | 3300025927 | Bacteria | 1246 |
| 306 | Ga0207687_10341644 | 3300025927 | Bacteria | 1217 |
| 307 | Ga0207687_11035344 | 3300025927 | Bacteria | 704 |
| 308 | Ga0207644_10806657 | 3300025931 | Bacteria | 785 |
| 309 | Ga0207644_11572959 | 3300025931 | Bacteria | 552 |
| 310 | Ga0207690_10012557 | 3300025932 | Bacteria | 5070 |
| 311 | Ga0207690_10337535 | 3300025932 | Bacteria | 1188 |
| 312 | Ga0207690_11424473 | 3300025932 | Bacteria | 579 |
| 313 | Ga0207706_10042095 | 3300025933 | Bacteria | 4048 |
| 314 | Ga0207686_10000016 | 3300025934 | Bacteria | 198779 |
| 315 | Ga0207709_10042898 | 3300025935 | Bacteria | 2724 |
| 316 | Ga0207709_10076448 | 3300025935 | Bacteria | 2143 |
| 317 | Ga0207709_10145548 | 3300025935 | Bacteria | 1634 |
| 318 | Ga0207670_10003497 | 3300025936 | Bacteria | 8339 |
| 319 | Ga0207669_10196747 | 3300025937 | Bacteria | 1459 |
| 320 | Ga0207669_10562451 | 3300025937 | Bacteria | 922 |
| 321 | Ga0207669_11151052 | 3300025937 | Bacteria | 656 |
| 322 | Ga0207704_10189612 | 3300025938 | Bacteria | 1494 |
| 323 | Ga0207665_10311557 | 3300025939 | Bacteria | 1179 |
| 324 | Ga0207691_10187500 | 3300025940 | Bacteria | 1805 |
| 325 | Ga0207691_10904706 | 3300025940 | Bacteria | 739 |
| 326 | Ga0207691_11084222 | 3300025940 | Bacteria | 667 |
| 327 | Ga0207711_11617353 | 3300025941 | Bacteria | 591 |
| 328 | Ga0207689_10102706 | 3300025942 | Bacteria | 2349 |
| 329 | Ga0207689_10650945 | 3300025942 | Bacteria | 888 |
| 330 | Ga0207661_10015973 | 3300025944 | Bacteria | 5532 |
| 331 | Ga0207661_10069961 | 3300025944 | Bacteria | 2863 |
| 332 | Ga0207661_10145819 | 3300025944 | Bacteria | 2042 |
| 333 | Ga0207661_10159902 | 3300025944 | Bacteria | 1954 |
| 334 | Ga0207661_10403967 | 3300025944 | Bacteria | 1239 |
| 335 | Ga0207679_10069057 | 3300025945 | Bacteria | 2657 |
| 336 | Ga0207679_10305814 | 3300025945 | Bacteria | 1372 |
| 337 | Ga0207679_10518926 | 3300025945 | Bacteria | 1065 |
| 338 | Ga0207679_10577290 | 3300025945 | Bacteria | 1011 |
| 339 | Ga0207679_10586854 | 3300025945 | Bacteria | 1003 |
| 340 | Ga0207679_10603484 | 3300025945 | Bacteria | 989 |
| 341 | Ga0207667_10220657 | 3300025949 | Bacteria | 1942 |
| 342 | Ga0207651_11146976 | 3300025960 | Bacteria | 697 |
| 343 | Ga0207712_10065345 | 3300025961 | Bacteria | 2596 |
| 344 | Ga0207712_10156072 | 3300025961 | Bacteria | 1768 |
| 345 | Ga0207712_10284829 | 3300025961 | Bacteria | 1350 |
| 346 | Ga0207712_10332957 | 3300025961 | Bacteria | 1256 |
| 347 | Ga0207712_11070954 | 3300025961 | Bacteria | 717 |
| 348 | Ga0207712_11327086 | 3300025961 | Bacteria | 643 |
| 349 | Ga0207668_10367059 | 3300025972 | Bacteria | 1208 |
| 350 | Ga0207668_10887491 | 3300025972 | Bacteria | 793 |
| 351 | Ga0207668_10931666 | 3300025972 | Bacteria | 774 |
| 352 | Ga0207640_10190385 | 3300025981 | Bacteria | 1546 |
| 353 | Ga0207640_10201835 | 3300025981 | Bacteria | 1507 |
| 354 | Ga0207640_10466701 | 3300025981 | Bacteria | 1044 |
| 355 | Ga0207640_10744204 | 3300025981 | Bacteria | 844 |
| 356 | Ga0207640_10882555 | 3300025981 | Bacteria | 780 |
| 357 | Ga0207658_10380929 | 3300025986 | Bacteria | 1235 |
| 358 | Ga0207677_10096478 | 3300026023 | Bacteria | 2163 |
| 359 | Ga0207677_10642050 | 3300026023 | Bacteria | 936 |
| 360 | Ga0207703_10076087 | 3300026035 | Bacteria | 2783 |
| 361 | Ga0207703_11441467 | 3300026035 | Bacteria | 662 |
| 362 | Ga0207639_10056632 | 3300026041 | Bacteria | 3005 |
| 363 | Ga0207639_10103276 | 3300026041 | Bacteria | 2309 |
| 364 | Ga0207639_10144340 | 3300026041 | Bacteria | 1987 |
| 365 | Ga0207678_10097579 | 3300026067 | Bacteria | 2511 |
| 366 | Ga0207678_10168141 | 3300026067 | Bacteria | 1872 |
| 367 | Ga0207678_10351842 | 3300026067 | Bacteria | 1270 |
| 368 | Ga0207678_10800735 | 3300026067 | Bacteria | 832 |
| 369 | Ga0207708_10015341 | 3300026075 | Bacteria | 5746 |
| 370 | Ga0207708_10058187 | 3300026075 | Bacteria | 2949 |
| 371 | Ga0207708_11860809 | 3300026075 | Bacteria | 528 |
| 372 | Ga0207702_10015459 | 3300026078 | Bacteria | 6320 |
| 373 | Ga0207702_10408691 | 3300026078 | Bacteria | 1310 |
| 374 | Ga0207702_10566464 | 3300026078 | Bacteria | 1112 |
| 375 | Ga0207702_10838347 | 3300026078 | Bacteria | 910 |
| 376 | Ga0207702_11999597 | 3300026078 | Bacteria | 570 |
| 377 | Ga0207641_10003652 | 3300026088 | Bacteria | 13571 |
| 378 | Ga0207641_10608177 | 3300026088 | Bacteria | 1071 |
| 379 | Ga0207641_11866336 | 3300026088 | Bacteria | 603 |
| 380 | Ga0207648_10030168 | 3300026089 | Bacteria | 4806 |
| 381 | Ga0207648_10533452 | 3300026089 | Bacteria | 1076 |
| 382 | Ga0207676_10122419 | 3300026095 | Bacteria | 2196 |
| 383 | Ga0207676_10288667 | 3300026095 | Bacteria | 1493 |
| 384 | Ga0207674_10049021 | 3300026116 | Bacteria | 4321 |
| 385 | Ga0207674_10134101 | 3300026116 | Bacteria | 2439 |
| 386 | Ga0207674_10210974 | 3300026116 | Bacteria | 1891 |
| 387 | Ga0207674_10423727 | 3300026116 | Bacteria | 1286 |
| 388 | Ga0207674_10719417 | 3300026116 | Bacteria | 964 |
| 389 | Ga0207675_100031946 | 3300026118 | Bacteria | 4905 |
| 390 | Ga0207675_100428967 | 3300026118 | Bacteria | 1307 |
| 391 | Ga0207675_100641912 | 3300026118 | Bacteria | 1067 |
| 392 | Ga0207675_100872742 | 3300026118 | Bacteria | 915 |
| 393 | Ga0207683_10089555 | 3300026121 | Bacteria | 2739 |
| 394 | Ga0207683_10373816 | 3300026121 | Bacteria | 1309 |
| 395 | Ga0207683_11029378 | 3300026121 | Bacteria | 764 |
| 396 | Ga0207683_11135890 | 3300026121 | Bacteria | 724 |
| 397 | Ga0207698_10025949 | 3300026142 | Bacteria | 4138 |
| 398 | Ga0207698_10073080 | 3300026142 | Bacteria | 2729 |
| 399 | Ga0207698_10141238 | 3300026142 | Bacteria | 2075 |
| 400 | Ga0207698_10226338 | 3300026142 | Bacteria | 1694 |
| 401 | Ga0207428_10202467 | 3300027907 | Bacteria | 1493 |
| 402 | Ga0207428_10364948 | 3300027907 | Bacteria | 1061 |
| 403 | Ga0268266_10000825 | 3300028379 | Bacteria | 40545 |
| 404 | Ga0268266_10298294 | 3300028379 | Bacteria | 1503 |
| 405 | Ga0268265_10063264 | 3300028380 | Bacteria | 2846 |
| 406 | Ga0268265_10835929 | 3300028380 | Bacteria | 900 |
| 407 | Ga0268265_11338164 | 3300028380 | Bacteria | 717 |
| 408 | Ga0268264_11344263 | 3300028381 | Bacteria | 725 |
| 409 | Ga0265320_10043731 | 3300031240 | Bacteria | 2212 |
| 410 | Ga0316576_10004257 | 3300031727 | Bacteria | 8553 |
| 411 | Ga0307405_10113312 | 3300031731 | Bacteria | 1841 |
| 412 | Ga0307405_10738989 | 3300031731 | Bacteria | 819 |
| 413 | Ga0316577_10357920 | 3300031733 | Bacteria | 828 |
| 414 | Ga0307413_10762734 | 3300031824 | Bacteria | 810 |
| 415 | Ga0307413_11900798 | 3300031824 | Bacteria | 535 |
| 416 | Ga0307410_11943072 | 3300031852 | Bacteria | 524 |
| 417 | Ga0307406_10011188 | 3300031901 | Bacteria | 5085 |
| 418 | Ga0307407_10475554 | 3300031903 | Bacteria | 911 |
| 419 | Ga0307416_100955803 | 3300032002 | Bacteria | 959 |
| 420 | Ga0307414_11677478 | 3300032004 | Bacteria | 593 |
| 421 | Ga0307411_10028474 | 3300032005 | Bacteria | 3397 |
| 422 | Ga0307411_11415651 | 3300032005 | Bacteria | 637 |
| 423 | Ga0373948_0061618 | 3300034817 | Bacteria | 825 |
| 424 | Ga0373950_0121138 | 3300034818 | Bacteria | 579 |
| 425 | Ga0373952_0230185 | 3300035092 | Bacteria | 554 |
| 426 | Ga0373960_0125908 | 3300035121 | Bacteria | 855 |
| 427 | Ga0316574_0089965 | 3300035398 | Bacteria | 1956 |
| 428 | Ga0316574_0173009 | 3300035398 | Bacteria | 1390 |
| 429 | Ga0373947_0331856 | 3300035725 | Bacteria | 1018 |
| 430 | Ga0316584_0011869 | 3300036712 | Bacteria | 6137 |
| 431 | Ga0395901_1906570 | 3300038443 | Bacteria | 542 |
| 432 | Ga0395901_2139636 | 3300038443 | Bacteria | 504 |
| 433 | Ga0242420_135132 | 3300038996 | Bacteria | 546 |
| 434 | Ga0451791_1346709 | 3300041451 | Bacteria | 597 |
| 435 | Ga0451807_1439438 | 3300041486 | Bacteria | 917 |
| 436 | Ga0451847_0878330 | 3300041503 | Bacteria | 523 |
| 437 | Ga0451849_0063983 | 3300041505 | Bacteria | 507 |
| 438 | Ga0451853_2540431 | 3300041512 | Bacteria | 837 |
| 439 | Ga0466965_0201839 | 3300044683 | Bacteria | 1055 |
| 440 | Ga0466963_0416701 | 3300044694 | Bacteria | 947 |
| 441 | Ga0466963_0644183 | 3300044694 | Bacteria | 748 |
| 442 | Ga0466964_0013475 | 3300044706 | Bacteria | 3102 |
| 443 | Ga0466964_0051349 | 3300044706 | Bacteria | 1693 |
| 444 | Ga0466964_0377478 | 3300044706 | Bacteria | 735 |
| 445 | Ga0466968_0399108 | 3300044735 | Bacteria | 674 |
| 446 | Ga0466960_0988890 | 3300044901 | Bacteria | 516 |
| 447 | Ga0466958_0873558 | 3300045836 | Bacteria | 587 |
| 448 | Ga0466967_0018953 | 3300045976 | Bacteria | 5520 |
| 449 | Ga0466967_0044251 | 3300045976 | Bacteria | 3860 |
| 450 | Ga0466967_0171045 | 3300045976 | Bacteria | 2044 |
| 451 | Ga0466967_0493033 | 3300045976 | Bacteria | 1201 |
| 452 | Ga0466967_0655653 | 3300045976 | Bacteria | 1038 |
| 453 | Ga0466967_0808307 | 3300045976 | Bacteria | 931 |
| 454 | Ga0466967_1500458 | 3300045976 | Bacteria | 671 |
| 455 | Ga0466967_1997437 | 3300045976 | Bacteria | 577 |
| 456 | Ga0495596_0088647 | 3300046500 | Bacteria | 1201 |
| 457 | Ga0495620_0263463 | 3300046515 | Bacteria | 657 |
| 458 | Ga0495630_0260811 | 3300046517 | Bacteria | 1324 |
| 459 | Ga0495632_0206939 | 3300046519 | Bacteria | 891 |
| 460 | Ga0495625_0869388 | 3300046660 | Bacteria | 519 |
| 461 | Ga0495670_0706984 | 3300046691 | Bacteria | 550 |
| 462 | Ga0495589_0165686 | 3300046794 | Bacteria | 1052 |
| 463 | Ga0495589_0184791 | 3300046794 | Bacteria | 988 |
| 464 | Ga0495676_0000652 | 3300047321 | Bacteria | 28858 |
| 465 | Ga0495676_0024641 | 3300047321 | Bacteria | 5205 |
| 466 | Ga0495676_0032649 | 3300047321 | Bacteria | 4392 |
| 467 | Ga0495686_0206073 | 3300047472 | Bacteria | 1126 |
| 468 | Ga0495615_0170282 | 3300048090 | Bacteria | 659 |
| 469 | Ga0495626_0400513 | 3300048091 | Bacteria | 531 |
| 470 | Ga0496100_0000063 | 3300048903 | Bacteria | 60957 |
| 471 | Ga0496100_0035388 | 3300048903 | Bacteria | 3140 |
| 472 | Ga0496101_0000012 | 3300048904 | Bacteria | 268127 |
| 473 | Ga0496101_0236416 | 3300048904 | Bacteria | 1421 |
| 474 | Ga0496102_0000061 | 3300048905 | Bacteria | 167066 |
| 475 | Ga0496103_0000044 | 3300048906 | Bacteria | 167066 |
| 476 | Ga0496103_0642584 | 3300048906 | Bacteria | 674 |
| 477 | Ga0496104_0006120 | 3300048907 | Bacteria | 10563 |
| 478 | Ga0496104_0248797 | 3300048907 | Bacteria | 1690 |
| 479 | Ga0496104_0672917 | 3300048907 | Bacteria | 943 |
| 480 | Ga0496105_0013280 | 3300048908 | Bacteria | 6536 |
| 481 | Ga0496105_0383917 | 3300048908 | Bacteria | 1117 |
| 482 | Ga0496106_0000020 | 3300048909 | Bacteria | 169168 |
| 483 | Ga0496106_0067519 | 3300048909 | Bacteria | 2726 |
| 484 | Ga0496106_0133515 | 3300048909 | Bacteria | 1948 |
| 485 | Ga0496107_0000014 | 3300048910 | Bacteria | 176738 |
| 486 | Ga0496108_0199825 | 3300048911 | Bacteria | 1735 |
| 487 | Ga0496108_0415078 | 3300048911 | Bacteria | 1176 |
| 488 | Ga0496108_0489984 | 3300048911 | Bacteria | 1074 |
| 489 | Ga0496108_0583631 | 3300048911 | Bacteria | 974 |
| 490 | Ga0496109_0619838 | 3300048912 | Bacteria | 1018 |
| 491 | Ga0496109_1084366 | 3300048912 | Bacteria | 738 |
| 492 | Ga0496109_1260409 | 3300048912 | Bacteria | 675 |
| 493 | Ga0496110_0035815 | 3300048913 | Bacteria | 4308 |
| 494 | Ga0496110_0289265 | 3300048913 | Bacteria | 1492 |
| 495 | Ga0496110_0320583 | 3300048913 | Bacteria | 1412 |
| 496 | Ga0496110_0332049 | 3300048913 | Bacteria | 1385 |
| 497 | Ga0496110_0658612 | 3300048913 | Bacteria | 947 |
| 498 | Ga0496111_0270615 | 3300048914 | Bacteria | 1260 |
| 499 | Ga0496111_0361712 | 3300048914 | Bacteria | 1074 |
| 500 | Ga0496111_0926831 | 3300048914 | Bacteria | 626 |
| 501 | Ga0496112_0106845 | 3300048915 | Bacteria | 2769 |
| 502 | Ga0496112_0502735 | 3300048915 | Bacteria | 1147 |
| 503 | Ga0496112_0771266 | 3300048915 | Bacteria | 887 |
| 504 | Ga0496113_0059089 | 3300048916 | Bacteria | 2888 |
| 505 | Ga0496113_0495575 | 3300048916 | Bacteria | 981 |
| 506 | Ga0496113_0600311 | 3300048916 | Bacteria | 881 |
| 507 | Ga0496113_0602581 | 3300048916 | Bacteria | 880 |
| 508 | Ga0496114_0655224 | 3300048917 | Bacteria | 923 |
| 509 | Ga0496114_0748394 | 3300048917 | Bacteria | 854 |
| 510 | Ga0496115_0579766 | 3300048918 | Bacteria | 894 |
| 511 | Ga0496115_0591710 | 3300048918 | Bacteria | 883 |
| 512 | Ga0496115_1019788 | 3300048918 | Bacteria | 631 |
| 513 | Ga0496117_0300896 | 3300048920 | Bacteria | 849 |
| 514 | Ga0496118_0447022 | 3300048921 | Bacteria | 657 |
| 515 | Ga0496119_0012278 | 3300048922 | Bacteria | 6980 |
| 516 | Ga0496120_0243335 | 3300048923 | Bacteria | 848 |
| 517 | Ga0496121_0021031 | 3300048924 | Bacteria | 6417 |
| 518 | Ga0496124_0236434 | 3300048927 | Bacteria | 1362 |
| 519 | Ga0496124_0480152 | 3300048927 | Bacteria | 839 |
| 520 | Ga0496125_0025269 | 3300048928 | Bacteria | 5443 |
| 521 | Ga0496126_0061253 | 3300048929 | Bacteria | 3381 |
| 522 | Ga0496126_0343342 | 3300048929 | Bacteria | 1223 |
| 523 | Ga0501305_094822 | 3300049161 | Bacteria | 550 |
| 524 | Ga0501317_091011 | 3300049533 | Bacteria | 539 |
| 525 | Ga0501318_044932 | 3300049534 | Bacteria | 642 |
| 526 | Ga0501318_047069 | 3300049534 | Bacteria | 632 |
| 527 | Ga0501322_025022 | 3300049538 | Bacteria | 542 |
| 528 | Ga0501323_046080 | 3300049539 | Bacteria | 651 |
| 529 | Ga0501031_0018623 | 3300049568 | Bacteria | 4523 |
| 530 | Ga0501032_0535742 | 3300049569 | Bacteria | 747 |
| 531 | Ga0501033_0978290 | 3300049570 | Unclassified | 566 |
| 532 | Ga0501036_0100305 | 3300049572 | Bacteria | 2449 |
| 533 | Ga0501038_0273392 | 3300049574 | Bacteria | 1332 |
| 534 | Ga0501039_0007834 | 3300049575 | Bacteria | 8143 |
| 535 | Ga0501039_1531841 | 3300049575 | Bacteria | 512 |
| 536 | Ga0501041_0258902 | 3300049577 | Bacteria | 1094 |
| 537 | Ga0501042_0408377 | 3300049578 | Bacteria | 984 |
| 538 | Ga0501046_0616759 | 3300049580 | Bacteria | 769 |
| 539 | Ga0501047_0972961 | 3300049581 | Bacteria | 662 |
| 540 | Ga0501072_0126564 | 3300049588 | Bacteria | 2036 |
| 541 | Ga0501074_0045895 | 3300049590 | Bacteria | 3160 |
| 542 | Ga0501075_0244214 | 3300049591 | Bacteria | 1369 |
| 543 | Ga0501076_0621722 | 3300049592 | Bacteria | 891 |
| 544 | Ga0501076_0710027 | 3300049592 | Bacteria | 830 |
| 545 | Ga0501035_0682913 | 3300049822 | Bacteria | 830 |
| 546 | Ga0501045_0350332 | 3300049824 | Bacteria | 1099 |
| 547 | nmdc:mga03n38_856879_c1 | 3300050490 | Bacteria | 532 |
| 548 | nmdc:mga0yw44_869008_c1 | 3300050492 | Bacteria | 612 |
| 549 | nmdc:mga05p37_3930_c1 | 3300050507 | Bacteria | 17409 |
| 550 | nmdc:mga06r32_151826_c1 | 3300050510 | Bacteria | 2295 |
| 551 | nmdc:mga08y16_144736_c1 | 3300050511 | Bacteria | 2470 |
| 552 | nmdc:mga08y16_392436_c1 | 3300050511 | Bacteria | 1422 |
| 553 | nmdc:mga0n895_11128_c1 | 3300050512 | Bacteria | 8007 |
| 554 | nmdc:mga0n895_2106849_c1 | 3300050512 | Bacteria | 520 |
| 555 | nmdc:mga0n895_554811_c1 | 3300050512 | Bacteria | 1154 |
| 556 | nmdc:mga0rr50_58019_c1 | 3300050513 | Bacteria | 2899 |
| 557 | nmdc:mga08x19_386451_c1 | 3300050514 | Bacteria | 980 |
| 558 | nmdc:mga0a205_5205_c1 | 3300050515 | Bacteria | 11703 |
| 559 | Ga0500641_0011550 | 3300053096 | Bacteria | 3206 |
| 560 | Ga0500588_0174117 | 3300053146 | Bacteria | 789 |
| 561 | Ga0501084_0085381 | 3300054114 | Bacteria | 2650 |
| 562 | Ga0590075_059488 | 3300059424 | Bacteria | 984 |
| 563 | Ga0587070_221483 | 3300059491 | Bacteria | 513 |
| 564 | Ga0587083_0232094 | 3300059505 | Bacteria | 542 |
| 565 | Ga0587099_023749 | 3300059622 | Bacteria | 709 |
| 566 | Ga0587101_145433 | 3300059623 | Bacteria | 510 |
| 567 | Ga0587128_121083 | 3300059630 | Bacteria | 570 |
| 568 | Ga0587111_0091501 | 3300060346 | Bacteria | 744 |
| 569 | Ga0501082_0528419 | 3300060353 | Bacteria | 1031 |
| 570 | Ga0530510_1203627 | 3300061734 | Bacteria | 581 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0018623 | Ga0501031_0018623_3308_3637 | 96 |
| 2 | 3300049569 | Ga0501032_0535742 | Ga0501032_0535742_278_607 | 96 |
| 3 | 3300049570 | Ga0501033_0978290 | Ga0501033_0978290_176_505 | 96 |
| 4 | 3300049572 | Ga0501036_0100305 | Ga0501036_0100305_525_854 | 96 |
| 5 | 3300049574 | Ga0501038_0273392 | Ga0501038_0273392_678_1007 | 96 |
| 6 | 3300049575 | Ga0501039_0007834 | Ga0501039_0007834_1676_2005 | 96 |
| 7 | 3300049577 | Ga0501041_0258902 | Ga0501041_0258902_581_910 | 96 |
| 8 | 3300049591 | Ga0501075_0244214 | Ga0501075_0244214_785_1114 | 96 |
| 9 | 3300049592 | Ga0501076_0621722 | Ga0501076_0621722_38_367 | 96 |
| 10 | 3300049824 | Ga0501045_0350332 | Ga0501045_0350332_93_422 | 96 |
| 11 | 3300054114 | Ga0501084_0085381 | Ga0501084_0085381_917_1246 | 96 |
| 12 | 3300060353 | Ga0501082_0528419 | Ga0501082_0528419_604_933 | 96 |
| 13 | 3300049580 | Ga0501046_0616759 | Ga0501046_0616759_148_453 | 97 |
| 14 | 3300035725 | Ga0373947_0331856 | Ga0373947_0331856_513_833 | 103 |
| 15 | 3300047321 | Ga0495676_0032649 | Ga0495676_0032649_1172_1492 | 103 |
| 16 | 3300009093 | Ga0105240_10332232 | Ga0105240_103322322 | 104 |
| 17 | 3300009147 | Ga0114129_12020903 | Ga0114129_120209031 | 104 |
| 18 | 3300009174 | Ga0105241_10512758 | Ga0105241_105127584 | 104 |
| 19 | 3300009551 | Ga0105238_10250990 | Ga0105238_102509902 | 104 |
| 20 | 3300014325 | Ga0163163_10844071 | Ga0163163_108440712 | 104 |
| 21 | 3300044706 | Ga0466964_0013475 | Ga0466964_0013475_1434_1757 | 104 |
| 22 | 3300045976 | Ga0466967_1500458 | Ga0466967_1500458_293_616 | 104 |
| 23 | 3300045976 | Ga0466967_1997437 | Ga0466967_1997437_165_479 | 104 |
| 24 | 3300046519 | Ga0495632_0206939 | Ga0495632_0206939_181_495 | 104 |
| 25 | 3300046660 | Ga0495625_0869388 | Ga0495625_0869388_177_491 | 104 |
| 26 | 3300048907 | Ga0496104_0006120 | Ga0496104_0006120_6765_7079 | 104 |
| 27 | 3300048908 | Ga0496105_0013280 | Ga0496105_0013280_2154_2468 | 104 |
| 28 | 3300048909 | Ga0496106_0133515 | Ga0496106_0133515_1303_1617 | 104 |
| 29 | 3300048913 | Ga0496110_0658612 | Ga0496110_0658612_611_925 | 104 |
| 30 | 3300048917 | Ga0496114_0655224 | Ga0496114_0655224_538_852 | 104 |
| 31 | 3300048922 | Ga0496119_0012278 | Ga0496119_0012278_5054_5368 | 104 |
| 32 | 3300048923 | Ga0496120_0243335 | Ga0496120_0243335_174_488 | 104 |
| 33 | 3300048924 | Ga0496121_0021031 | Ga0496121_0021031_4222_4536 | 104 |
| 34 | 3300048927 | Ga0496124_0236434 | Ga0496124_0236434_126_440 | 104 |
| 35 | 3300048927 | Ga0496124_0480152 | Ga0496124_0480152_29_343 | 104 |
| 36 | 3300048928 | Ga0496125_0025269 | Ga0496125_0025269_3861_4175 | 104 |
| 37 | 3300048929 | Ga0496126_0061253 | Ga0496126_0061253_2794_3108 | 104 |
| 38 | 3300049590 | Ga0501074_0045895 | Ga0501074_0045895_1963_2277 | 104 |
| 39 | 3300031824 | Ga0307413_10762734 | Ga0307413_107627342 | 105 |
| 40 | 3300032005 | Ga0307411_11415651 | Ga0307411_114156512 | 105 |
| 41 | 3300034817 | Ga0373948_0061618 | Ga0373948_0061618_103_420 | 105 |
| 42 | 3300046515 | Ga0495620_0263463 | Ga0495620_0263463_241_564 | 105 |
| 43 | 3300049575 | Ga0501039_1531841 | Ga0501039_1531841_144_473 | 105 |
| 44 | 3300049578 | Ga0501042_0408377 | Ga0501042_0408377_168_497 | 105 |
| 45 | 3300049588 | Ga0501072_0126564 | Ga0501072_0126564_866_1195 | 105 |
| 46 | 3300049592 | Ga0501076_0710027 | Ga0501076_0710027_401_730 | 105 |
| 47 | 3300050512 | nmdc:mga0n895_2106849_c1 | nmdc:mga0n895_2106849_c1_180_503 | 105 |
| 48 | 3300020081 | Ga0206354_10407136 | Ga0206354_104071361 | 106 |
| 49 | 3300031240 | Ga0265320_10043731 | Ga0265320_100437312 | 106 |
| 50 | 3300005530 | Ga0070679_100985961 | Ga0070679_1009859612 | 107 |
| 51 | 3300009176 | Ga0105242_11065490 | Ga0105242_110654902 | 107 |
| 52 | 3300009177 | Ga0105248_10309593 | Ga0105248_103095933 | 107 |
| 53 | 3300009551 | Ga0105238_11388550 | Ga0105238_113885502 | 107 |
| 54 | 3300014745 | Ga0157377_10742570 | Ga0157377_107425701 | 107 |
| 55 | 3300020078 | Ga0206352_10713396 | Ga0206352_107133961 | 107 |
| 56 | 3300025919 | Ga0207657_10208285 | Ga0207657_102082852 | 107 |
| 57 | 3300025940 | Ga0207691_11084222 | Ga0207691_110842222 | 107 |
| 58 | 3300025961 | Ga0207712_11327086 | Ga0207712_113270862 | 107 |
| 59 | 3300026121 | Ga0207683_10373816 | Ga0207683_103738162 | 107 |
| 60 | 3300031731 | Ga0307405_10113312 | Ga0307405_101133122 | 107 |
| 61 | 3300031901 | Ga0307406_10011188 | Ga0307406_100111885 | 107 |
| 62 | 3300031903 | Ga0307407_10475554 | Ga0307407_104755542 | 107 |
| 63 | 3300032005 | Ga0307411_10028474 | Ga0307411_100284743 | 107 |
| 64 | 3300044694 | Ga0466963_0416701 | Ga0466963_0416701_346_669 | 107 |
| 65 | 3300003162 | Ga0006778J45830_1007030 | Ga0006778J45830_10070301 | 108 |
| 66 | 3300003373 | JGI25407J50210_10119373 | JGI25407J50210_101193732 | 108 |
| 67 | 3300003559 | Ga0007427J51700_123134 | Ga0007427J51700_1231341 | 108 |
| 68 | 3300003575 | Ga0007409J51694_1012852 | Ga0007409J51694_10128521 | 108 |
| 69 | 3300004799 | Ga0058863_11847521 | Ga0058863_118475211 | 108 |
| 70 | 3300004800 | Ga0058861_11599725 | Ga0058861_115997252 | 108 |
| 71 | 3300005327 | Ga0070658_10062086 | Ga0070658_100620863 | 108 |
| 72 | 3300005327 | Ga0070658_10884271 | Ga0070658_108842712 | 108 |
| 73 | 3300005329 | Ga0070683_100072034 | Ga0070683_1000720341 | 108 |
| 74 | 3300005329 | Ga0070683_100212246 | Ga0070683_1002122462 | 108 |
| 75 | 3300005335 | Ga0070666_10050127 | Ga0070666_100501272 | 108 |
| 76 | 3300005336 | Ga0070680_100059698 | Ga0070680_1000596981 | 108 |
| 77 | 3300005337 | Ga0070682_100763164 | Ga0070682_1007631641 | 108 |
| 78 | 3300005337 | Ga0070682_101319499 | Ga0070682_1013194992 | 108 |
| 79 | 3300005338 | Ga0068868_100169079 | Ga0068868_1001690793 | 108 |
| 80 | 3300005339 | Ga0070660_100013384 | Ga0070660_1000133842 | 108 |
| 81 | 3300005344 | Ga0070661_100048843 | Ga0070661_1000488432 | 108 |
| 82 | 3300005345 | Ga0070692_10041984 | Ga0070692_100419842 | 108 |
| 83 | 3300005347 | Ga0070668_100369544 | Ga0070668_1003695442 | 108 |
| 84 | 3300005347 | Ga0070668_100524531 | Ga0070668_1005245312 | 108 |
| 85 | 3300005347 | Ga0070668_101522607 | Ga0070668_1015226072 | 108 |
| 86 | 3300005356 | Ga0070674_100118763 | Ga0070674_1001187632 | 108 |
| 87 | 3300005356 | Ga0070674_100879935 | Ga0070674_1008799352 | 108 |
| 88 | 3300005364 | Ga0070673_101490151 | Ga0070673_1014901511 | 108 |
| 89 | 3300005366 | Ga0070659_100004246 | Ga0070659_1000042463 | 108 |
| 90 | 3300005366 | Ga0070659_100486326 | Ga0070659_1004863262 | 108 |
| 91 | 3300005366 | Ga0070659_100818757 | Ga0070659_1008187572 | 108 |
| 92 | 3300005366 | Ga0070659_100989948 | Ga0070659_1009899482 | 108 |
| 93 | 3300005366 | Ga0070659_101901471 | Ga0070659_1019014711 | 108 |
| 94 | 3300005367 | Ga0070667_100516916 | Ga0070667_1005169162 | 108 |
| 95 | 3300005367 | Ga0070667_101644975 | Ga0070667_1016449751 | 108 |
| 96 | 3300005438 | Ga0070701_10689906 | Ga0070701_106899061 | 108 |
| 97 | 3300005441 | Ga0070700_100766501 | Ga0070700_1007665012 | 108 |
| 98 | 3300005456 | Ga0070678_101164719 | Ga0070678_1011647191 | 108 |
| 99 | 3300005457 | Ga0070662_101209196 | Ga0070662_1012091961 | 108 |
| 100 | 3300005458 | Ga0070681_10025672 | Ga0070681_100256722 | 108 |
| 101 | 3300005459 | Ga0068867_100153995 | Ga0068867_1001539952 | 108 |
| 102 | 3300005459 | Ga0068867_100405691 | Ga0068867_1004056912 | 108 |
| 103 | 3300005530 | Ga0070679_100015880 | Ga0070679_1000158804 | 108 |
| 104 | 3300005535 | Ga0070684_100029841 | Ga0070684_1000298412 | 108 |
| 105 | 3300005539 | Ga0068853_100604032 | Ga0068853_1006040322 | 108 |
| 106 | 3300005539 | Ga0068853_101027634 | Ga0068853_1010276342 | 108 |
| 107 | 3300005539 | Ga0068853_102327863 | Ga0068853_1023278631 | 108 |
| 108 | 3300005539 | Ga0068853_102501937 | Ga0068853_1025019371 | 108 |
| 109 | 3300005544 | Ga0070686_100635466 | Ga0070686_1006354661 | 108 |
| 110 | 3300005544 | Ga0070686_101269116 | Ga0070686_1012691161 | 108 |
| 111 | 3300005548 | Ga0070665_100011475 | Ga0070665_1000114755 | 108 |
| 112 | 3300005548 | Ga0070665_100179522 | Ga0070665_1001795223 | 108 |
| 113 | 3300005549 | Ga0070704_100798978 | Ga0070704_1007989782 | 108 |
| 114 | 3300005563 | Ga0068855_100389858 | Ga0068855_1003898581 | 108 |
| 115 | 3300005563 | Ga0068855_100778967 | Ga0068855_1007789672 | 108 |
| 116 | 3300005564 | Ga0070664_100036090 | Ga0070664_1000360903 | 108 |
| 117 | 3300005564 | Ga0070664_100263323 | Ga0070664_1002633232 | 108 |
| 118 | 3300005564 | Ga0070664_100493372 | Ga0070664_1004933722 | 108 |
| 119 | 3300005577 | Ga0068857_100227204 | Ga0068857_1002272043 | 108 |
| 120 | 3300005577 | Ga0068857_101779532 | Ga0068857_1017795322 | 108 |
| 121 | 3300005578 | Ga0068854_100243263 | Ga0068854_1002432632 | 108 |
| 122 | 3300005578 | Ga0068854_100531377 | Ga0068854_1005313772 | 108 |
| 123 | 3300005578 | Ga0068854_100548696 | Ga0068854_1005486962 | 108 |
| 124 | 3300005578 | Ga0068854_100802416 | Ga0068854_1008024162 | 108 |
| 125 | 3300005614 | Ga0068856_100018802 | Ga0068856_1000188023 | 108 |
| 126 | 3300005614 | Ga0068856_100830161 | Ga0068856_1008301611 | 108 |
| 127 | 3300005615 | Ga0070702_100674221 | Ga0070702_1006742211 | 108 |
| 128 | 3300005616 | Ga0068852_100050849 | Ga0068852_1000508492 | 108 |
| 129 | 3300005616 | Ga0068852_100076061 | Ga0068852_1000760613 | 108 |
| 130 | 3300005616 | Ga0068852_100500523 | Ga0068852_1005005232 | 108 |
| 131 | 3300005618 | Ga0068864_100255643 | Ga0068864_1002556432 | 108 |
| 132 | 3300005718 | Ga0068866_10020436 | Ga0068866_100204363 | 108 |
| 133 | 3300005718 | Ga0068866_10570200 | Ga0068866_105702002 | 108 |
| 134 | 3300005719 | Ga0068861_100549775 | Ga0068861_1005497752 | 108 |
| 135 | 3300005719 | Ga0068861_100995317 | Ga0068861_1009953172 | 108 |
| 136 | 3300005834 | Ga0068851_10262970 | Ga0068851_102629702 | 108 |
| 137 | 3300005840 | Ga0068870_10605771 | Ga0068870_106057711 | 108 |
| 138 | 3300005841 | Ga0068863_100005579 | Ga0068863_1000055798 | 108 |
| 139 | 3300005842 | Ga0068858_100187883 | Ga0068858_1001878832 | 108 |
| 140 | 3300005844 | Ga0068862_101213815 | Ga0068862_1012138152 | 108 |
| 141 | 3300005844 | Ga0068862_101365838 | Ga0068862_1013658381 | 108 |
| 142 | 3300005844 | Ga0068862_101399816 | Ga0068862_1013998161 | 108 |
| 143 | 3300005937 | Ga0081455_10004081 | Ga0081455_100040812 | 108 |
| 144 | 3300005981 | Ga0081538_10053474 | Ga0081538_100534742 | 108 |
| 145 | 3300005983 | Ga0081540_1002274 | Ga0081540_10022743 | 108 |
| 146 | 3300005983 | Ga0081540_1017202 | Ga0081540_10172022 | 108 |
| 147 | 3300006038 | Ga0075365_10979607 | Ga0075365_109796071 | 108 |
| 148 | 3300006163 | Ga0070715_10430842 | Ga0070715_104308422 | 108 |
| 149 | 3300006847 | Ga0075431_101681470 | Ga0075431_1016814702 | 108 |
| 150 | 3300006852 | Ga0075433_10010256 | Ga0075433_100102566 | 108 |
| 151 | 3300006871 | Ga0075434_100003617 | Ga0075434_10000361712 | 108 |
| 152 | 3300006881 | Ga0068865_100296131 | Ga0068865_1002961312 | 108 |
| 153 | 3300006914 | Ga0075436_100318480 | Ga0075436_1003184801 | 108 |
| 154 | 3300007076 | Ga0075435_100010684 | Ga0075435_1000106843 | 108 |
| 155 | 3300009093 | Ga0105240_10031826 | Ga0105240_100318262 | 108 |
| 156 | 3300009093 | Ga0105240_10310792 | Ga0105240_103107923 | 108 |
| 157 | 3300009094 | Ga0111539_10184849 | Ga0111539_101848493 | 108 |
| 158 | 3300009147 | Ga0114129_10002590 | Ga0114129_1000259012 | 108 |
| 159 | 3300009148 | Ga0105243_10713433 | Ga0105243_107134332 | 108 |
| 160 | 3300009174 | Ga0105241_12155775 | Ga0105241_121557751 | 108 |
| 161 | 3300009176 | Ga0105242_10000239 | Ga0105242_100002393 | 108 |
| 162 | 3300009176 | Ga0105242_10505459 | Ga0105242_105054592 | 108 |
| 163 | 3300009177 | Ga0105248_11056983 | Ga0105248_110569832 | 108 |
| 164 | 3300009551 | Ga0105238_10045833 | Ga0105238_100458333 | 108 |
| 165 | 3300009551 | Ga0105238_10672935 | Ga0105238_106729352 | 108 |
| 166 | 3300009553 | Ga0105249_10049271 | Ga0105249_100492713 | 108 |
| 167 | 3300009553 | Ga0105249_10481868 | Ga0105249_104818683 | 108 |
| 168 | 3300009553 | Ga0105249_10727616 | Ga0105249_107276162 | 108 |
| 169 | 3300010375 | Ga0105239_10114226 | Ga0105239_101142263 | 108 |
| 170 | 3300010375 | Ga0105239_10675939 | Ga0105239_106759392 | 108 |
| 171 | 3300010375 | Ga0105239_11168023 | Ga0105239_111680232 | 108 |
| 172 | 3300010375 | Ga0105239_11744824 | Ga0105239_117448242 | 108 |
| 173 | 3300013102 | Ga0157371_10247795 | Ga0157371_102477952 | 108 |
| 174 | 3300013102 | Ga0157371_10331575 | Ga0157371_103315752 | 108 |
| 175 | 3300013104 | Ga0157370_10020903 | Ga0157370_100209033 | 108 |
| 176 | 3300013105 | Ga0157369_10050379 | Ga0157369_100503793 | 108 |
| 177 | 3300013296 | Ga0157374_11627796 | Ga0157374_116277961 | 108 |
| 178 | 3300013307 | Ga0157372_11544001 | Ga0157372_115440012 | 108 |
| 179 | 3300013307 | Ga0157372_12444150 | Ga0157372_124441501 | 108 |
| 180 | 3300013307 | Ga0157372_12766786 | Ga0157372_127667862 | 108 |
| 181 | 3300013308 | Ga0157375_10635421 | Ga0157375_106354212 | 108 |
| 182 | 3300013308 | Ga0157375_12653994 | Ga0157375_126539941 | 108 |
| 183 | 3300014325 | Ga0163163_10386072 | Ga0163163_103860722 | 108 |
| 184 | 3300014325 | Ga0163163_11167050 | Ga0163163_111670502 | 108 |
| 185 | 3300014326 | Ga0157380_11175719 | Ga0157380_111757192 | 108 |
| 186 | 3300014326 | Ga0157380_11321769 | Ga0157380_113217691 | 108 |
| 187 | 3300014326 | Ga0157380_11848086 | Ga0157380_118480862 | 108 |
| 188 | 3300014497 | Ga0182008_10432221 | Ga0182008_104322212 | 108 |
| 189 | 3300014745 | Ga0157377_11343838 | Ga0157377_113438381 | 108 |
| 190 | 3300014968 | Ga0157379_11743113 | Ga0157379_117431132 | 108 |
| 191 | 3300015262 | Ga0182007_10177447 | Ga0182007_101774472 | 108 |
| 192 | 3300020070 | Ga0206356_11445486 | Ga0206356_114454861 | 108 |
| 193 | 3300020070 | Ga0206356_11503213 | Ga0206356_115032131 | 108 |
| 194 | 3300020076 | Ga0206355_1293151 | Ga0206355_12931511 | 108 |
| 195 | 3300020078 | Ga0206352_10525377 | Ga0206352_105253772 | 108 |
| 196 | 3300020080 | Ga0206350_10372490 | Ga0206350_103724901 | 108 |
| 197 | 3300020081 | Ga0206354_10198566 | Ga0206354_101985661 | 108 |
| 198 | 3300020082 | Ga0206353_11262324 | Ga0206353_112623242 | 108 |
| 199 | 3300020610 | Ga0154015_1542708 | Ga0154015_15427081 | 108 |
| 200 | 3300022467 | Ga0224712_10283472 | Ga0224712_102834722 | 108 |
| 201 | 3300022467 | Ga0224712_10678866 | Ga0224712_106788661 | 108 |
| 202 | 3300025899 | Ga0207642_10009247 | Ga0207642_100092475 | 108 |
| 203 | 3300025904 | Ga0207647_10737996 | Ga0207647_107379961 | 108 |
| 204 | 3300025908 | Ga0207643_10375665 | Ga0207643_103756652 | 108 |
| 205 | 3300025909 | Ga0207705_10036997 | Ga0207705_100369972 | 108 |
| 206 | 3300025909 | Ga0207705_10173824 | Ga0207705_101738242 | 108 |
| 207 | 3300025909 | Ga0207705_11486457 | Ga0207705_114864571 | 108 |
| 208 | 3300025911 | Ga0207654_10767660 | Ga0207654_107676601 | 108 |
| 209 | 3300025912 | Ga0207707_10033822 | Ga0207707_100338222 | 108 |
| 210 | 3300025913 | Ga0207695_10054488 | Ga0207695_100544884 | 108 |
| 211 | 3300025913 | Ga0207695_10389041 | Ga0207695_103890412 | 108 |
| 212 | 3300025913 | Ga0207695_10702682 | Ga0207695_107026821 | 108 |
| 213 | 3300025914 | Ga0207671_10174366 | Ga0207671_101743662 | 108 |
| 214 | 3300025917 | Ga0207660_10042285 | Ga0207660_100422851 | 108 |
| 215 | 3300025919 | Ga0207657_10009087 | Ga0207657_100090879 | 108 |
| 216 | 3300025919 | Ga0207657_10136478 | Ga0207657_101364783 | 108 |
| 217 | 3300025920 | Ga0207649_10005084 | Ga0207649_100050844 | 108 |
| 218 | 3300025920 | Ga0207649_10279763 | Ga0207649_102797632 | 108 |
| 219 | 3300025921 | Ga0207652_10008391 | Ga0207652_100083918 | 108 |
| 220 | 3300025923 | Ga0207681_11605913 | Ga0207681_116059132 | 108 |
| 221 | 3300025924 | Ga0207694_10034485 | Ga0207694_100344852 | 108 |
| 222 | 3300025927 | Ga0207687_10325248 | Ga0207687_103252481 | 108 |
| 223 | 3300025927 | Ga0207687_10341644 | Ga0207687_103416442 | 108 |
| 224 | 3300025927 | Ga0207687_11035344 | Ga0207687_110353442 | 108 |
| 225 | 3300025932 | Ga0207690_10012557 | Ga0207690_100125572 | 108 |
| 226 | 3300025932 | Ga0207690_10337535 | Ga0207690_103375352 | 108 |
| 227 | 3300025932 | Ga0207690_11424473 | Ga0207690_114244732 | 108 |
| 228 | 3300025934 | Ga0207686_10000016 | Ga0207686_10000016130 | 108 |
| 229 | 3300025935 | Ga0207709_10145548 | Ga0207709_101455482 | 108 |
| 230 | 3300025937 | Ga0207669_10196747 | Ga0207669_101967471 | 108 |
| 231 | 3300025938 | Ga0207704_10189612 | Ga0207704_101896122 | 108 |
| 232 | 3300025940 | Ga0207691_10187500 | Ga0207691_101875003 | 108 |
| 233 | 3300025942 | Ga0207689_10650945 | Ga0207689_106509452 | 108 |
| 234 | 3300025944 | Ga0207661_10015973 | Ga0207661_100159732 | 108 |
| 235 | 3300025944 | Ga0207661_10159902 | Ga0207661_101599022 | 108 |
| 236 | 3300025945 | Ga0207679_10305814 | Ga0207679_103058142 | 108 |
| 237 | 3300025945 | Ga0207679_10577290 | Ga0207679_105772902 | 108 |
| 238 | 3300025945 | Ga0207679_10586854 | Ga0207679_105868542 | 108 |
| 239 | 3300025945 | Ga0207679_10603484 | Ga0207679_106034841 | 108 |
| 240 | 3300025949 | Ga0207667_10220657 | Ga0207667_102206573 | 108 |
| 241 | 3300025960 | Ga0207651_11146976 | Ga0207651_111469762 | 108 |
| 242 | 3300025961 | Ga0207712_10156072 | Ga0207712_101560722 | 108 |
| 243 | 3300025961 | Ga0207712_10284829 | Ga0207712_102848292 | 108 |
| 244 | 3300025972 | Ga0207668_10367059 | Ga0207668_103670592 | 108 |
| 245 | 3300025972 | Ga0207668_10931666 | Ga0207668_109316662 | 108 |
| 246 | 3300025981 | Ga0207640_10190385 | Ga0207640_101903852 | 108 |
| 247 | 3300025981 | Ga0207640_10466701 | Ga0207640_104667012 | 108 |
| 248 | 3300025981 | Ga0207640_10744204 | Ga0207640_107442041 | 108 |
| 249 | 3300025981 | Ga0207640_10882555 | Ga0207640_108825551 | 108 |
| 250 | 3300025986 | Ga0207658_10380929 | Ga0207658_103809291 | 108 |
| 251 | 3300026035 | Ga0207703_11441467 | Ga0207703_114414672 | 108 |
| 252 | 3300026041 | Ga0207639_10056632 | Ga0207639_100566322 | 108 |
| 253 | 3300026041 | Ga0207639_10144340 | Ga0207639_101443402 | 108 |
| 254 | 3300026067 | Ga0207678_10351842 | Ga0207678_103518422 | 108 |
| 255 | 3300026067 | Ga0207678_10800735 | Ga0207678_108007352 | 108 |
| 256 | 3300026075 | Ga0207708_10058187 | Ga0207708_100581873 | 108 |
| 257 | 3300026075 | Ga0207708_11860809 | Ga0207708_118608091 | 108 |
| 258 | 3300026078 | Ga0207702_10015459 | Ga0207702_100154593 | 108 |
| 259 | 3300026078 | Ga0207702_10566464 | Ga0207702_105664641 | 108 |
| 260 | 3300026078 | Ga0207702_11999597 | Ga0207702_119995971 | 108 |
| 261 | 3300026088 | Ga0207641_10003652 | Ga0207641_100036526 | 108 |
| 262 | 3300026089 | Ga0207648_10533452 | Ga0207648_105334522 | 108 |
| 263 | 3300026116 | Ga0207674_10210974 | Ga0207674_102109743 | 108 |
| 264 | 3300026116 | Ga0207674_10423727 | Ga0207674_104237272 | 108 |
| 265 | 3300026116 | Ga0207674_10719417 | Ga0207674_107194171 | 108 |
| 266 | 3300026118 | Ga0207675_100428967 | Ga0207675_1004289673 | 108 |
| 267 | 3300026118 | Ga0207675_100872742 | Ga0207675_1008727422 | 108 |
| 268 | 3300026121 | Ga0207683_11029378 | Ga0207683_110293782 | 108 |
| 269 | 3300026142 | Ga0207698_10025949 | Ga0207698_100259492 | 108 |
| 270 | 3300026142 | Ga0207698_10073080 | Ga0207698_100730802 | 108 |
| 271 | 3300026142 | Ga0207698_10226338 | Ga0207698_102263383 | 108 |
| 272 | 3300027907 | Ga0207428_10202467 | Ga0207428_102024672 | 108 |
| 273 | 3300028379 | Ga0268266_10000825 | Ga0268266_1000082535 | 108 |
| 274 | 3300028380 | Ga0268265_10835929 | Ga0268265_108359292 | 108 |
| 275 | 3300028380 | Ga0268265_11338164 | Ga0268265_113381641 | 108 |
| 276 | 3300028381 | Ga0268264_11344263 | Ga0268264_113442633 | 108 |
| 277 | 3300031727 | Ga0316576_10004257 | Ga0316576_100042576 | 108 |
| 278 | 3300031731 | Ga0307405_10738989 | Ga0307405_107389892 | 108 |
| 279 | 3300031733 | Ga0316577_10357920 | Ga0316577_103579203 | 108 |
| 280 | 3300031824 | Ga0307413_11900798 | Ga0307413_119007981 | 108 |
| 281 | 3300032002 | Ga0307416_100955803 | Ga0307416_1009558032 | 108 |
| 282 | 3300035398 | Ga0316574_0089965 | Ga0316574_0089965_592_918 | 108 |
| 283 | 3300035398 | Ga0316574_0173009 | Ga0316574_0173009_1054_1380 | 108 |
| 284 | 3300036712 | Ga0316584_0011869 | Ga0316584_0011869_857_1183 | 108 |
| 285 | 3300038443 | Ga0395901_1906570 | Ga0395901_1906570_80_406 | 108 |
| 286 | 3300038443 | Ga0395901_2139636 | Ga0395901_2139636_104_430 | 108 |
| 287 | 3300041451 | Ga0451791_1346709 | Ga0451791_1346709_23_349 | 108 |
| 288 | 3300041486 | Ga0451807_1439438 | Ga0451807_1439438_327_653 | 108 |
| 289 | 3300041503 | Ga0451847_0878330 | Ga0451847_0878330_162_488 | 108 |
| 290 | 3300041505 | Ga0451849_0063983 | Ga0451849_0063983_34_360 | 108 |
| 291 | 3300041512 | Ga0451853_2540431 | Ga0451853_2540431_213_539 | 108 |
| 292 | 3300044683 | Ga0466965_0201839 | Ga0466965_0201839_692_1018 | 108 |
| 293 | 3300044694 | Ga0466963_0644183 | Ga0466963_0644183_364_690 | 108 |
| 294 | 3300044706 | Ga0466964_0051349 | Ga0466964_0051349_1341_1667 | 108 |
| 295 | 3300044706 | Ga0466964_0377478 | Ga0466964_0377478_240_566 | 108 |
| 296 | 3300044735 | Ga0466968_0399108 | Ga0466968_0399108_277_603 | 108 |
| 297 | 3300045836 | Ga0466958_0873558 | Ga0466958_0873558_168_494 | 108 |
| 298 | 3300045976 | Ga0466967_0018953 | Ga0466967_0018953_2127_2453 | 108 |
| 299 | 3300045976 | Ga0466967_0044251 | Ga0466967_0044251_1469_1795 | 108 |
| 300 | 3300045976 | Ga0466967_0171045 | Ga0466967_0171045_1536_1862 | 108 |
| 301 | 3300045976 | Ga0466967_0493033 | Ga0466967_0493033_127_453 | 108 |
| 302 | 3300046517 | Ga0495630_0260811 | Ga0495630_0260811_942_1268 | 108 |
| 303 | 3300046794 | Ga0495589_0165686 | Ga0495589_0165686_658_996 | 108 |
| 304 | 3300046794 | Ga0495589_0184791 | Ga0495589_0184791_131_457 | 108 |
| 305 | 3300047321 | Ga0495676_0000652 | Ga0495676_0000652_25688_26014 | 108 |
| 306 | 3300047321 | Ga0495676_0024641 | Ga0495676_0024641_2811_3137 | 108 |
| 307 | 3300047472 | Ga0495686_0206073 | Ga0495686_0206073_94_420 | 108 |
| 308 | 3300048090 | Ga0495615_0170282 | Ga0495615_0170282_132_458 | 108 |
| 309 | 3300048903 | Ga0496100_0000063 | Ga0496100_0000063_36975_37301 | 108 |
| 310 | 3300048904 | Ga0496101_0000012 | Ga0496101_0000012_239878_240204 | 108 |
| 311 | 3300048905 | Ga0496102_0000061 | Ga0496102_0000061_146262_146588 | 108 |
| 312 | 3300048906 | Ga0496103_0000044 | Ga0496103_0000044_146262_146588 | 108 |
| 313 | 3300048907 | Ga0496104_0672917 | Ga0496104_0672917_337_663 | 108 |
| 314 | 3300048909 | Ga0496106_0000020 | Ga0496106_0000020_139379_139705 | 108 |
| 315 | 3300048910 | Ga0496107_0000014 | Ga0496107_0000014_139368_139694 | 108 |
| 316 | 3300048911 | Ga0496108_0199825 | Ga0496108_0199825_486_812 | 108 |
| 317 | 3300048911 | Ga0496108_0415078 | Ga0496108_0415078_349_675 | 108 |
| 318 | 3300048911 | Ga0496108_0489984 | Ga0496108_0489984_102_440 | 108 |
| 319 | 3300048912 | Ga0496109_0619838 | Ga0496109_0619838_76_402 | 108 |
| 320 | 3300048913 | Ga0496110_0289265 | Ga0496110_0289265_84_410 | 108 |
| 321 | 3300048913 | Ga0496110_0320583 | Ga0496110_0320583_95_421 | 108 |
| 322 | 3300048913 | Ga0496110_0332049 | Ga0496110_0332049_274_600 | 108 |
| 323 | 3300048914 | Ga0496111_0926831 | Ga0496111_0926831_203_529 | 108 |
| 324 | 3300048915 | Ga0496112_0106845 | Ga0496112_0106845_271_600 | 108 |
| 325 | 3300048916 | Ga0496113_0059089 | Ga0496113_0059089_1795_2121 | 108 |
| 326 | 3300048916 | Ga0496113_0602581 | Ga0496113_0602581_27_353 | 108 |
| 327 | 3300048918 | Ga0496115_0579766 | Ga0496115_0579766_346_684 | 108 |
| 328 | 3300048918 | Ga0496115_0591710 | Ga0496115_0591710_427_753 | 108 |
| 329 | 3300048920 | Ga0496117_0300896 | Ga0496117_0300896_254_580 | 108 |
| 330 | 3300048921 | Ga0496118_0447022 | Ga0496118_0447022_300_626 | 108 |
| 331 | 3300048929 | Ga0496126_0343342 | Ga0496126_0343342_266_604 | 108 |
| 332 | 3300049581 | Ga0501047_0972961 | Ga0501047_0972961_315_641 | 108 |
| 333 | 3300049822 | Ga0501035_0682913 | Ga0501035_0682913_155_481 | 108 |
| 334 | 3300050492 | nmdc:mga0yw44_869008_c1 | nmdc:mga0yw44_869008_c1_65_391 | 108 |
| 335 | 3300050507 | nmdc:mga05p37_3930_c1 | nmdc:mga05p37_3930_c1_8699_9028 | 108 |
| 336 | 3300050510 | nmdc:mga06r32_151826_c1 | nmdc:mga06r32_151826_c1_327_653 | 108 |
| 337 | 3300050511 | nmdc:mga08y16_144736_c1 | nmdc:mga08y16_144736_c1_1696_2025 | 108 |
| 338 | 3300050512 | nmdc:mga0n895_11128_c1 | nmdc:mga0n895_11128_c1_7355_7684 | 108 |
| 339 | 3300050513 | nmdc:mga0rr50_58019_c1 | nmdc:mga0rr50_58019_c1_1359_1688 | 108 |
| 340 | 3300050514 | nmdc:mga08x19_386451_c1 | nmdc:mga08x19_386451_c1_635_964 | 108 |
| 341 | 3300050515 | nmdc:mga0a205_5205_c1 | nmdc:mga0a205_5205_c1_4268_4597 | 108 |
| 342 | 3300053096 | Ga0500641_0011550 | Ga0500641_0011550_49_375 | 108 |
| 343 | 3300053146 | Ga0500588_0174117 | Ga0500588_0174117_425_763 | 108 |
| 344 | 3300059424 | Ga0590075_059488 | Ga0590075_059488_387_713 | 108 |
| 345 | 3300059491 | Ga0587070_221483 | Ga0587070_221483_22_348 | 108 |
| 346 | 3300059505 | Ga0587083_0232094 | Ga0587083_0232094_108_434 | 108 |
| 347 | 3300059622 | Ga0587099_023749 | Ga0587099_023749_295_621 | 108 |
| 348 | 3300005329 | Ga0070683_100307037 | Ga0070683_1003070372 | 109 |
| 349 | 3300005344 | Ga0070661_101259870 | Ga0070661_1012598701 | 109 |
| 350 | 3300005347 | Ga0070668_100190633 | Ga0070668_1001906333 | 109 |
| 351 | 3300005347 | Ga0070668_100935422 | Ga0070668_1009354221 | 109 |
| 352 | 3300005355 | Ga0070671_100494031 | Ga0070671_1004940312 | 109 |
| 353 | 3300005364 | Ga0070673_102051959 | Ga0070673_1020519591 | 109 |
| 354 | 3300005438 | Ga0070701_10474482 | Ga0070701_104744822 | 109 |
| 355 | 3300005440 | Ga0070705_100492021 | Ga0070705_1004920212 | 109 |
| 356 | 3300005444 | Ga0070694_100461333 | Ga0070694_1004613332 | 109 |
| 357 | 3300005456 | Ga0070678_100724073 | Ga0070678_1007240731 | 109 |
| 358 | 3300005545 | Ga0070695_100357212 | Ga0070695_1003572122 | 109 |
| 359 | 3300005546 | Ga0070696_100230968 | Ga0070696_1002309682 | 109 |
| 360 | 3300005549 | Ga0070704_100017370 | Ga0070704_1000173703 | 109 |
| 361 | 3300005564 | Ga0070664_100163679 | Ga0070664_1001636792 | 109 |
| 362 | 3300005618 | Ga0068864_100384459 | Ga0068864_1003844592 | 109 |
| 363 | 3300009098 | Ga0105245_10355229 | Ga0105245_103552292 | 109 |
| 364 | 3300009101 | Ga0105247_11235661 | Ga0105247_112356611 | 109 |
| 365 | 3300009148 | Ga0105243_10022548 | Ga0105243_100225483 | 109 |
| 366 | 3300009176 | Ga0105242_11609872 | Ga0105242_116098722 | 109 |
| 367 | 3300009545 | Ga0105237_10552458 | Ga0105237_105524582 | 109 |
| 368 | 3300009553 | Ga0105249_10789845 | Ga0105249_107898452 | 109 |
| 369 | 3300010375 | Ga0105239_10602238 | Ga0105239_106022381 | 109 |
| 370 | 3300013306 | Ga0163162_10915945 | Ga0163162_109159452 | 109 |
| 371 | 3300013306 | Ga0163162_12205920 | Ga0163162_122059202 | 109 |
| 372 | 3300014745 | Ga0157377_10240101 | Ga0157377_102401012 | 109 |
| 373 | 3300025914 | Ga0207671_11028709 | Ga0207671_110287092 | 109 |
| 374 | 3300025920 | Ga0207649_10220536 | Ga0207649_102205361 | 109 |
| 375 | 3300025927 | Ga0207687_10090019 | Ga0207687_100900192 | 109 |
| 376 | 3300025931 | Ga0207644_10806657 | Ga0207644_108066571 | 109 |
| 377 | 3300025937 | Ga0207669_11151052 | Ga0207669_111510522 | 109 |
| 378 | 3300025944 | Ga0207661_10069961 | Ga0207661_100699613 | 109 |
| 379 | 3300025945 | Ga0207679_10069057 | Ga0207679_100690572 | 109 |
| 380 | 3300025961 | Ga0207712_10332957 | Ga0207712_103329572 | 109 |
| 381 | 3300025961 | Ga0207712_11070954 | Ga0207712_110709541 | 109 |
| 382 | 3300025972 | Ga0207668_10887491 | Ga0207668_108874912 | 109 |
| 383 | 3300026023 | Ga0207677_10642050 | Ga0207677_106420501 | 109 |
| 384 | 3300026078 | Ga0207702_10838347 | Ga0207702_108383472 | 109 |
| 385 | 3300026088 | Ga0207641_11866336 | Ga0207641_118663361 | 109 |
| 386 | 3300026095 | Ga0207676_10288667 | Ga0207676_102886672 | 109 |
| 387 | 3300026118 | Ga0207675_100641912 | Ga0207675_1006419122 | 109 |
| 388 | 3300026121 | Ga0207683_11135890 | Ga0207683_111358902 | 109 |
| 389 | 3300032004 | Ga0307414_11677478 | Ga0307414_116774781 | 109 |
| 390 | 3300044901 | Ga0466960_0988890 | Ga0466960_0988890_77_406 | 109 |
| 391 | 3300045976 | Ga0466967_0655653 | Ga0466967_0655653_177_506 | 109 |
| 392 | 3300046691 | Ga0495670_0706984 | Ga0495670_0706984_73_402 | 109 |
| 393 | 3300048911 | Ga0496108_0583631 | Ga0496108_0583631_548_877 | 109 |
| 394 | 3300048912 | Ga0496109_1084366 | Ga0496109_1084366_230_559 | 109 |
| 395 | 3300048914 | Ga0496111_0361712 | Ga0496111_0361712_349_678 | 109 |
| 396 | 3300048915 | Ga0496112_0771266 | Ga0496112_0771266_26_355 | 109 |
| 397 | 3300048916 | Ga0496113_0495575 | Ga0496113_0495575_185_514 | 109 |
| 398 | 3300049534 | Ga0501318_044932 | Ga0501318_044932_60_389 | 109 |
| 399 | 3300060346 | Ga0587111_0091501 | Ga0587111_0091501_57_389 | 109 |
| 400 | 3300061734 | Ga0530510_1203627 | Ga0530510_1203627_91_420 | 109 |
| 401 | 3300001977 | JGI24746J21847_1065058 | JGI24746J21847_10650581 | 110 |
| 402 | 3300001990 | JGI24737J22298_10195880 | JGI24737J22298_101958802 | 110 |
| 403 | 3300001991 | JGI24743J22301_10076831 | JGI24743J22301_100768311 | 110 |
| 404 | 3300002076 | JGI24749J21850_1029203 | JGI24749J21850_10292032 | 110 |
| 405 | 3300002244 | JGI24742J22300_10056958 | JGI24742J22300_100569582 | 110 |
| 406 | 3300005327 | Ga0070658_10565830 | Ga0070658_105658302 | 110 |
| 407 | 3300005328 | Ga0070676_10433689 | Ga0070676_104336892 | 110 |
| 408 | 3300005329 | Ga0070683_100036702 | Ga0070683_1000367023 | 110 |
| 409 | 3300005329 | Ga0070683_100815340 | Ga0070683_1008153402 | 110 |
| 410 | 3300005330 | Ga0070690_100088950 | Ga0070690_1000889503 | 110 |
| 411 | 3300005331 | Ga0070670_100434356 | Ga0070670_1004343561 | 110 |
| 412 | 3300005334 | Ga0068869_100690484 | Ga0068869_1006904842 | 110 |
| 413 | 3300005337 | Ga0070682_100051657 | Ga0070682_1000516573 | 110 |
| 414 | 3300005338 | Ga0068868_100012973 | Ga0068868_1000129733 | 110 |
| 415 | 3300005339 | Ga0070660_100397988 | Ga0070660_1003979881 | 110 |
| 416 | 3300005340 | Ga0070689_100028871 | Ga0070689_1000288713 | 110 |
| 417 | 3300005341 | Ga0070691_10392570 | Ga0070691_103925701 | 110 |
| 418 | 3300005353 | Ga0070669_100495672 | Ga0070669_1004956722 | 110 |
| 419 | 3300005354 | Ga0070675_100299450 | Ga0070675_1002994502 | 110 |
| 420 | 3300005355 | Ga0070671_100574777 | Ga0070671_1005747772 | 110 |
| 421 | 3300005356 | Ga0070674_100057695 | Ga0070674_1000576952 | 110 |
| 422 | 3300005365 | Ga0070688_100035388 | Ga0070688_1000353883 | 110 |
| 423 | 3300005366 | Ga0070659_100020667 | Ga0070659_1000206673 | 110 |
| 424 | 3300005367 | Ga0070667_100073476 | Ga0070667_1000734762 | 110 |
| 425 | 3300005406 | Ga0070703_10599708 | Ga0070703_105997081 | 110 |
| 426 | 3300005437 | Ga0070710_10352932 | Ga0070710_103529322 | 110 |
| 427 | 3300005438 | Ga0070701_10052001 | Ga0070701_100520012 | 110 |
| 428 | 3300005439 | Ga0070711_100763851 | Ga0070711_1007638511 | 110 |
| 429 | 3300005440 | Ga0070705_100830397 | Ga0070705_1008303972 | 110 |
| 430 | 3300005444 | Ga0070694_100168673 | Ga0070694_1001686732 | 110 |
| 431 | 3300005456 | Ga0070678_100153293 | Ga0070678_1001532932 | 110 |
| 432 | 3300005459 | Ga0068867_100111135 | Ga0068867_1001111353 | 110 |
| 433 | 3300005466 | Ga0070685_10042777 | Ga0070685_100427773 | 110 |
| 434 | 3300005535 | Ga0070684_100298493 | Ga0070684_1002984932 | 110 |
| 435 | 3300005535 | Ga0070684_100446237 | Ga0070684_1004462372 | 110 |
| 436 | 3300005539 | Ga0068853_100053246 | Ga0068853_1000532463 | 110 |
| 437 | 3300005543 | Ga0070672_100569572 | Ga0070672_1005695722 | 110 |
| 438 | 3300005544 | Ga0070686_100110942 | Ga0070686_1001109422 | 110 |
| 439 | 3300005545 | Ga0070695_100401662 | Ga0070695_1004016622 | 110 |
| 440 | 3300005546 | Ga0070696_101606415 | Ga0070696_1016064151 | 110 |
| 441 | 3300005548 | Ga0070665_100866951 | Ga0070665_1008669512 | 110 |
| 442 | 3300005548 | Ga0070665_102433212 | Ga0070665_1024332122 | 110 |
| 443 | 3300005549 | Ga0070704_100330876 | Ga0070704_1003308761 | 110 |
| 444 | 3300005564 | Ga0070664_100145756 | Ga0070664_1001457563 | 110 |
| 445 | 3300005577 | Ga0068857_100092902 | Ga0068857_1000929022 | 110 |
| 446 | 3300005577 | Ga0068857_100110482 | Ga0068857_1001104822 | 110 |
| 447 | 3300005614 | Ga0068856_100703309 | Ga0068856_1007033092 | 110 |
| 448 | 3300005614 | Ga0068856_101293309 | Ga0068856_1012933091 | 110 |
| 449 | 3300005616 | Ga0068852_100112329 | Ga0068852_1001123292 | 110 |
| 450 | 3300005618 | Ga0068864_100288979 | Ga0068864_1002889792 | 110 |
| 451 | 3300005718 | Ga0068866_10016489 | Ga0068866_100164893 | 110 |
| 452 | 3300005834 | Ga0068851_10180312 | Ga0068851_101803122 | 110 |
| 453 | 3300005840 | Ga0068870_10401825 | Ga0068870_104018252 | 110 |
| 454 | 3300005841 | Ga0068863_100808692 | Ga0068863_1008086921 | 110 |
| 455 | 3300005842 | Ga0068858_100043518 | Ga0068858_1000435182 | 110 |
| 456 | 3300005843 | Ga0068860_100061878 | Ga0068860_1000618783 | 110 |
| 457 | 3300005844 | Ga0068862_100188267 | Ga0068862_1001882672 | 110 |
| 458 | 3300006048 | Ga0075363_100868529 | Ga0075363_1008685291 | 110 |
| 459 | 3300006058 | Ga0075432_10415468 | Ga0075432_104154682 | 110 |
| 460 | 3300006173 | Ga0070716_101303865 | Ga0070716_1013038651 | 110 |
| 461 | 3300006175 | Ga0070712_100112814 | Ga0070712_1001128141 | 110 |
| 462 | 3300006175 | Ga0070712_101771476 | Ga0070712_1017714761 | 110 |
| 463 | 3300006237 | Ga0097621_100898277 | Ga0097621_1008982771 | 110 |
| 464 | 3300006358 | Ga0068871_101248717 | Ga0068871_1012487171 | 110 |
| 465 | 3300006358 | Ga0068871_101320891 | Ga0068871_1013208912 | 110 |
| 466 | 3300006871 | Ga0075434_101796442 | Ga0075434_1017964422 | 110 |
| 467 | 3300006881 | Ga0068865_100549689 | Ga0068865_1005496892 | 110 |
| 468 | 3300009011 | Ga0105251_10424455 | Ga0105251_104244551 | 110 |
| 469 | 3300009092 | Ga0105250_10118940 | Ga0105250_101189401 | 110 |
| 470 | 3300009093 | Ga0105240_12602185 | Ga0105240_126021851 | 110 |
| 471 | 3300009094 | Ga0111539_10141088 | Ga0111539_101410883 | 110 |
| 472 | 3300009101 | Ga0105247_10143443 | Ga0105247_101434432 | 110 |
| 473 | 3300009147 | Ga0114129_12692250 | Ga0114129_126922501 | 110 |
| 474 | 3300009148 | Ga0105243_10014782 | Ga0105243_100147823 | 110 |
| 475 | 3300009545 | Ga0105237_11197643 | Ga0105237_111976432 | 110 |
| 476 | 3300009553 | Ga0105249_10038504 | Ga0105249_100385043 | 110 |
| 477 | 3300010375 | Ga0105239_10105708 | Ga0105239_101057082 | 110 |
| 478 | 3300011119 | Ga0105246_10055690 | Ga0105246_100556903 | 110 |
| 479 | 3300013100 | Ga0157373_10369487 | Ga0157373_103694872 | 110 |
| 480 | 3300013102 | Ga0157371_10668544 | Ga0157371_106685441 | 110 |
| 481 | 3300013296 | Ga0157374_10116789 | Ga0157374_101167891 | 110 |
| 482 | 3300013307 | Ga0157372_10069929 | Ga0157372_100699294 | 110 |
| 483 | 3300013308 | Ga0157375_10400703 | Ga0157375_104007032 | 110 |
| 484 | 3300014325 | Ga0163163_10922852 | Ga0163163_109228521 | 110 |
| 485 | 3300014326 | Ga0157380_10130625 | Ga0157380_101306253 | 110 |
| 486 | 3300014745 | Ga0157377_10262151 | Ga0157377_102621512 | 110 |
| 487 | 3300014968 | Ga0157379_10295829 | Ga0157379_102958291 | 110 |
| 488 | 3300014969 | Ga0157376_12201187 | Ga0157376_122011872 | 110 |
| 489 | 3300020081 | Ga0206354_10316741 | Ga0206354_103167411 | 110 |
| 490 | 3300025321 | Ga0207656_10296184 | Ga0207656_102961842 | 110 |
| 491 | 3300025900 | Ga0207710_10165255 | Ga0207710_101652551 | 110 |
| 492 | 3300025901 | Ga0207688_10026391 | Ga0207688_100263913 | 110 |
| 493 | 3300025904 | Ga0207647_10107039 | Ga0207647_101070392 | 110 |
| 494 | 3300025908 | Ga0207643_10114673 | Ga0207643_101146732 | 110 |
| 495 | 3300025909 | Ga0207705_10180942 | Ga0207705_101809423 | 110 |
| 496 | 3300025911 | Ga0207654_10506530 | Ga0207654_105065301 | 110 |
| 497 | 3300025914 | Ga0207671_10232287 | Ga0207671_102322872 | 110 |
| 498 | 3300025915 | Ga0207693_10181638 | Ga0207693_101816383 | 110 |
| 499 | 3300025916 | Ga0207663_10827445 | Ga0207663_108274451 | 110 |
| 500 | 3300025917 | Ga0207660_11176702 | Ga0207660_111767021 | 110 |
| 501 | 3300025918 | Ga0207662_10014010 | Ga0207662_100140102 | 110 |
| 502 | 3300025919 | Ga0207657_10097388 | Ga0207657_100973882 | 110 |
| 503 | 3300025920 | Ga0207649_10721721 | Ga0207649_107217212 | 110 |
| 504 | 3300025923 | Ga0207681_10093662 | Ga0207681_100936621 | 110 |
| 505 | 3300025926 | Ga0207659_11712342 | Ga0207659_117123422 | 110 |
| 506 | 3300025927 | Ga0207687_10024765 | Ga0207687_100247654 | 110 |
| 507 | 3300025931 | Ga0207644_11572959 | Ga0207644_115729591 | 110 |
| 508 | 3300025933 | Ga0207706_10042095 | Ga0207706_100420952 | 110 |
| 509 | 3300025935 | Ga0207709_10042898 | Ga0207709_100428983 | 110 |
| 510 | 3300025935 | Ga0207709_10076448 | Ga0207709_100764482 | 110 |
| 511 | 3300025936 | Ga0207670_10003497 | Ga0207670_100034973 | 110 |
| 512 | 3300025937 | Ga0207669_10562451 | Ga0207669_105624512 | 110 |
| 513 | 3300025939 | Ga0207665_10311557 | Ga0207665_103115571 | 110 |
| 514 | 3300025940 | Ga0207691_10904706 | Ga0207691_109047062 | 110 |
| 515 | 3300025941 | Ga0207711_11617353 | Ga0207711_116173531 | 110 |
| 516 | 3300025942 | Ga0207689_10102706 | Ga0207689_101027063 | 110 |
| 517 | 3300025944 | Ga0207661_10145819 | Ga0207661_101458193 | 110 |
| 518 | 3300025944 | Ga0207661_10403967 | Ga0207661_104039672 | 110 |
| 519 | 3300025945 | Ga0207679_10518926 | Ga0207679_105189262 | 110 |
| 520 | 3300025961 | Ga0207712_10065345 | Ga0207712_100653454 | 110 |
| 521 | 3300025981 | Ga0207640_10201835 | Ga0207640_102018351 | 110 |
| 522 | 3300026023 | Ga0207677_10096478 | Ga0207677_100964781 | 110 |
| 523 | 3300026035 | Ga0207703_10076087 | Ga0207703_100760874 | 110 |
| 524 | 3300026041 | Ga0207639_10103276 | Ga0207639_101032762 | 110 |
| 525 | 3300026067 | Ga0207678_10097579 | Ga0207678_100975793 | 110 |
| 526 | 3300026067 | Ga0207678_10168141 | Ga0207678_101681412 | 110 |
| 527 | 3300026075 | Ga0207708_10015341 | Ga0207708_100153413 | 110 |
| 528 | 3300026078 | Ga0207702_10408691 | Ga0207702_104086912 | 110 |
| 529 | 3300026088 | Ga0207641_10608177 | Ga0207641_106081773 | 110 |
| 530 | 3300026089 | Ga0207648_10030168 | Ga0207648_100301684 | 110 |
| 531 | 3300026095 | Ga0207676_10122419 | Ga0207676_101224193 | 110 |
| 532 | 3300026116 | Ga0207674_10049021 | Ga0207674_100490212 | 110 |
| 533 | 3300026116 | Ga0207674_10134101 | Ga0207674_101341013 | 110 |
| 534 | 3300026118 | Ga0207675_100031946 | Ga0207675_1000319463 | 110 |
| 535 | 3300026121 | Ga0207683_10089555 | Ga0207683_100895552 | 110 |
| 536 | 3300026142 | Ga0207698_10141238 | Ga0207698_101412382 | 110 |
| 537 | 3300027907 | Ga0207428_10364948 | Ga0207428_103649481 | 110 |
| 538 | 3300028379 | Ga0268266_10298294 | Ga0268266_102982941 | 110 |
| 539 | 3300028380 | Ga0268265_10063264 | Ga0268265_100632644 | 110 |
| 540 | 3300031852 | Ga0307410_11943072 | Ga0307410_119430721 | 110 |
| 541 | 3300034818 | Ga0373950_0121138 | Ga0373950_0121138_71_403 | 110 |
| 542 | 3300035092 | Ga0373952_0230185 | Ga0373952_0230185_194_526 | 110 |
| 543 | 3300035121 | Ga0373960_0125908 | Ga0373960_0125908_395_727 | 110 |
| 544 | 3300038996 | Ga0242420_135132 | Ga0242420_135132_58_390 | 110 |
| 545 | 3300045976 | Ga0466967_0808307 | Ga0466967_0808307_188_520 | 110 |
| 546 | 3300046500 | Ga0495596_0088647 | Ga0495596_0088647_337_669 | 110 |
| 547 | 3300048091 | Ga0495626_0400513 | Ga0495626_0400513_158_490 | 110 |
| 548 | 3300048903 | Ga0496100_0035388 | Ga0496100_0035388_19_351 | 110 |
| 549 | 3300048904 | Ga0496101_0236416 | Ga0496101_0236416_724_1056 | 110 |
| 550 | 3300048906 | Ga0496103_0642584 | Ga0496103_0642584_39_371 | 110 |
| 551 | 3300048907 | Ga0496104_0248797 | Ga0496104_0248797_520_852 | 110 |
| 552 | 3300048908 | Ga0496105_0383917 | Ga0496105_0383917_573_905 | 110 |
| 553 | 3300048909 | Ga0496106_0067519 | Ga0496106_0067519_1598_1930 | 110 |
| 554 | 3300048912 | Ga0496109_1260409 | Ga0496109_1260409_28_360 | 110 |
| 555 | 3300048913 | Ga0496110_0035815 | Ga0496110_0035815_603_935 | 110 |
| 556 | 3300048914 | Ga0496111_0270615 | Ga0496111_0270615_901_1233 | 110 |
| 557 | 3300048915 | Ga0496112_0502735 | Ga0496112_0502735_797_1129 | 110 |
| 558 | 3300048916 | Ga0496113_0600311 | Ga0496113_0600311_522_854 | 110 |
| 559 | 3300048917 | Ga0496114_0748394 | Ga0496114_0748394_194_526 | 110 |
| 560 | 3300048918 | Ga0496115_1019788 | Ga0496115_1019788_40_372 | 110 |
| 561 | 3300049161 | Ga0501305_094822 | Ga0501305_094822_177_509 | 110 |
| 562 | 3300049533 | Ga0501317_091011 | Ga0501317_091011_178_510 | 110 |
| 563 | 3300049534 | Ga0501318_047069 | Ga0501318_047069_260_592 | 110 |
| 564 | 3300049538 | Ga0501322_025022 | Ga0501322_025022_163_495 | 110 |
| 565 | 3300049539 | Ga0501323_046080 | Ga0501323_046080_149_481 | 110 |
| 566 | 3300050490 | nmdc:mga03n38_856879_c1 | nmdc:mga03n38_856879_c1_94_426 | 110 |
| 567 | 3300050511 | nmdc:mga08y16_392436_c1 | nmdc:mga08y16_392436_c1_411_743 | 110 |
| 568 | 3300050512 | nmdc:mga0n895_554811_c1 | nmdc:mga0n895_554811_c1_726_1058 | 110 |
| 569 | 3300059623 | Ga0587101_145433 | Ga0587101_145433_94_426 | 110 |
| 570 | 3300059630 | Ga0587128_121083 | Ga0587128_121083_168_500 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yj7-assembly2.cif.gz_B | crystal structure of a hyperstable protein from the precambrian period | 0.9885 | 4 | 105 |
| 2yn1-assembly2.cif.gz_B | crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period | 0.9865 | 4 | 106 |
| 6nup-assembly1.cif.gz_A | structure of thioredoxin (trxa) from rickettsia prowazekii str. madrid e. | 0.986 | 5 | 106 |
| 4wxt-assembly1.cif.gz_A | x-ray crystal structure of thioredoxin from mycobacterium avium | 0.9831 | 4 | 103 |
| 2o8v-assembly1.cif.gz_B | paps reductase in a covalent complex with thioredoxin c35a | 0.9824 | 4 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ulxA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9822 | 4 | 105 | 3.40.30.10 |
| 5hr1G00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9818 | 29 | 102 | 3.40.30.10 |
| 3dieB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9803 | 33 | 105 | 3.40.30.10 |
| af_Q9SEU7_68_173_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9738 | 6 | 109 | 3.40.30.10 |
| af_Q5JMR9_59_168_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9735 | 13 | 108 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N7YBN7-F1-model_v4 | Thioredoxin | 1.003 | 4 | 105 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A7V9K472-F1-model_v4 | Thioredoxin | 1.001 | 5 | 107 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A7W9KH78-F1-model_v4 | Thioredoxin | 0.9994 | 5 | 103 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A4D9DH47-F1-model_v4 | Thioredoxin | 0.999 | 5 | 107 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-H6RAG8-F1-model_v4 | Thioredoxin | 0.9982 | 5 | 105 |
GO:0005829
GO:0015035 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar