F464836

General Info

Members Datasets Scaffolds Average Seq Length
570 296 570 109

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10642050|Ga0207677_106420501
Length 127
Sequence MANEMTLDTPILGGAGGDDLIKDTTTKDFVLDVVEASKQVPVLVDFWAPWCGPCRVVSPILEEINGERDDLRVVKLNVDDNQVTAVRYEVLSIPTMILFKNGELVKKVIGAQPRARIEAELEPALAA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
123 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
189 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
200 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
201 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
208 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
209 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
210 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
211 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
286 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.74
Metatranscriptomes 5.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 7.89
Rhizosphere 88.77
Stem 0
Stem Tuber 0
Unclassified 2.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1065058 3300001977 Bacteria 525
2 JGI24737J22298_10195880 3300001990 Bacteria 596
3 JGI24743J22301_10076831 3300001991 Bacteria 701
4 JGI24749J21850_1029203 3300002076 Bacteria 789
5 JGI24742J22300_10056958 3300002244 Bacteria 714
6 Ga0006778J45830_1007030 3300003162 Bacteria 523
7 JGI25407J50210_10119373 3300003373 Bacteria 650
8 Ga0007427J51700_123134 3300003559 Bacteria 552
9 Ga0007409J51694_1012852 3300003575 Bacteria 507
10 Ga0058863_11847521 3300004799 Bacteria 590
11 Ga0058861_11599725 3300004800 Bacteria 583
12 Ga0070658_10062086 3300005327 Bacteria 3045
13 Ga0070658_10565830 3300005327 Bacteria 984
14 Ga0070658_10884271 3300005327 Bacteria 777
15 Ga0070676_10433689 3300005328 Bacteria 921
16 Ga0070683_100036702 3300005329 Bacteria 4485
17 Ga0070683_100072034 3300005329 Bacteria 3225
18 Ga0070683_100212246 3300005329 Bacteria 1839
19 Ga0070683_100307037 3300005329 Bacteria 1509
20 Ga0070683_100815340 3300005329 Bacteria 895
21 Ga0070690_100088950 3300005330 Bacteria 2031
22 Ga0070670_100434356 3300005331 Bacteria 1162
23 Ga0068869_100690484 3300005334 Bacteria 870
24 Ga0070666_10050127 3300005335 Bacteria 2807
25 Ga0070680_100059698 3300005336 Bacteria 3121
26 Ga0070682_100051657 3300005337 Bacteria 2570
27 Ga0070682_100763164 3300005337 Bacteria 782
28 Ga0070682_101319499 3300005337 Bacteria 614
29 Ga0068868_100012973 3300005338 Bacteria 6097
30 Ga0068868_100169079 3300005338 Bacteria 1809
31 Ga0070660_100013384 3300005339 Bacteria 5884
32 Ga0070660_100397988 3300005339 Bacteria 1139
33 Ga0070689_100028871 3300005340 Bacteria 4195
34 Ga0070691_10392570 3300005341 Bacteria 780
35 Ga0070661_100048843 3300005344 Bacteria 3098
36 Ga0070661_101259870 3300005344 Bacteria 619
37 Ga0070692_10041984 3300005345 Bacteria 2346
38 Ga0070668_100190633 3300005347 Bacteria 1679
39 Ga0070668_100369544 3300005347 Bacteria 1218
40 Ga0070668_100524531 3300005347 Bacteria 1028
41 Ga0070668_100935422 3300005347 Bacteria 776
42 Ga0070668_101522607 3300005347 Bacteria 612
43 Ga0070669_100495672 3300005353 Bacteria 1013
44 Ga0070675_100299450 3300005354 Bacteria 1416
45 Ga0070671_100494031 3300005355 Bacteria 1052
46 Ga0070671_100574777 3300005355 Bacteria 973
47 Ga0070674_100057695 3300005356 Bacteria 2696
48 Ga0070674_100118763 3300005356 Bacteria 1955
49 Ga0070674_100879935 3300005356 Bacteria 779
50 Ga0070673_101490151 3300005364 Bacteria 638
51 Ga0070673_102051959 3300005364 Bacteria 543
52 Ga0070688_100035388 3300005365 Bacteria 3033
53 Ga0070659_100004246 3300005366 Bacteria 10229
54 Ga0070659_100020667 3300005366 Bacteria 5005
55 Ga0070659_100486326 3300005366 Bacteria 1051
56 Ga0070659_100818757 3300005366 Bacteria 810
57 Ga0070659_100989948 3300005366 Bacteria 738
58 Ga0070659_101901471 3300005366 Bacteria 534
59 Ga0070667_100073476 3300005367 Bacteria 2916
60 Ga0070667_100516916 3300005367 Bacteria 1095
61 Ga0070667_101644975 3300005367 Bacteria 604
62 Ga0070703_10599708 3300005406 Bacteria 508
63 Ga0070710_10352932 3300005437 Bacteria 974
64 Ga0070701_10052001 3300005438 Bacteria 2126
65 Ga0070701_10474482 3300005438 Bacteria 807
66 Ga0070701_10689906 3300005438 Bacteria 686
67 Ga0070711_100763851 3300005439 Bacteria 818
68 Ga0070705_100492021 3300005440 Bacteria 929
69 Ga0070705_100830397 3300005440 Bacteria 738
70 Ga0070700_100766501 3300005441 Bacteria 774
71 Ga0070694_100168673 3300005444 Bacteria 1611
72 Ga0070694_100461333 3300005444 Bacteria 1005
73 Ga0070678_100153293 3300005456 Bacteria 1859
74 Ga0070678_100724073 3300005456 Bacteria 898
75 Ga0070678_101164719 3300005456 Bacteria 714
76 Ga0070662_101209196 3300005457 Bacteria 650
77 Ga0070681_10025672 3300005458 Bacteria 5926
78 Ga0068867_100111135 3300005459 Bacteria 2105
79 Ga0068867_100153995 3300005459 Bacteria 1808
80 Ga0068867_100405691 3300005459 Bacteria 1151
81 Ga0070685_10042777 3300005466 Bacteria 2586
82 Ga0070679_100015880 3300005530 Bacteria 7247
83 Ga0070679_100985961 3300005530 Bacteria 786
84 Ga0070684_100029841 3300005535 Bacteria 4626
85 Ga0070684_100298493 3300005535 Bacteria 1478
86 Ga0070684_100446237 3300005535 Bacteria 1195
87 Ga0068853_100053246 3300005539 Bacteria 3485
88 Ga0068853_100604032 3300005539 Bacteria 1042
89 Ga0068853_101027634 3300005539 Bacteria 794
90 Ga0068853_102327863 3300005539 Bacteria 519
91 Ga0068853_102501937 3300005539 Bacteria 500
92 Ga0070672_100569572 3300005543 Bacteria 985
93 Ga0070686_100110942 3300005544 Bacteria 1869
94 Ga0070686_100635466 3300005544 Bacteria 845
95 Ga0070686_101269116 3300005544 Bacteria 614
96 Ga0070695_100357212 3300005545 Bacteria 1096
97 Ga0070695_100401662 3300005545 Bacteria 1039
98 Ga0070696_100230968 3300005546 Bacteria 1392
99 Ga0070696_101606415 3300005546 Bacteria 559
100 Ga0070665_100011475 3300005548 Bacteria 8960
101 Ga0070665_100179522 3300005548 Bacteria 2118
102 Ga0070665_100866951 3300005548 Bacteria 916
103 Ga0070665_102433212 3300005548 Bacteria 526
104 Ga0070704_100017370 3300005549 Bacteria 4575
105 Ga0070704_100330876 3300005549 Bacteria 1280
106 Ga0070704_100798978 3300005549 Bacteria 843
107 Ga0068855_100389858 3300005563 Bacteria 1528
108 Ga0068855_100778967 3300005563 Bacteria 1018
109 Ga0070664_100036090 3300005564 Bacteria 4152
110 Ga0070664_100145756 3300005564 Bacteria 2088
111 Ga0070664_100163679 3300005564 Bacteria 1969
112 Ga0070664_100263323 3300005564 Bacteria 1552
113 Ga0070664_100493372 3300005564 Bacteria 1128
114 Ga0068857_100092902 3300005577 Bacteria 2702
115 Ga0068857_100110482 3300005577 Bacteria 2470
116 Ga0068857_100227204 3300005577 Bacteria 1706
117 Ga0068857_101779532 3300005577 Bacteria 603
118 Ga0068854_100243263 3300005578 Bacteria 1434
119 Ga0068854_100531377 3300005578 Bacteria 995
120 Ga0068854_100548696 3300005578 Bacteria 980
121 Ga0068854_100802416 3300005578 Bacteria 821
122 Ga0068856_100018802 3300005614 Bacteria 6700
123 Ga0068856_100703309 3300005614 Bacteria 1031
124 Ga0068856_100830161 3300005614 Bacteria 944
125 Ga0068856_101293309 3300005614 Bacteria 745
126 Ga0070702_100674221 3300005615 Bacteria 785
127 Ga0068852_100050849 3300005616 Bacteria 3553
128 Ga0068852_100076061 3300005616 Bacteria 2964
129 Ga0068852_100112329 3300005616 Bacteria 2479
130 Ga0068852_100500523 3300005616 Bacteria 1210
131 Ga0068864_100255643 3300005618 Bacteria 1628
132 Ga0068864_100288979 3300005618 Bacteria 1532
133 Ga0068864_100384459 3300005618 Bacteria 1331
134 Ga0068866_10016489 3300005718 Bacteria 3303
135 Ga0068866_10020436 3300005718 Bacteria 3034
136 Ga0068866_10570200 3300005718 Bacteria 760
137 Ga0068861_100549775 3300005719 Bacteria 1052
138 Ga0068861_100995317 3300005719 Bacteria 800
139 Ga0068851_10180312 3300005834 Bacteria 1169
140 Ga0068851_10262970 3300005834 Bacteria 982
141 Ga0068870_10401825 3300005840 Bacteria 892
142 Ga0068870_10605771 3300005840 Bacteria 745
143 Ga0068863_100005579 3300005841 Bacteria 12365
144 Ga0068863_100808692 3300005841 Bacteria 935
145 Ga0068858_100043518 3300005842 Bacteria 4163
146 Ga0068858_100187883 3300005842 Bacteria 1952
147 Ga0068860_100061878 3300005843 Bacteria 3557
148 Ga0068862_100188267 3300005844 Bacteria 1856
149 Ga0068862_101213815 3300005844 Bacteria 753
150 Ga0068862_101365838 3300005844 Bacteria 711
151 Ga0068862_101399816 3300005844 Bacteria 703
152 Ga0081455_10004081 3300005937 Bacteria 16534
153 Ga0081538_10053474 3300005981 Bacteria 2400
154 Ga0081540_1002274 3300005983 Bacteria 15785
155 Ga0081540_1017202 3300005983 Bacteria 4484
156 Ga0075365_10979607 3300006038 Bacteria 596
157 Ga0075363_100868529 3300006048 Bacteria 551
158 Ga0075432_10415468 3300006058 Bacteria 584
159 Ga0070715_10430842 3300006163 Bacteria 740
160 Ga0070716_101303865 3300006173 Bacteria 587
161 Ga0070712_100112814 3300006175 Bacteria 2031
162 Ga0070712_101771476 3300006175 Bacteria 541
163 Ga0097621_100898277 3300006237 Bacteria 825
164 Ga0068871_101248717 3300006358 Bacteria 698
165 Ga0068871_101320891 3300006358 Bacteria 679
166 Ga0075431_101681470 3300006847 Bacteria 592
167 Ga0075433_10010256 3300006852 Bacteria 7515
168 Ga0075434_100003617 3300006871 Bacteria 13797
169 Ga0075434_101796442 3300006871 Bacteria 620
170 Ga0068865_100296131 3300006881 Bacteria 1293
171 Ga0068865_100549689 3300006881 Bacteria 969
172 Ga0075436_100318480 3300006914 Bacteria 1117
173 Ga0075435_100010684 3300007076 Bacteria 6720
174 Ga0105251_10424455 3300009011 Bacteria 614
175 Ga0105250_10118940 3300009092 Bacteria 1085
176 Ga0105240_10031826 3300009093 Bacteria 6834
177 Ga0105240_10310792 3300009093 Bacteria 1800
178 Ga0105240_10332232 3300009093 Bacteria 1729
179 Ga0105240_12602185 3300009093 Bacteria 523
180 Ga0111539_10141088 3300009094 Bacteria 2820
181 Ga0111539_10184849 3300009094 Bacteria 2434
182 Ga0105245_10355229 3300009098 Bacteria 1453
183 Ga0105247_10143443 3300009101 Bacteria 1567
184 Ga0105247_11235661 3300009101 Bacteria 597
185 Ga0114129_10002590 3300009147 Bacteria 25131
186 Ga0114129_12020903 3300009147 Bacteria 697
187 Ga0114129_12692250 3300009147 Bacteria 593
188 Ga0105243_10014782 3300009148 Bacteria 5905
189 Ga0105243_10022548 3300009148 Bacteria 4787
190 Ga0105243_10713433 3300009148 Bacteria 979
191 Ga0105241_10512758 3300009174 Bacteria 1071
192 Ga0105241_12155775 3300009174 Bacteria 552
193 Ga0105242_10000239 3300009176 Bacteria 43273
194 Ga0105242_10505459 3300009176 Bacteria 1150
195 Ga0105242_11065490 3300009176 Bacteria 820
196 Ga0105242_11609872 3300009176 Bacteria 683
197 Ga0105248_10309593 3300009177 Bacteria 1779
198 Ga0105248_11056983 3300009177 Bacteria 917
199 Ga0105237_10552458 3300009545 Bacteria 1158
200 Ga0105237_11197643 3300009545 Bacteria 766
201 Ga0105238_10045833 3300009551 Bacteria 4417
202 Ga0105238_10250990 3300009551 Bacteria 1747
203 Ga0105238_10672935 3300009551 Bacteria 1046
204 Ga0105238_11388550 3300009551 Bacteria 729
205 Ga0105249_10038504 3300009553 Bacteria 4339
206 Ga0105249_10049271 3300009553 Bacteria 3841
207 Ga0105249_10481868 3300009553 Bacteria 1283
208 Ga0105249_10727616 3300009553 Bacteria 1054
209 Ga0105249_10789845 3300009553 Bacteria 1013
210 Ga0105239_10105708 3300010375 Bacteria 3118
211 Ga0105239_10114226 3300010375 Bacteria 2995
212 Ga0105239_10602238 3300010375 Bacteria 1253
213 Ga0105239_10675939 3300010375 Bacteria 1180
214 Ga0105239_11168023 3300010375 Bacteria 887
215 Ga0105239_11744824 3300010375 Bacteria 721
216 Ga0105246_10055690 3300011119 Bacteria 2730
217 Ga0157373_10369487 3300013100 Bacteria 1025
218 Ga0157371_10247795 3300013102 Bacteria 1282
219 Ga0157371_10331575 3300013102 Bacteria 1105
220 Ga0157371_10668544 3300013102 Bacteria 776
221 Ga0157370_10020903 3300013104 Bacteria 6529
222 Ga0157369_10050379 3300013105 Bacteria 4510
223 Ga0157374_10116789 3300013296 Bacteria 2571
224 Ga0157374_11627796 3300013296 Bacteria 670
225 Ga0163162_10915945 3300013306 Bacteria 989
226 Ga0163162_12205920 3300013306 Bacteria 632
227 Ga0157372_10069929 3300013307 Bacteria 3948
228 Ga0157372_11544001 3300013307 Bacteria 765
229 Ga0157372_12444150 3300013307 Bacteria 600
230 Ga0157372_12766786 3300013307 Bacteria 563
231 Ga0157375_10400703 3300013308 Bacteria 1539
232 Ga0157375_10635421 3300013308 Bacteria 1225
233 Ga0157375_12653994 3300013308 Bacteria 599
234 Ga0163163_10386072 3300014325 Bacteria 1458
235 Ga0163163_10844071 3300014325 Bacteria 979
236 Ga0163163_10922852 3300014325 Bacteria 936
237 Ga0163163_11167050 3300014325 Bacteria 833
238 Ga0157380_10130625 3300014326 Bacteria 2142
239 Ga0157380_11175719 3300014326 Bacteria 810
240 Ga0157380_11321769 3300014326 Unclassified 769
241 Ga0157380_11848086 3300014326 Bacteria 664
242 Ga0182008_10432221 3300014497 Bacteria 713
243 Ga0157377_10240101 3300014745 Bacteria 1169
244 Ga0157377_10262151 3300014745 Bacteria 1125
245 Ga0157377_10742570 3300014745 Bacteria 717
246 Ga0157377_11343838 3300014745 Bacteria 561
247 Ga0157379_10295829 3300014968 Bacteria 1475
248 Ga0157379_11743113 3300014968 Bacteria 611
249 Ga0157376_12201187 3300014969 Bacteria 590
250 Ga0182007_10177447 3300015262 Bacteria 735
251 Ga0206356_11445486 3300020070 Bacteria 551
252 Ga0206356_11503213 3300020070 Bacteria 2087
253 Ga0206355_1293151 3300020076 Bacteria 616
254 Ga0206352_10525377 3300020078 Bacteria 723
255 Ga0206352_10713396 3300020078 Bacteria 729
256 Ga0206350_10372490 3300020080 Bacteria 575
257 Ga0206354_10198566 3300020081 Bacteria 1844
258 Ga0206354_10316741 3300020081 Bacteria 554
259 Ga0206354_10407136 3300020081 Bacteria 531
260 Ga0206353_11262324 3300020082 Bacteria 711
261 Ga0154015_1542708 3300020610 Bacteria 668
262 Ga0224712_10283472 3300022467 Bacteria 772
263 Ga0224712_10678866 3300022467 Bacteria 506
264 Ga0207656_10296184 3300025321 Bacteria 800
265 Ga0207642_10009247 3300025899 Bacteria 3421
266 Ga0207710_10165255 3300025900 Bacteria 1080
267 Ga0207688_10026391 3300025901 Bacteria 3194
268 Ga0207647_10107039 3300025904 Bacteria 1655
269 Ga0207647_10737996 3300025904 Bacteria 534
270 Ga0207643_10114673 3300025908 Bacteria 1590
271 Ga0207643_10375665 3300025908 Bacteria 895
272 Ga0207705_10036997 3300025909 Bacteria 3493
273 Ga0207705_10173824 3300025909 Bacteria 1623
274 Ga0207705_10180942 3300025909 Bacteria 1591
275 Ga0207705_11486457 3300025909 Bacteria 513
276 Ga0207654_10506530 3300025911 Bacteria 853
277 Ga0207654_10767660 3300025911 Bacteria 695
278 Ga0207707_10033822 3300025912 Bacteria 4474
279 Ga0207695_10054488 3300025913 Bacteria 4175
280 Ga0207695_10389041 3300025913 Bacteria 1279
281 Ga0207695_10702682 3300025913 Bacteria 892
282 Ga0207671_10174366 3300025914 Bacteria 1671
283 Ga0207671_10232287 3300025914 Bacteria 1447
284 Ga0207671_11028709 3300025914 Bacteria 648
285 Ga0207693_10181638 3300025915 Bacteria 1656
286 Ga0207663_10827445 3300025916 Bacteria 738
287 Ga0207660_10042285 3300025917 Bacteria 3198
288 Ga0207660_11176702 3300025917 Bacteria 624
289 Ga0207662_10014010 3300025918 Bacteria 4491
290 Ga0207657_10009087 3300025919 Bacteria 10029
291 Ga0207657_10097388 3300025919 Bacteria 2446
292 Ga0207657_10136478 3300025919 Bacteria 2007
293 Ga0207657_10208285 3300025919 Bacteria 1570
294 Ga0207649_10005084 3300025920 Bacteria 7109
295 Ga0207649_10220536 3300025920 Bacteria 1350
296 Ga0207649_10279763 3300025920 Bacteria 1213
297 Ga0207649_10721721 3300025920 Bacteria 774
298 Ga0207652_10008391 3300025921 Bacteria 8311
299 Ga0207681_10093662 3300025923 Bacteria 2151
300 Ga0207681_11605913 3300025923 Bacteria 544
301 Ga0207694_10034485 3300025924 Bacteria 3880
302 Ga0207659_11712342 3300025926 Bacteria 535
303 Ga0207687_10024765 3300025927 Bacteria 4012
304 Ga0207687_10090019 3300025927 Bacteria 2235
305 Ga0207687_10325248 3300025927 Bacteria 1246
306 Ga0207687_10341644 3300025927 Bacteria 1217
307 Ga0207687_11035344 3300025927 Bacteria 704
308 Ga0207644_10806657 3300025931 Bacteria 785
309 Ga0207644_11572959 3300025931 Bacteria 552
310 Ga0207690_10012557 3300025932 Bacteria 5070
311 Ga0207690_10337535 3300025932 Bacteria 1188
312 Ga0207690_11424473 3300025932 Bacteria 579
313 Ga0207706_10042095 3300025933 Bacteria 4048
314 Ga0207686_10000016 3300025934 Bacteria 198779
315 Ga0207709_10042898 3300025935 Bacteria 2724
316 Ga0207709_10076448 3300025935 Bacteria 2143
317 Ga0207709_10145548 3300025935 Bacteria 1634
318 Ga0207670_10003497 3300025936 Bacteria 8339
319 Ga0207669_10196747 3300025937 Bacteria 1459
320 Ga0207669_10562451 3300025937 Bacteria 922
321 Ga0207669_11151052 3300025937 Bacteria 656
322 Ga0207704_10189612 3300025938 Bacteria 1494
323 Ga0207665_10311557 3300025939 Bacteria 1179
324 Ga0207691_10187500 3300025940 Bacteria 1805
325 Ga0207691_10904706 3300025940 Bacteria 739
326 Ga0207691_11084222 3300025940 Bacteria 667
327 Ga0207711_11617353 3300025941 Bacteria 591
328 Ga0207689_10102706 3300025942 Bacteria 2349
329 Ga0207689_10650945 3300025942 Bacteria 888
330 Ga0207661_10015973 3300025944 Bacteria 5532
331 Ga0207661_10069961 3300025944 Bacteria 2863
332 Ga0207661_10145819 3300025944 Bacteria 2042
333 Ga0207661_10159902 3300025944 Bacteria 1954
334 Ga0207661_10403967 3300025944 Bacteria 1239
335 Ga0207679_10069057 3300025945 Bacteria 2657
336 Ga0207679_10305814 3300025945 Bacteria 1372
337 Ga0207679_10518926 3300025945 Bacteria 1065
338 Ga0207679_10577290 3300025945 Bacteria 1011
339 Ga0207679_10586854 3300025945 Bacteria 1003
340 Ga0207679_10603484 3300025945 Bacteria 989
341 Ga0207667_10220657 3300025949 Bacteria 1942
342 Ga0207651_11146976 3300025960 Bacteria 697
343 Ga0207712_10065345 3300025961 Bacteria 2596
344 Ga0207712_10156072 3300025961 Bacteria 1768
345 Ga0207712_10284829 3300025961 Bacteria 1350
346 Ga0207712_10332957 3300025961 Bacteria 1256
347 Ga0207712_11070954 3300025961 Bacteria 717
348 Ga0207712_11327086 3300025961 Bacteria 643
349 Ga0207668_10367059 3300025972 Bacteria 1208
350 Ga0207668_10887491 3300025972 Bacteria 793
351 Ga0207668_10931666 3300025972 Bacteria 774
352 Ga0207640_10190385 3300025981 Bacteria 1546
353 Ga0207640_10201835 3300025981 Bacteria 1507
354 Ga0207640_10466701 3300025981 Bacteria 1044
355 Ga0207640_10744204 3300025981 Bacteria 844
356 Ga0207640_10882555 3300025981 Bacteria 780
357 Ga0207658_10380929 3300025986 Bacteria 1235
358 Ga0207677_10096478 3300026023 Bacteria 2163
359 Ga0207677_10642050 3300026023 Bacteria 936
360 Ga0207703_10076087 3300026035 Bacteria 2783
361 Ga0207703_11441467 3300026035 Bacteria 662
362 Ga0207639_10056632 3300026041 Bacteria 3005
363 Ga0207639_10103276 3300026041 Bacteria 2309
364 Ga0207639_10144340 3300026041 Bacteria 1987
365 Ga0207678_10097579 3300026067 Bacteria 2511
366 Ga0207678_10168141 3300026067 Bacteria 1872
367 Ga0207678_10351842 3300026067 Bacteria 1270
368 Ga0207678_10800735 3300026067 Bacteria 832
369 Ga0207708_10015341 3300026075 Bacteria 5746
370 Ga0207708_10058187 3300026075 Bacteria 2949
371 Ga0207708_11860809 3300026075 Bacteria 528
372 Ga0207702_10015459 3300026078 Bacteria 6320
373 Ga0207702_10408691 3300026078 Bacteria 1310
374 Ga0207702_10566464 3300026078 Bacteria 1112
375 Ga0207702_10838347 3300026078 Bacteria 910
376 Ga0207702_11999597 3300026078 Bacteria 570
377 Ga0207641_10003652 3300026088 Bacteria 13571
378 Ga0207641_10608177 3300026088 Bacteria 1071
379 Ga0207641_11866336 3300026088 Bacteria 603
380 Ga0207648_10030168 3300026089 Bacteria 4806
381 Ga0207648_10533452 3300026089 Bacteria 1076
382 Ga0207676_10122419 3300026095 Bacteria 2196
383 Ga0207676_10288667 3300026095 Bacteria 1493
384 Ga0207674_10049021 3300026116 Bacteria 4321
385 Ga0207674_10134101 3300026116 Bacteria 2439
386 Ga0207674_10210974 3300026116 Bacteria 1891
387 Ga0207674_10423727 3300026116 Bacteria 1286
388 Ga0207674_10719417 3300026116 Bacteria 964
389 Ga0207675_100031946 3300026118 Bacteria 4905
390 Ga0207675_100428967 3300026118 Bacteria 1307
391 Ga0207675_100641912 3300026118 Bacteria 1067
392 Ga0207675_100872742 3300026118 Bacteria 915
393 Ga0207683_10089555 3300026121 Bacteria 2739
394 Ga0207683_10373816 3300026121 Bacteria 1309
395 Ga0207683_11029378 3300026121 Bacteria 764
396 Ga0207683_11135890 3300026121 Bacteria 724
397 Ga0207698_10025949 3300026142 Bacteria 4138
398 Ga0207698_10073080 3300026142 Bacteria 2729
399 Ga0207698_10141238 3300026142 Bacteria 2075
400 Ga0207698_10226338 3300026142 Bacteria 1694
401 Ga0207428_10202467 3300027907 Bacteria 1493
402 Ga0207428_10364948 3300027907 Bacteria 1061
403 Ga0268266_10000825 3300028379 Bacteria 40545
404 Ga0268266_10298294 3300028379 Bacteria 1503
405 Ga0268265_10063264 3300028380 Bacteria 2846
406 Ga0268265_10835929 3300028380 Bacteria 900
407 Ga0268265_11338164 3300028380 Bacteria 717
408 Ga0268264_11344263 3300028381 Bacteria 725
409 Ga0265320_10043731 3300031240 Bacteria 2212
410 Ga0316576_10004257 3300031727 Bacteria 8553
411 Ga0307405_10113312 3300031731 Bacteria 1841
412 Ga0307405_10738989 3300031731 Bacteria 819
413 Ga0316577_10357920 3300031733 Bacteria 828
414 Ga0307413_10762734 3300031824 Bacteria 810
415 Ga0307413_11900798 3300031824 Bacteria 535
416 Ga0307410_11943072 3300031852 Bacteria 524
417 Ga0307406_10011188 3300031901 Bacteria 5085
418 Ga0307407_10475554 3300031903 Bacteria 911
419 Ga0307416_100955803 3300032002 Bacteria 959
420 Ga0307414_11677478 3300032004 Bacteria 593
421 Ga0307411_10028474 3300032005 Bacteria 3397
422 Ga0307411_11415651 3300032005 Bacteria 637
423 Ga0373948_0061618 3300034817 Bacteria 825
424 Ga0373950_0121138 3300034818 Bacteria 579
425 Ga0373952_0230185 3300035092 Bacteria 554
426 Ga0373960_0125908 3300035121 Bacteria 855
427 Ga0316574_0089965 3300035398 Bacteria 1956
428 Ga0316574_0173009 3300035398 Bacteria 1390
429 Ga0373947_0331856 3300035725 Bacteria 1018
430 Ga0316584_0011869 3300036712 Bacteria 6137
431 Ga0395901_1906570 3300038443 Bacteria 542
432 Ga0395901_2139636 3300038443 Bacteria 504
433 Ga0242420_135132 3300038996 Bacteria 546
434 Ga0451791_1346709 3300041451 Bacteria 597
435 Ga0451807_1439438 3300041486 Bacteria 917
436 Ga0451847_0878330 3300041503 Bacteria 523
437 Ga0451849_0063983 3300041505 Bacteria 507
438 Ga0451853_2540431 3300041512 Bacteria 837
439 Ga0466965_0201839 3300044683 Bacteria 1055
440 Ga0466963_0416701 3300044694 Bacteria 947
441 Ga0466963_0644183 3300044694 Bacteria 748
442 Ga0466964_0013475 3300044706 Bacteria 3102
443 Ga0466964_0051349 3300044706 Bacteria 1693
444 Ga0466964_0377478 3300044706 Bacteria 735
445 Ga0466968_0399108 3300044735 Bacteria 674
446 Ga0466960_0988890 3300044901 Bacteria 516
447 Ga0466958_0873558 3300045836 Bacteria 587
448 Ga0466967_0018953 3300045976 Bacteria 5520
449 Ga0466967_0044251 3300045976 Bacteria 3860
450 Ga0466967_0171045 3300045976 Bacteria 2044
451 Ga0466967_0493033 3300045976 Bacteria 1201
452 Ga0466967_0655653 3300045976 Bacteria 1038
453 Ga0466967_0808307 3300045976 Bacteria 931
454 Ga0466967_1500458 3300045976 Bacteria 671
455 Ga0466967_1997437 3300045976 Bacteria 577
456 Ga0495596_0088647 3300046500 Bacteria 1201
457 Ga0495620_0263463 3300046515 Bacteria 657
458 Ga0495630_0260811 3300046517 Bacteria 1324
459 Ga0495632_0206939 3300046519 Bacteria 891
460 Ga0495625_0869388 3300046660 Bacteria 519
461 Ga0495670_0706984 3300046691 Bacteria 550
462 Ga0495589_0165686 3300046794 Bacteria 1052
463 Ga0495589_0184791 3300046794 Bacteria 988
464 Ga0495676_0000652 3300047321 Bacteria 28858
465 Ga0495676_0024641 3300047321 Bacteria 5205
466 Ga0495676_0032649 3300047321 Bacteria 4392
467 Ga0495686_0206073 3300047472 Bacteria 1126
468 Ga0495615_0170282 3300048090 Bacteria 659
469 Ga0495626_0400513 3300048091 Bacteria 531
470 Ga0496100_0000063 3300048903 Bacteria 60957
471 Ga0496100_0035388 3300048903 Bacteria 3140
472 Ga0496101_0000012 3300048904 Bacteria 268127
473 Ga0496101_0236416 3300048904 Bacteria 1421
474 Ga0496102_0000061 3300048905 Bacteria 167066
475 Ga0496103_0000044 3300048906 Bacteria 167066
476 Ga0496103_0642584 3300048906 Bacteria 674
477 Ga0496104_0006120 3300048907 Bacteria 10563
478 Ga0496104_0248797 3300048907 Bacteria 1690
479 Ga0496104_0672917 3300048907 Bacteria 943
480 Ga0496105_0013280 3300048908 Bacteria 6536
481 Ga0496105_0383917 3300048908 Bacteria 1117
482 Ga0496106_0000020 3300048909 Bacteria 169168
483 Ga0496106_0067519 3300048909 Bacteria 2726
484 Ga0496106_0133515 3300048909 Bacteria 1948
485 Ga0496107_0000014 3300048910 Bacteria 176738
486 Ga0496108_0199825 3300048911 Bacteria 1735
487 Ga0496108_0415078 3300048911 Bacteria 1176
488 Ga0496108_0489984 3300048911 Bacteria 1074
489 Ga0496108_0583631 3300048911 Bacteria 974
490 Ga0496109_0619838 3300048912 Bacteria 1018
491 Ga0496109_1084366 3300048912 Bacteria 738
492 Ga0496109_1260409 3300048912 Bacteria 675
493 Ga0496110_0035815 3300048913 Bacteria 4308
494 Ga0496110_0289265 3300048913 Bacteria 1492
495 Ga0496110_0320583 3300048913 Bacteria 1412
496 Ga0496110_0332049 3300048913 Bacteria 1385
497 Ga0496110_0658612 3300048913 Bacteria 947
498 Ga0496111_0270615 3300048914 Bacteria 1260
499 Ga0496111_0361712 3300048914 Bacteria 1074
500 Ga0496111_0926831 3300048914 Bacteria 626
501 Ga0496112_0106845 3300048915 Bacteria 2769
502 Ga0496112_0502735 3300048915 Bacteria 1147
503 Ga0496112_0771266 3300048915 Bacteria 887
504 Ga0496113_0059089 3300048916 Bacteria 2888
505 Ga0496113_0495575 3300048916 Bacteria 981
506 Ga0496113_0600311 3300048916 Bacteria 881
507 Ga0496113_0602581 3300048916 Bacteria 880
508 Ga0496114_0655224 3300048917 Bacteria 923
509 Ga0496114_0748394 3300048917 Bacteria 854
510 Ga0496115_0579766 3300048918 Bacteria 894
511 Ga0496115_0591710 3300048918 Bacteria 883
512 Ga0496115_1019788 3300048918 Bacteria 631
513 Ga0496117_0300896 3300048920 Bacteria 849
514 Ga0496118_0447022 3300048921 Bacteria 657
515 Ga0496119_0012278 3300048922 Bacteria 6980
516 Ga0496120_0243335 3300048923 Bacteria 848
517 Ga0496121_0021031 3300048924 Bacteria 6417
518 Ga0496124_0236434 3300048927 Bacteria 1362
519 Ga0496124_0480152 3300048927 Bacteria 839
520 Ga0496125_0025269 3300048928 Bacteria 5443
521 Ga0496126_0061253 3300048929 Bacteria 3381
522 Ga0496126_0343342 3300048929 Bacteria 1223
523 Ga0501305_094822 3300049161 Bacteria 550
524 Ga0501317_091011 3300049533 Bacteria 539
525 Ga0501318_044932 3300049534 Bacteria 642
526 Ga0501318_047069 3300049534 Bacteria 632
527 Ga0501322_025022 3300049538 Bacteria 542
528 Ga0501323_046080 3300049539 Bacteria 651
529 Ga0501031_0018623 3300049568 Bacteria 4523
530 Ga0501032_0535742 3300049569 Bacteria 747
531 Ga0501033_0978290 3300049570 Unclassified 566
532 Ga0501036_0100305 3300049572 Bacteria 2449
533 Ga0501038_0273392 3300049574 Bacteria 1332
534 Ga0501039_0007834 3300049575 Bacteria 8143
535 Ga0501039_1531841 3300049575 Bacteria 512
536 Ga0501041_0258902 3300049577 Bacteria 1094
537 Ga0501042_0408377 3300049578 Bacteria 984
538 Ga0501046_0616759 3300049580 Bacteria 769
539 Ga0501047_0972961 3300049581 Bacteria 662
540 Ga0501072_0126564 3300049588 Bacteria 2036
541 Ga0501074_0045895 3300049590 Bacteria 3160
542 Ga0501075_0244214 3300049591 Bacteria 1369
543 Ga0501076_0621722 3300049592 Bacteria 891
544 Ga0501076_0710027 3300049592 Bacteria 830
545 Ga0501035_0682913 3300049822 Bacteria 830
546 Ga0501045_0350332 3300049824 Bacteria 1099
547 nmdc:mga03n38_856879_c1 3300050490 Bacteria 532
548 nmdc:mga0yw44_869008_c1 3300050492 Bacteria 612
549 nmdc:mga05p37_3930_c1 3300050507 Bacteria 17409
550 nmdc:mga06r32_151826_c1 3300050510 Bacteria 2295
551 nmdc:mga08y16_144736_c1 3300050511 Bacteria 2470
552 nmdc:mga08y16_392436_c1 3300050511 Bacteria 1422
553 nmdc:mga0n895_11128_c1 3300050512 Bacteria 8007
554 nmdc:mga0n895_2106849_c1 3300050512 Bacteria 520
555 nmdc:mga0n895_554811_c1 3300050512 Bacteria 1154
556 nmdc:mga0rr50_58019_c1 3300050513 Bacteria 2899
557 nmdc:mga08x19_386451_c1 3300050514 Bacteria 980
558 nmdc:mga0a205_5205_c1 3300050515 Bacteria 11703
559 Ga0500641_0011550 3300053096 Bacteria 3206
560 Ga0500588_0174117 3300053146 Bacteria 789
561 Ga0501084_0085381 3300054114 Bacteria 2650
562 Ga0590075_059488 3300059424 Bacteria 984
563 Ga0587070_221483 3300059491 Bacteria 513
564 Ga0587083_0232094 3300059505 Bacteria 542
565 Ga0587099_023749 3300059622 Bacteria 709
566 Ga0587101_145433 3300059623 Bacteria 510
567 Ga0587128_121083 3300059630 Bacteria 570
568 Ga0587111_0091501 3300060346 Bacteria 744
569 Ga0501082_0528419 3300060353 Bacteria 1031
570 Ga0530510_1203627 3300061734 Bacteria 581

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0018623 Ga0501031_0018623_3308_3637 96
2 3300049569 Ga0501032_0535742 Ga0501032_0535742_278_607 96
3 3300049570 Ga0501033_0978290 Ga0501033_0978290_176_505 96
4 3300049572 Ga0501036_0100305 Ga0501036_0100305_525_854 96
5 3300049574 Ga0501038_0273392 Ga0501038_0273392_678_1007 96
6 3300049575 Ga0501039_0007834 Ga0501039_0007834_1676_2005 96
7 3300049577 Ga0501041_0258902 Ga0501041_0258902_581_910 96
8 3300049591 Ga0501075_0244214 Ga0501075_0244214_785_1114 96
9 3300049592 Ga0501076_0621722 Ga0501076_0621722_38_367 96
10 3300049824 Ga0501045_0350332 Ga0501045_0350332_93_422 96
11 3300054114 Ga0501084_0085381 Ga0501084_0085381_917_1246 96
12 3300060353 Ga0501082_0528419 Ga0501082_0528419_604_933 96
13 3300049580 Ga0501046_0616759 Ga0501046_0616759_148_453 97
14 3300035725 Ga0373947_0331856 Ga0373947_0331856_513_833 103
15 3300047321 Ga0495676_0032649 Ga0495676_0032649_1172_1492 103
16 3300009093 Ga0105240_10332232 Ga0105240_103322322 104
17 3300009147 Ga0114129_12020903 Ga0114129_120209031 104
18 3300009174 Ga0105241_10512758 Ga0105241_105127584 104
19 3300009551 Ga0105238_10250990 Ga0105238_102509902 104
20 3300014325 Ga0163163_10844071 Ga0163163_108440712 104
21 3300044706 Ga0466964_0013475 Ga0466964_0013475_1434_1757 104
22 3300045976 Ga0466967_1500458 Ga0466967_1500458_293_616 104
23 3300045976 Ga0466967_1997437 Ga0466967_1997437_165_479 104
24 3300046519 Ga0495632_0206939 Ga0495632_0206939_181_495 104
25 3300046660 Ga0495625_0869388 Ga0495625_0869388_177_491 104
26 3300048907 Ga0496104_0006120 Ga0496104_0006120_6765_7079 104
27 3300048908 Ga0496105_0013280 Ga0496105_0013280_2154_2468 104
28 3300048909 Ga0496106_0133515 Ga0496106_0133515_1303_1617 104
29 3300048913 Ga0496110_0658612 Ga0496110_0658612_611_925 104
30 3300048917 Ga0496114_0655224 Ga0496114_0655224_538_852 104
31 3300048922 Ga0496119_0012278 Ga0496119_0012278_5054_5368 104
32 3300048923 Ga0496120_0243335 Ga0496120_0243335_174_488 104
33 3300048924 Ga0496121_0021031 Ga0496121_0021031_4222_4536 104
34 3300048927 Ga0496124_0236434 Ga0496124_0236434_126_440 104
35 3300048927 Ga0496124_0480152 Ga0496124_0480152_29_343 104
36 3300048928 Ga0496125_0025269 Ga0496125_0025269_3861_4175 104
37 3300048929 Ga0496126_0061253 Ga0496126_0061253_2794_3108 104
38 3300049590 Ga0501074_0045895 Ga0501074_0045895_1963_2277 104
39 3300031824 Ga0307413_10762734 Ga0307413_107627342 105
40 3300032005 Ga0307411_11415651 Ga0307411_114156512 105
41 3300034817 Ga0373948_0061618 Ga0373948_0061618_103_420 105
42 3300046515 Ga0495620_0263463 Ga0495620_0263463_241_564 105
43 3300049575 Ga0501039_1531841 Ga0501039_1531841_144_473 105
44 3300049578 Ga0501042_0408377 Ga0501042_0408377_168_497 105
45 3300049588 Ga0501072_0126564 Ga0501072_0126564_866_1195 105
46 3300049592 Ga0501076_0710027 Ga0501076_0710027_401_730 105
47 3300050512 nmdc:mga0n895_2106849_c1 nmdc:mga0n895_2106849_c1_180_503 105
48 3300020081 Ga0206354_10407136 Ga0206354_104071361 106
49 3300031240 Ga0265320_10043731 Ga0265320_100437312 106
50 3300005530 Ga0070679_100985961 Ga0070679_1009859612 107
51 3300009176 Ga0105242_11065490 Ga0105242_110654902 107
52 3300009177 Ga0105248_10309593 Ga0105248_103095933 107
53 3300009551 Ga0105238_11388550 Ga0105238_113885502 107
54 3300014745 Ga0157377_10742570 Ga0157377_107425701 107
55 3300020078 Ga0206352_10713396 Ga0206352_107133961 107
56 3300025919 Ga0207657_10208285 Ga0207657_102082852 107
57 3300025940 Ga0207691_11084222 Ga0207691_110842222 107
58 3300025961 Ga0207712_11327086 Ga0207712_113270862 107
59 3300026121 Ga0207683_10373816 Ga0207683_103738162 107
60 3300031731 Ga0307405_10113312 Ga0307405_101133122 107
61 3300031901 Ga0307406_10011188 Ga0307406_100111885 107
62 3300031903 Ga0307407_10475554 Ga0307407_104755542 107
63 3300032005 Ga0307411_10028474 Ga0307411_100284743 107
64 3300044694 Ga0466963_0416701 Ga0466963_0416701_346_669 107
65 3300003162 Ga0006778J45830_1007030 Ga0006778J45830_10070301 108
66 3300003373 JGI25407J50210_10119373 JGI25407J50210_101193732 108
67 3300003559 Ga0007427J51700_123134 Ga0007427J51700_1231341 108
68 3300003575 Ga0007409J51694_1012852 Ga0007409J51694_10128521 108
69 3300004799 Ga0058863_11847521 Ga0058863_118475211 108
70 3300004800 Ga0058861_11599725 Ga0058861_115997252 108
71 3300005327 Ga0070658_10062086 Ga0070658_100620863 108
72 3300005327 Ga0070658_10884271 Ga0070658_108842712 108
73 3300005329 Ga0070683_100072034 Ga0070683_1000720341 108
74 3300005329 Ga0070683_100212246 Ga0070683_1002122462 108
75 3300005335 Ga0070666_10050127 Ga0070666_100501272 108
76 3300005336 Ga0070680_100059698 Ga0070680_1000596981 108
77 3300005337 Ga0070682_100763164 Ga0070682_1007631641 108
78 3300005337 Ga0070682_101319499 Ga0070682_1013194992 108
79 3300005338 Ga0068868_100169079 Ga0068868_1001690793 108
80 3300005339 Ga0070660_100013384 Ga0070660_1000133842 108
81 3300005344 Ga0070661_100048843 Ga0070661_1000488432 108
82 3300005345 Ga0070692_10041984 Ga0070692_100419842 108
83 3300005347 Ga0070668_100369544 Ga0070668_1003695442 108
84 3300005347 Ga0070668_100524531 Ga0070668_1005245312 108
85 3300005347 Ga0070668_101522607 Ga0070668_1015226072 108
86 3300005356 Ga0070674_100118763 Ga0070674_1001187632 108
87 3300005356 Ga0070674_100879935 Ga0070674_1008799352 108
88 3300005364 Ga0070673_101490151 Ga0070673_1014901511 108
89 3300005366 Ga0070659_100004246 Ga0070659_1000042463 108
90 3300005366 Ga0070659_100486326 Ga0070659_1004863262 108
91 3300005366 Ga0070659_100818757 Ga0070659_1008187572 108
92 3300005366 Ga0070659_100989948 Ga0070659_1009899482 108
93 3300005366 Ga0070659_101901471 Ga0070659_1019014711 108
94 3300005367 Ga0070667_100516916 Ga0070667_1005169162 108
95 3300005367 Ga0070667_101644975 Ga0070667_1016449751 108
96 3300005438 Ga0070701_10689906 Ga0070701_106899061 108
97 3300005441 Ga0070700_100766501 Ga0070700_1007665012 108
98 3300005456 Ga0070678_101164719 Ga0070678_1011647191 108
99 3300005457 Ga0070662_101209196 Ga0070662_1012091961 108
100 3300005458 Ga0070681_10025672 Ga0070681_100256722 108
101 3300005459 Ga0068867_100153995 Ga0068867_1001539952 108
102 3300005459 Ga0068867_100405691 Ga0068867_1004056912 108
103 3300005530 Ga0070679_100015880 Ga0070679_1000158804 108
104 3300005535 Ga0070684_100029841 Ga0070684_1000298412 108
105 3300005539 Ga0068853_100604032 Ga0068853_1006040322 108
106 3300005539 Ga0068853_101027634 Ga0068853_1010276342 108
107 3300005539 Ga0068853_102327863 Ga0068853_1023278631 108
108 3300005539 Ga0068853_102501937 Ga0068853_1025019371 108
109 3300005544 Ga0070686_100635466 Ga0070686_1006354661 108
110 3300005544 Ga0070686_101269116 Ga0070686_1012691161 108
111 3300005548 Ga0070665_100011475 Ga0070665_1000114755 108
112 3300005548 Ga0070665_100179522 Ga0070665_1001795223 108
113 3300005549 Ga0070704_100798978 Ga0070704_1007989782 108
114 3300005563 Ga0068855_100389858 Ga0068855_1003898581 108
115 3300005563 Ga0068855_100778967 Ga0068855_1007789672 108
116 3300005564 Ga0070664_100036090 Ga0070664_1000360903 108
117 3300005564 Ga0070664_100263323 Ga0070664_1002633232 108
118 3300005564 Ga0070664_100493372 Ga0070664_1004933722 108
119 3300005577 Ga0068857_100227204 Ga0068857_1002272043 108
120 3300005577 Ga0068857_101779532 Ga0068857_1017795322 108
121 3300005578 Ga0068854_100243263 Ga0068854_1002432632 108
122 3300005578 Ga0068854_100531377 Ga0068854_1005313772 108
123 3300005578 Ga0068854_100548696 Ga0068854_1005486962 108
124 3300005578 Ga0068854_100802416 Ga0068854_1008024162 108
125 3300005614 Ga0068856_100018802 Ga0068856_1000188023 108
126 3300005614 Ga0068856_100830161 Ga0068856_1008301611 108
127 3300005615 Ga0070702_100674221 Ga0070702_1006742211 108
128 3300005616 Ga0068852_100050849 Ga0068852_1000508492 108
129 3300005616 Ga0068852_100076061 Ga0068852_1000760613 108
130 3300005616 Ga0068852_100500523 Ga0068852_1005005232 108
131 3300005618 Ga0068864_100255643 Ga0068864_1002556432 108
132 3300005718 Ga0068866_10020436 Ga0068866_100204363 108
133 3300005718 Ga0068866_10570200 Ga0068866_105702002 108
134 3300005719 Ga0068861_100549775 Ga0068861_1005497752 108
135 3300005719 Ga0068861_100995317 Ga0068861_1009953172 108
136 3300005834 Ga0068851_10262970 Ga0068851_102629702 108
137 3300005840 Ga0068870_10605771 Ga0068870_106057711 108
138 3300005841 Ga0068863_100005579 Ga0068863_1000055798 108
139 3300005842 Ga0068858_100187883 Ga0068858_1001878832 108
140 3300005844 Ga0068862_101213815 Ga0068862_1012138152 108
141 3300005844 Ga0068862_101365838 Ga0068862_1013658381 108
142 3300005844 Ga0068862_101399816 Ga0068862_1013998161 108
143 3300005937 Ga0081455_10004081 Ga0081455_100040812 108
144 3300005981 Ga0081538_10053474 Ga0081538_100534742 108
145 3300005983 Ga0081540_1002274 Ga0081540_10022743 108
146 3300005983 Ga0081540_1017202 Ga0081540_10172022 108
147 3300006038 Ga0075365_10979607 Ga0075365_109796071 108
148 3300006163 Ga0070715_10430842 Ga0070715_104308422 108
149 3300006847 Ga0075431_101681470 Ga0075431_1016814702 108
150 3300006852 Ga0075433_10010256 Ga0075433_100102566 108
151 3300006871 Ga0075434_100003617 Ga0075434_10000361712 108
152 3300006881 Ga0068865_100296131 Ga0068865_1002961312 108
153 3300006914 Ga0075436_100318480 Ga0075436_1003184801 108
154 3300007076 Ga0075435_100010684 Ga0075435_1000106843 108
155 3300009093 Ga0105240_10031826 Ga0105240_100318262 108
156 3300009093 Ga0105240_10310792 Ga0105240_103107923 108
157 3300009094 Ga0111539_10184849 Ga0111539_101848493 108
158 3300009147 Ga0114129_10002590 Ga0114129_1000259012 108
159 3300009148 Ga0105243_10713433 Ga0105243_107134332 108
160 3300009174 Ga0105241_12155775 Ga0105241_121557751 108
161 3300009176 Ga0105242_10000239 Ga0105242_100002393 108
162 3300009176 Ga0105242_10505459 Ga0105242_105054592 108
163 3300009177 Ga0105248_11056983 Ga0105248_110569832 108
164 3300009551 Ga0105238_10045833 Ga0105238_100458333 108
165 3300009551 Ga0105238_10672935 Ga0105238_106729352 108
166 3300009553 Ga0105249_10049271 Ga0105249_100492713 108
167 3300009553 Ga0105249_10481868 Ga0105249_104818683 108
168 3300009553 Ga0105249_10727616 Ga0105249_107276162 108
169 3300010375 Ga0105239_10114226 Ga0105239_101142263 108
170 3300010375 Ga0105239_10675939 Ga0105239_106759392 108
171 3300010375 Ga0105239_11168023 Ga0105239_111680232 108
172 3300010375 Ga0105239_11744824 Ga0105239_117448242 108
173 3300013102 Ga0157371_10247795 Ga0157371_102477952 108
174 3300013102 Ga0157371_10331575 Ga0157371_103315752 108
175 3300013104 Ga0157370_10020903 Ga0157370_100209033 108
176 3300013105 Ga0157369_10050379 Ga0157369_100503793 108
177 3300013296 Ga0157374_11627796 Ga0157374_116277961 108
178 3300013307 Ga0157372_11544001 Ga0157372_115440012 108
179 3300013307 Ga0157372_12444150 Ga0157372_124441501 108
180 3300013307 Ga0157372_12766786 Ga0157372_127667862 108
181 3300013308 Ga0157375_10635421 Ga0157375_106354212 108
182 3300013308 Ga0157375_12653994 Ga0157375_126539941 108
183 3300014325 Ga0163163_10386072 Ga0163163_103860722 108
184 3300014325 Ga0163163_11167050 Ga0163163_111670502 108
185 3300014326 Ga0157380_11175719 Ga0157380_111757192 108
186 3300014326 Ga0157380_11321769 Ga0157380_113217691 108
187 3300014326 Ga0157380_11848086 Ga0157380_118480862 108
188 3300014497 Ga0182008_10432221 Ga0182008_104322212 108
189 3300014745 Ga0157377_11343838 Ga0157377_113438381 108
190 3300014968 Ga0157379_11743113 Ga0157379_117431132 108
191 3300015262 Ga0182007_10177447 Ga0182007_101774472 108
192 3300020070 Ga0206356_11445486 Ga0206356_114454861 108
193 3300020070 Ga0206356_11503213 Ga0206356_115032131 108
194 3300020076 Ga0206355_1293151 Ga0206355_12931511 108
195 3300020078 Ga0206352_10525377 Ga0206352_105253772 108
196 3300020080 Ga0206350_10372490 Ga0206350_103724901 108
197 3300020081 Ga0206354_10198566 Ga0206354_101985661 108
198 3300020082 Ga0206353_11262324 Ga0206353_112623242 108
199 3300020610 Ga0154015_1542708 Ga0154015_15427081 108
200 3300022467 Ga0224712_10283472 Ga0224712_102834722 108
201 3300022467 Ga0224712_10678866 Ga0224712_106788661 108
202 3300025899 Ga0207642_10009247 Ga0207642_100092475 108
203 3300025904 Ga0207647_10737996 Ga0207647_107379961 108
204 3300025908 Ga0207643_10375665 Ga0207643_103756652 108
205 3300025909 Ga0207705_10036997 Ga0207705_100369972 108
206 3300025909 Ga0207705_10173824 Ga0207705_101738242 108
207 3300025909 Ga0207705_11486457 Ga0207705_114864571 108
208 3300025911 Ga0207654_10767660 Ga0207654_107676601 108
209 3300025912 Ga0207707_10033822 Ga0207707_100338222 108
210 3300025913 Ga0207695_10054488 Ga0207695_100544884 108
211 3300025913 Ga0207695_10389041 Ga0207695_103890412 108
212 3300025913 Ga0207695_10702682 Ga0207695_107026821 108
213 3300025914 Ga0207671_10174366 Ga0207671_101743662 108
214 3300025917 Ga0207660_10042285 Ga0207660_100422851 108
215 3300025919 Ga0207657_10009087 Ga0207657_100090879 108
216 3300025919 Ga0207657_10136478 Ga0207657_101364783 108
217 3300025920 Ga0207649_10005084 Ga0207649_100050844 108
218 3300025920 Ga0207649_10279763 Ga0207649_102797632 108
219 3300025921 Ga0207652_10008391 Ga0207652_100083918 108
220 3300025923 Ga0207681_11605913 Ga0207681_116059132 108
221 3300025924 Ga0207694_10034485 Ga0207694_100344852 108
222 3300025927 Ga0207687_10325248 Ga0207687_103252481 108
223 3300025927 Ga0207687_10341644 Ga0207687_103416442 108
224 3300025927 Ga0207687_11035344 Ga0207687_110353442 108
225 3300025932 Ga0207690_10012557 Ga0207690_100125572 108
226 3300025932 Ga0207690_10337535 Ga0207690_103375352 108
227 3300025932 Ga0207690_11424473 Ga0207690_114244732 108
228 3300025934 Ga0207686_10000016 Ga0207686_10000016130 108
229 3300025935 Ga0207709_10145548 Ga0207709_101455482 108
230 3300025937 Ga0207669_10196747 Ga0207669_101967471 108
231 3300025938 Ga0207704_10189612 Ga0207704_101896122 108
232 3300025940 Ga0207691_10187500 Ga0207691_101875003 108
233 3300025942 Ga0207689_10650945 Ga0207689_106509452 108
234 3300025944 Ga0207661_10015973 Ga0207661_100159732 108
235 3300025944 Ga0207661_10159902 Ga0207661_101599022 108
236 3300025945 Ga0207679_10305814 Ga0207679_103058142 108
237 3300025945 Ga0207679_10577290 Ga0207679_105772902 108
238 3300025945 Ga0207679_10586854 Ga0207679_105868542 108
239 3300025945 Ga0207679_10603484 Ga0207679_106034841 108
240 3300025949 Ga0207667_10220657 Ga0207667_102206573 108
241 3300025960 Ga0207651_11146976 Ga0207651_111469762 108
242 3300025961 Ga0207712_10156072 Ga0207712_101560722 108
243 3300025961 Ga0207712_10284829 Ga0207712_102848292 108
244 3300025972 Ga0207668_10367059 Ga0207668_103670592 108
245 3300025972 Ga0207668_10931666 Ga0207668_109316662 108
246 3300025981 Ga0207640_10190385 Ga0207640_101903852 108
247 3300025981 Ga0207640_10466701 Ga0207640_104667012 108
248 3300025981 Ga0207640_10744204 Ga0207640_107442041 108
249 3300025981 Ga0207640_10882555 Ga0207640_108825551 108
250 3300025986 Ga0207658_10380929 Ga0207658_103809291 108
251 3300026035 Ga0207703_11441467 Ga0207703_114414672 108
252 3300026041 Ga0207639_10056632 Ga0207639_100566322 108
253 3300026041 Ga0207639_10144340 Ga0207639_101443402 108
254 3300026067 Ga0207678_10351842 Ga0207678_103518422 108
255 3300026067 Ga0207678_10800735 Ga0207678_108007352 108
256 3300026075 Ga0207708_10058187 Ga0207708_100581873 108
257 3300026075 Ga0207708_11860809 Ga0207708_118608091 108
258 3300026078 Ga0207702_10015459 Ga0207702_100154593 108
259 3300026078 Ga0207702_10566464 Ga0207702_105664641 108
260 3300026078 Ga0207702_11999597 Ga0207702_119995971 108
261 3300026088 Ga0207641_10003652 Ga0207641_100036526 108
262 3300026089 Ga0207648_10533452 Ga0207648_105334522 108
263 3300026116 Ga0207674_10210974 Ga0207674_102109743 108
264 3300026116 Ga0207674_10423727 Ga0207674_104237272 108
265 3300026116 Ga0207674_10719417 Ga0207674_107194171 108
266 3300026118 Ga0207675_100428967 Ga0207675_1004289673 108
267 3300026118 Ga0207675_100872742 Ga0207675_1008727422 108
268 3300026121 Ga0207683_11029378 Ga0207683_110293782 108
269 3300026142 Ga0207698_10025949 Ga0207698_100259492 108
270 3300026142 Ga0207698_10073080 Ga0207698_100730802 108
271 3300026142 Ga0207698_10226338 Ga0207698_102263383 108
272 3300027907 Ga0207428_10202467 Ga0207428_102024672 108
273 3300028379 Ga0268266_10000825 Ga0268266_1000082535 108
274 3300028380 Ga0268265_10835929 Ga0268265_108359292 108
275 3300028380 Ga0268265_11338164 Ga0268265_113381641 108
276 3300028381 Ga0268264_11344263 Ga0268264_113442633 108
277 3300031727 Ga0316576_10004257 Ga0316576_100042576 108
278 3300031731 Ga0307405_10738989 Ga0307405_107389892 108
279 3300031733 Ga0316577_10357920 Ga0316577_103579203 108
280 3300031824 Ga0307413_11900798 Ga0307413_119007981 108
281 3300032002 Ga0307416_100955803 Ga0307416_1009558032 108
282 3300035398 Ga0316574_0089965 Ga0316574_0089965_592_918 108
283 3300035398 Ga0316574_0173009 Ga0316574_0173009_1054_1380 108
284 3300036712 Ga0316584_0011869 Ga0316584_0011869_857_1183 108
285 3300038443 Ga0395901_1906570 Ga0395901_1906570_80_406 108
286 3300038443 Ga0395901_2139636 Ga0395901_2139636_104_430 108
287 3300041451 Ga0451791_1346709 Ga0451791_1346709_23_349 108
288 3300041486 Ga0451807_1439438 Ga0451807_1439438_327_653 108
289 3300041503 Ga0451847_0878330 Ga0451847_0878330_162_488 108
290 3300041505 Ga0451849_0063983 Ga0451849_0063983_34_360 108
291 3300041512 Ga0451853_2540431 Ga0451853_2540431_213_539 108
292 3300044683 Ga0466965_0201839 Ga0466965_0201839_692_1018 108
293 3300044694 Ga0466963_0644183 Ga0466963_0644183_364_690 108
294 3300044706 Ga0466964_0051349 Ga0466964_0051349_1341_1667 108
295 3300044706 Ga0466964_0377478 Ga0466964_0377478_240_566 108
296 3300044735 Ga0466968_0399108 Ga0466968_0399108_277_603 108
297 3300045836 Ga0466958_0873558 Ga0466958_0873558_168_494 108
298 3300045976 Ga0466967_0018953 Ga0466967_0018953_2127_2453 108
299 3300045976 Ga0466967_0044251 Ga0466967_0044251_1469_1795 108
300 3300045976 Ga0466967_0171045 Ga0466967_0171045_1536_1862 108
301 3300045976 Ga0466967_0493033 Ga0466967_0493033_127_453 108
302 3300046517 Ga0495630_0260811 Ga0495630_0260811_942_1268 108
303 3300046794 Ga0495589_0165686 Ga0495589_0165686_658_996 108
304 3300046794 Ga0495589_0184791 Ga0495589_0184791_131_457 108
305 3300047321 Ga0495676_0000652 Ga0495676_0000652_25688_26014 108
306 3300047321 Ga0495676_0024641 Ga0495676_0024641_2811_3137 108
307 3300047472 Ga0495686_0206073 Ga0495686_0206073_94_420 108
308 3300048090 Ga0495615_0170282 Ga0495615_0170282_132_458 108
309 3300048903 Ga0496100_0000063 Ga0496100_0000063_36975_37301 108
310 3300048904 Ga0496101_0000012 Ga0496101_0000012_239878_240204 108
311 3300048905 Ga0496102_0000061 Ga0496102_0000061_146262_146588 108
312 3300048906 Ga0496103_0000044 Ga0496103_0000044_146262_146588 108
313 3300048907 Ga0496104_0672917 Ga0496104_0672917_337_663 108
314 3300048909 Ga0496106_0000020 Ga0496106_0000020_139379_139705 108
315 3300048910 Ga0496107_0000014 Ga0496107_0000014_139368_139694 108
316 3300048911 Ga0496108_0199825 Ga0496108_0199825_486_812 108
317 3300048911 Ga0496108_0415078 Ga0496108_0415078_349_675 108
318 3300048911 Ga0496108_0489984 Ga0496108_0489984_102_440 108
319 3300048912 Ga0496109_0619838 Ga0496109_0619838_76_402 108
320 3300048913 Ga0496110_0289265 Ga0496110_0289265_84_410 108
321 3300048913 Ga0496110_0320583 Ga0496110_0320583_95_421 108
322 3300048913 Ga0496110_0332049 Ga0496110_0332049_274_600 108
323 3300048914 Ga0496111_0926831 Ga0496111_0926831_203_529 108
324 3300048915 Ga0496112_0106845 Ga0496112_0106845_271_600 108
325 3300048916 Ga0496113_0059089 Ga0496113_0059089_1795_2121 108
326 3300048916 Ga0496113_0602581 Ga0496113_0602581_27_353 108
327 3300048918 Ga0496115_0579766 Ga0496115_0579766_346_684 108
328 3300048918 Ga0496115_0591710 Ga0496115_0591710_427_753 108
329 3300048920 Ga0496117_0300896 Ga0496117_0300896_254_580 108
330 3300048921 Ga0496118_0447022 Ga0496118_0447022_300_626 108
331 3300048929 Ga0496126_0343342 Ga0496126_0343342_266_604 108
332 3300049581 Ga0501047_0972961 Ga0501047_0972961_315_641 108
333 3300049822 Ga0501035_0682913 Ga0501035_0682913_155_481 108
334 3300050492 nmdc:mga0yw44_869008_c1 nmdc:mga0yw44_869008_c1_65_391 108
335 3300050507 nmdc:mga05p37_3930_c1 nmdc:mga05p37_3930_c1_8699_9028 108
336 3300050510 nmdc:mga06r32_151826_c1 nmdc:mga06r32_151826_c1_327_653 108
337 3300050511 nmdc:mga08y16_144736_c1 nmdc:mga08y16_144736_c1_1696_2025 108
338 3300050512 nmdc:mga0n895_11128_c1 nmdc:mga0n895_11128_c1_7355_7684 108
339 3300050513 nmdc:mga0rr50_58019_c1 nmdc:mga0rr50_58019_c1_1359_1688 108
340 3300050514 nmdc:mga08x19_386451_c1 nmdc:mga08x19_386451_c1_635_964 108
341 3300050515 nmdc:mga0a205_5205_c1 nmdc:mga0a205_5205_c1_4268_4597 108
342 3300053096 Ga0500641_0011550 Ga0500641_0011550_49_375 108
343 3300053146 Ga0500588_0174117 Ga0500588_0174117_425_763 108
344 3300059424 Ga0590075_059488 Ga0590075_059488_387_713 108
345 3300059491 Ga0587070_221483 Ga0587070_221483_22_348 108
346 3300059505 Ga0587083_0232094 Ga0587083_0232094_108_434 108
347 3300059622 Ga0587099_023749 Ga0587099_023749_295_621 108
348 3300005329 Ga0070683_100307037 Ga0070683_1003070372 109
349 3300005344 Ga0070661_101259870 Ga0070661_1012598701 109
350 3300005347 Ga0070668_100190633 Ga0070668_1001906333 109
351 3300005347 Ga0070668_100935422 Ga0070668_1009354221 109
352 3300005355 Ga0070671_100494031 Ga0070671_1004940312 109
353 3300005364 Ga0070673_102051959 Ga0070673_1020519591 109
354 3300005438 Ga0070701_10474482 Ga0070701_104744822 109
355 3300005440 Ga0070705_100492021 Ga0070705_1004920212 109
356 3300005444 Ga0070694_100461333 Ga0070694_1004613332 109
357 3300005456 Ga0070678_100724073 Ga0070678_1007240731 109
358 3300005545 Ga0070695_100357212 Ga0070695_1003572122 109
359 3300005546 Ga0070696_100230968 Ga0070696_1002309682 109
360 3300005549 Ga0070704_100017370 Ga0070704_1000173703 109
361 3300005564 Ga0070664_100163679 Ga0070664_1001636792 109
362 3300005618 Ga0068864_100384459 Ga0068864_1003844592 109
363 3300009098 Ga0105245_10355229 Ga0105245_103552292 109
364 3300009101 Ga0105247_11235661 Ga0105247_112356611 109
365 3300009148 Ga0105243_10022548 Ga0105243_100225483 109
366 3300009176 Ga0105242_11609872 Ga0105242_116098722 109
367 3300009545 Ga0105237_10552458 Ga0105237_105524582 109
368 3300009553 Ga0105249_10789845 Ga0105249_107898452 109
369 3300010375 Ga0105239_10602238 Ga0105239_106022381 109
370 3300013306 Ga0163162_10915945 Ga0163162_109159452 109
371 3300013306 Ga0163162_12205920 Ga0163162_122059202 109
372 3300014745 Ga0157377_10240101 Ga0157377_102401012 109
373 3300025914 Ga0207671_11028709 Ga0207671_110287092 109
374 3300025920 Ga0207649_10220536 Ga0207649_102205361 109
375 3300025927 Ga0207687_10090019 Ga0207687_100900192 109
376 3300025931 Ga0207644_10806657 Ga0207644_108066571 109
377 3300025937 Ga0207669_11151052 Ga0207669_111510522 109
378 3300025944 Ga0207661_10069961 Ga0207661_100699613 109
379 3300025945 Ga0207679_10069057 Ga0207679_100690572 109
380 3300025961 Ga0207712_10332957 Ga0207712_103329572 109
381 3300025961 Ga0207712_11070954 Ga0207712_110709541 109
382 3300025972 Ga0207668_10887491 Ga0207668_108874912 109
383 3300026023 Ga0207677_10642050 Ga0207677_106420501 109
384 3300026078 Ga0207702_10838347 Ga0207702_108383472 109
385 3300026088 Ga0207641_11866336 Ga0207641_118663361 109
386 3300026095 Ga0207676_10288667 Ga0207676_102886672 109
387 3300026118 Ga0207675_100641912 Ga0207675_1006419122 109
388 3300026121 Ga0207683_11135890 Ga0207683_111358902 109
389 3300032004 Ga0307414_11677478 Ga0307414_116774781 109
390 3300044901 Ga0466960_0988890 Ga0466960_0988890_77_406 109
391 3300045976 Ga0466967_0655653 Ga0466967_0655653_177_506 109
392 3300046691 Ga0495670_0706984 Ga0495670_0706984_73_402 109
393 3300048911 Ga0496108_0583631 Ga0496108_0583631_548_877 109
394 3300048912 Ga0496109_1084366 Ga0496109_1084366_230_559 109
395 3300048914 Ga0496111_0361712 Ga0496111_0361712_349_678 109
396 3300048915 Ga0496112_0771266 Ga0496112_0771266_26_355 109
397 3300048916 Ga0496113_0495575 Ga0496113_0495575_185_514 109
398 3300049534 Ga0501318_044932 Ga0501318_044932_60_389 109
399 3300060346 Ga0587111_0091501 Ga0587111_0091501_57_389 109
400 3300061734 Ga0530510_1203627 Ga0530510_1203627_91_420 109
401 3300001977 JGI24746J21847_1065058 JGI24746J21847_10650581 110
402 3300001990 JGI24737J22298_10195880 JGI24737J22298_101958802 110
403 3300001991 JGI24743J22301_10076831 JGI24743J22301_100768311 110
404 3300002076 JGI24749J21850_1029203 JGI24749J21850_10292032 110
405 3300002244 JGI24742J22300_10056958 JGI24742J22300_100569582 110
406 3300005327 Ga0070658_10565830 Ga0070658_105658302 110
407 3300005328 Ga0070676_10433689 Ga0070676_104336892 110
408 3300005329 Ga0070683_100036702 Ga0070683_1000367023 110
409 3300005329 Ga0070683_100815340 Ga0070683_1008153402 110
410 3300005330 Ga0070690_100088950 Ga0070690_1000889503 110
411 3300005331 Ga0070670_100434356 Ga0070670_1004343561 110
412 3300005334 Ga0068869_100690484 Ga0068869_1006904842 110
413 3300005337 Ga0070682_100051657 Ga0070682_1000516573 110
414 3300005338 Ga0068868_100012973 Ga0068868_1000129733 110
415 3300005339 Ga0070660_100397988 Ga0070660_1003979881 110
416 3300005340 Ga0070689_100028871 Ga0070689_1000288713 110
417 3300005341 Ga0070691_10392570 Ga0070691_103925701 110
418 3300005353 Ga0070669_100495672 Ga0070669_1004956722 110
419 3300005354 Ga0070675_100299450 Ga0070675_1002994502 110
420 3300005355 Ga0070671_100574777 Ga0070671_1005747772 110
421 3300005356 Ga0070674_100057695 Ga0070674_1000576952 110
422 3300005365 Ga0070688_100035388 Ga0070688_1000353883 110
423 3300005366 Ga0070659_100020667 Ga0070659_1000206673 110
424 3300005367 Ga0070667_100073476 Ga0070667_1000734762 110
425 3300005406 Ga0070703_10599708 Ga0070703_105997081 110
426 3300005437 Ga0070710_10352932 Ga0070710_103529322 110
427 3300005438 Ga0070701_10052001 Ga0070701_100520012 110
428 3300005439 Ga0070711_100763851 Ga0070711_1007638511 110
429 3300005440 Ga0070705_100830397 Ga0070705_1008303972 110
430 3300005444 Ga0070694_100168673 Ga0070694_1001686732 110
431 3300005456 Ga0070678_100153293 Ga0070678_1001532932 110
432 3300005459 Ga0068867_100111135 Ga0068867_1001111353 110
433 3300005466 Ga0070685_10042777 Ga0070685_100427773 110
434 3300005535 Ga0070684_100298493 Ga0070684_1002984932 110
435 3300005535 Ga0070684_100446237 Ga0070684_1004462372 110
436 3300005539 Ga0068853_100053246 Ga0068853_1000532463 110
437 3300005543 Ga0070672_100569572 Ga0070672_1005695722 110
438 3300005544 Ga0070686_100110942 Ga0070686_1001109422 110
439 3300005545 Ga0070695_100401662 Ga0070695_1004016622 110
440 3300005546 Ga0070696_101606415 Ga0070696_1016064151 110
441 3300005548 Ga0070665_100866951 Ga0070665_1008669512 110
442 3300005548 Ga0070665_102433212 Ga0070665_1024332122 110
443 3300005549 Ga0070704_100330876 Ga0070704_1003308761 110
444 3300005564 Ga0070664_100145756 Ga0070664_1001457563 110
445 3300005577 Ga0068857_100092902 Ga0068857_1000929022 110
446 3300005577 Ga0068857_100110482 Ga0068857_1001104822 110
447 3300005614 Ga0068856_100703309 Ga0068856_1007033092 110
448 3300005614 Ga0068856_101293309 Ga0068856_1012933091 110
449 3300005616 Ga0068852_100112329 Ga0068852_1001123292 110
450 3300005618 Ga0068864_100288979 Ga0068864_1002889792 110
451 3300005718 Ga0068866_10016489 Ga0068866_100164893 110
452 3300005834 Ga0068851_10180312 Ga0068851_101803122 110
453 3300005840 Ga0068870_10401825 Ga0068870_104018252 110
454 3300005841 Ga0068863_100808692 Ga0068863_1008086921 110
455 3300005842 Ga0068858_100043518 Ga0068858_1000435182 110
456 3300005843 Ga0068860_100061878 Ga0068860_1000618783 110
457 3300005844 Ga0068862_100188267 Ga0068862_1001882672 110
458 3300006048 Ga0075363_100868529 Ga0075363_1008685291 110
459 3300006058 Ga0075432_10415468 Ga0075432_104154682 110
460 3300006173 Ga0070716_101303865 Ga0070716_1013038651 110
461 3300006175 Ga0070712_100112814 Ga0070712_1001128141 110
462 3300006175 Ga0070712_101771476 Ga0070712_1017714761 110
463 3300006237 Ga0097621_100898277 Ga0097621_1008982771 110
464 3300006358 Ga0068871_101248717 Ga0068871_1012487171 110
465 3300006358 Ga0068871_101320891 Ga0068871_1013208912 110
466 3300006871 Ga0075434_101796442 Ga0075434_1017964422 110
467 3300006881 Ga0068865_100549689 Ga0068865_1005496892 110
468 3300009011 Ga0105251_10424455 Ga0105251_104244551 110
469 3300009092 Ga0105250_10118940 Ga0105250_101189401 110
470 3300009093 Ga0105240_12602185 Ga0105240_126021851 110
471 3300009094 Ga0111539_10141088 Ga0111539_101410883 110
472 3300009101 Ga0105247_10143443 Ga0105247_101434432 110
473 3300009147 Ga0114129_12692250 Ga0114129_126922501 110
474 3300009148 Ga0105243_10014782 Ga0105243_100147823 110
475 3300009545 Ga0105237_11197643 Ga0105237_111976432 110
476 3300009553 Ga0105249_10038504 Ga0105249_100385043 110
477 3300010375 Ga0105239_10105708 Ga0105239_101057082 110
478 3300011119 Ga0105246_10055690 Ga0105246_100556903 110
479 3300013100 Ga0157373_10369487 Ga0157373_103694872 110
480 3300013102 Ga0157371_10668544 Ga0157371_106685441 110
481 3300013296 Ga0157374_10116789 Ga0157374_101167891 110
482 3300013307 Ga0157372_10069929 Ga0157372_100699294 110
483 3300013308 Ga0157375_10400703 Ga0157375_104007032 110
484 3300014325 Ga0163163_10922852 Ga0163163_109228521 110
485 3300014326 Ga0157380_10130625 Ga0157380_101306253 110
486 3300014745 Ga0157377_10262151 Ga0157377_102621512 110
487 3300014968 Ga0157379_10295829 Ga0157379_102958291 110
488 3300014969 Ga0157376_12201187 Ga0157376_122011872 110
489 3300020081 Ga0206354_10316741 Ga0206354_103167411 110
490 3300025321 Ga0207656_10296184 Ga0207656_102961842 110
491 3300025900 Ga0207710_10165255 Ga0207710_101652551 110
492 3300025901 Ga0207688_10026391 Ga0207688_100263913 110
493 3300025904 Ga0207647_10107039 Ga0207647_101070392 110
494 3300025908 Ga0207643_10114673 Ga0207643_101146732 110
495 3300025909 Ga0207705_10180942 Ga0207705_101809423 110
496 3300025911 Ga0207654_10506530 Ga0207654_105065301 110
497 3300025914 Ga0207671_10232287 Ga0207671_102322872 110
498 3300025915 Ga0207693_10181638 Ga0207693_101816383 110
499 3300025916 Ga0207663_10827445 Ga0207663_108274451 110
500 3300025917 Ga0207660_11176702 Ga0207660_111767021 110
501 3300025918 Ga0207662_10014010 Ga0207662_100140102 110
502 3300025919 Ga0207657_10097388 Ga0207657_100973882 110
503 3300025920 Ga0207649_10721721 Ga0207649_107217212 110
504 3300025923 Ga0207681_10093662 Ga0207681_100936621 110
505 3300025926 Ga0207659_11712342 Ga0207659_117123422 110
506 3300025927 Ga0207687_10024765 Ga0207687_100247654 110
507 3300025931 Ga0207644_11572959 Ga0207644_115729591 110
508 3300025933 Ga0207706_10042095 Ga0207706_100420952 110
509 3300025935 Ga0207709_10042898 Ga0207709_100428983 110
510 3300025935 Ga0207709_10076448 Ga0207709_100764482 110
511 3300025936 Ga0207670_10003497 Ga0207670_100034973 110
512 3300025937 Ga0207669_10562451 Ga0207669_105624512 110
513 3300025939 Ga0207665_10311557 Ga0207665_103115571 110
514 3300025940 Ga0207691_10904706 Ga0207691_109047062 110
515 3300025941 Ga0207711_11617353 Ga0207711_116173531 110
516 3300025942 Ga0207689_10102706 Ga0207689_101027063 110
517 3300025944 Ga0207661_10145819 Ga0207661_101458193 110
518 3300025944 Ga0207661_10403967 Ga0207661_104039672 110
519 3300025945 Ga0207679_10518926 Ga0207679_105189262 110
520 3300025961 Ga0207712_10065345 Ga0207712_100653454 110
521 3300025981 Ga0207640_10201835 Ga0207640_102018351 110
522 3300026023 Ga0207677_10096478 Ga0207677_100964781 110
523 3300026035 Ga0207703_10076087 Ga0207703_100760874 110
524 3300026041 Ga0207639_10103276 Ga0207639_101032762 110
525 3300026067 Ga0207678_10097579 Ga0207678_100975793 110
526 3300026067 Ga0207678_10168141 Ga0207678_101681412 110
527 3300026075 Ga0207708_10015341 Ga0207708_100153413 110
528 3300026078 Ga0207702_10408691 Ga0207702_104086912 110
529 3300026088 Ga0207641_10608177 Ga0207641_106081773 110
530 3300026089 Ga0207648_10030168 Ga0207648_100301684 110
531 3300026095 Ga0207676_10122419 Ga0207676_101224193 110
532 3300026116 Ga0207674_10049021 Ga0207674_100490212 110
533 3300026116 Ga0207674_10134101 Ga0207674_101341013 110
534 3300026118 Ga0207675_100031946 Ga0207675_1000319463 110
535 3300026121 Ga0207683_10089555 Ga0207683_100895552 110
536 3300026142 Ga0207698_10141238 Ga0207698_101412382 110
537 3300027907 Ga0207428_10364948 Ga0207428_103649481 110
538 3300028379 Ga0268266_10298294 Ga0268266_102982941 110
539 3300028380 Ga0268265_10063264 Ga0268265_100632644 110
540 3300031852 Ga0307410_11943072 Ga0307410_119430721 110
541 3300034818 Ga0373950_0121138 Ga0373950_0121138_71_403 110
542 3300035092 Ga0373952_0230185 Ga0373952_0230185_194_526 110
543 3300035121 Ga0373960_0125908 Ga0373960_0125908_395_727 110
544 3300038996 Ga0242420_135132 Ga0242420_135132_58_390 110
545 3300045976 Ga0466967_0808307 Ga0466967_0808307_188_520 110
546 3300046500 Ga0495596_0088647 Ga0495596_0088647_337_669 110
547 3300048091 Ga0495626_0400513 Ga0495626_0400513_158_490 110
548 3300048903 Ga0496100_0035388 Ga0496100_0035388_19_351 110
549 3300048904 Ga0496101_0236416 Ga0496101_0236416_724_1056 110
550 3300048906 Ga0496103_0642584 Ga0496103_0642584_39_371 110
551 3300048907 Ga0496104_0248797 Ga0496104_0248797_520_852 110
552 3300048908 Ga0496105_0383917 Ga0496105_0383917_573_905 110
553 3300048909 Ga0496106_0067519 Ga0496106_0067519_1598_1930 110
554 3300048912 Ga0496109_1260409 Ga0496109_1260409_28_360 110
555 3300048913 Ga0496110_0035815 Ga0496110_0035815_603_935 110
556 3300048914 Ga0496111_0270615 Ga0496111_0270615_901_1233 110
557 3300048915 Ga0496112_0502735 Ga0496112_0502735_797_1129 110
558 3300048916 Ga0496113_0600311 Ga0496113_0600311_522_854 110
559 3300048917 Ga0496114_0748394 Ga0496114_0748394_194_526 110
560 3300048918 Ga0496115_1019788 Ga0496115_1019788_40_372 110
561 3300049161 Ga0501305_094822 Ga0501305_094822_177_509 110
562 3300049533 Ga0501317_091011 Ga0501317_091011_178_510 110
563 3300049534 Ga0501318_047069 Ga0501318_047069_260_592 110
564 3300049538 Ga0501322_025022 Ga0501322_025022_163_495 110
565 3300049539 Ga0501323_046080 Ga0501323_046080_149_481 110
566 3300050490 nmdc:mga03n38_856879_c1 nmdc:mga03n38_856879_c1_94_426 110
567 3300050511 nmdc:mga08y16_392436_c1 nmdc:mga08y16_392436_c1_411_743 110
568 3300050512 nmdc:mga0n895_554811_c1 nmdc:mga0n895_554811_c1_726_1058 110
569 3300059623 Ga0587101_145433 Ga0587101_145433_94_426 110
570 3300059630 Ga0587128_121083 Ga0587128_121083_168_500 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

20

123

0.9

PF14595

Thioredoxin_9

Thioredoxin

20

123

0.8

PF13098

Thioredoxin_2

Thioredoxin-like domain

35

121

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yj7-assembly2.cif.gz_B crystal structure of a hyperstable protein from the precambrian period 0.9885 4 105
2yn1-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period 0.9865 4 106
6nup-assembly1.cif.gz_A structure of thioredoxin (trxa) from rickettsia prowazekii str. madrid e. 0.986 5 106
4wxt-assembly1.cif.gz_A x-ray crystal structure of thioredoxin from mycobacterium avium 0.9831 4 103
2o8v-assembly1.cif.gz_B paps reductase in a covalent complex with thioredoxin c35a 0.9824 4 107
ID Description Score Start End Superfamily
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9822 4 105 3.40.30.10
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9818 29 102 3.40.30.10
3dieB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9803 33 105 3.40.30.10
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9738 6 109 3.40.30.10
af_Q5JMR9_59_168_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9735 13 108 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6N7YBN7-F1-model_v4 Thioredoxin 1.003 4 105 GO:0005829
GO:0015035
GO:0045454
AF-A0A7V9K472-F1-model_v4 Thioredoxin 1.001 5 107 GO:0005829
GO:0015035
GO:0045454
AF-A0A7W9KH78-F1-model_v4 Thioredoxin 0.9994 5 103 GO:0005829
GO:0015035
GO:0045454
AF-A0A4D9DH47-F1-model_v4 Thioredoxin 0.999 5 107 GO:0005829
GO:0015035
GO:0045454
AF-H6RAG8-F1-model_v4 Thioredoxin 0.9982 5 105 GO:0005829
GO:0015035
GO:0045454

Feature Viewer

pLDDT pTM Quality
94.68 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map