F464833

General Info

Members Datasets Scaffolds Average Seq Length
570 307 552 208

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10255621|Ga0207707_102556212
Length 224
Sequence MRRAHDTITLATMPASPSPPKHFSMVRSLHLADAFTLANAACGVAAVFCAMAYVAGQASAYYFAAAALAPAAFVFDVLDGRVARARRTHSALGRELDSLSDVISFGVAPAALGFAAGLRGGWDWVVLVYFVCCGVARLARYNVTAEALAGSSETGKVAYFEGTPIPTSVVLVAVLAFAAWRGRIGEQLWGGAWTIAFWDLHPLSLLFFVSGTLMISKTLRIPKL

Samples

Sample ID Description Type Environment
1 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
2 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
3 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
4 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
5 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
6 2738541277 Variovorax sp. GV051 Isolate Unclassified
7 2738543019 Variovorax sp. GV040 Isolate Unclassified
8 2818991446 Variovorax sp. 1180 Isolate Unclassified
9 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
10 2885198086 Variovorax sp. 679 Isolate Unclassified
11 2885211737 Variovorax sp. 553 Isolate Unclassified
12 2899924645 Variovorax sp. 369 Isolate Unclassified
13 2928037797 Variovorax sp. 1126 Isolate Unclassified
14 2928044640 Variovorax sp. 1128 Isolate Unclassified
15 2928051484 Variovorax sp. 1133 Isolate Unclassified
16 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
17 2928070936 Variovorax gossypii 1167 Isolate Unclassified
18 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
27 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
125 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
295 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
296 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
297 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
301 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
304 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
305 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0.18
Isolates 3.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.44
Nodule 0.35
Rhizoplane 4.21
Rhizosphere 74.74
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10044116 3300002075 Bacteria 906
2 JGI25152J39213_1005172 3300002773 Bacteria 3895
3 JGI25152J39213_1026926 3300002773 Bacteria 931
4 JGI25150J39212_1003222 3300002774 Bacteria 3860
5 JGI25159J45721_1007688 3300002987 Bacteria 3055
6 JGI25159J45721_1007832 3300002987 Bacteria 3007
7 JGI25151J46595_10009110 3300003187 Bacteria 4728
8 JGI25151J46595_10021267 3300003187 Bacteria 2718
9 JGI25153J46596_10009295 3300003215 Bacteria 4594
10 JGI25153J46596_10018378 3300003215 Bacteria 2718
11 JGI25160J50197_1006774 3300003354 Bacteria 4594
12 JGI25160J50197_1059274 3300003354 Bacteria 772
13 JGI25161J50226_1008700 3300003374 Bacteria 1533
14 Ga0006562J51391_1114904 3300003578 Bacteria 2002
15 Ga0055535_1000215 3300003761 Bacteria 61211
16 Ga0055542_1000004 3300003762 Bacteria 553532
17 Ga0055526_1012364 3300003771 Bacteria 3735
18 Ga0055526_1012792 3300003771 Bacteria 3621
19 Ga0055526_1015757 3300003771 Bacteria 3011
20 Ga0055537_1003185 3300003773 Bacteria 5127
21 Ga0055537_1003730 3300003773 Bacteria 4594
22 Ga0055524_1005576 3300003775 Bacteria 5596
23 Ga0055524_1007567 3300003775 Bacteria 4594
24 Ga0055536_1000578 3300003781 Bacteria 24963
25 Ga0055536_1021090 3300003781 Bacteria 1989
26 Ga0055534_1003190 3300003784 Bacteria 5292
27 Ga0055534_1003831 3300003784 Bacteria 4594
28 Ga0055528_1010603 3300003790 Bacteria 3735
29 Ga0055528_1013947 3300003790 Bacteria 3011
30 Ga0055528_1027724 3300003790 Bacteria 1584
31 Ga0055530_10001680 3300003791 Bacteria 15705
32 Ga0055540_1010762 3300003792 Bacteria 3018
33 Ga0055531_10005985 3300003794 Bacteria 6984
34 Ga0055531_10011395 3300003794 Bacteria 4293
35 Ga0055543_1000713 3300004625 Bacteria 16829
36 Ga0055543_1002495 3300004625 Bacteria 6043
37 Ga0065715_10351285 3300005293 Bacteria 950
38 Ga0070676_10008322 3300005328 Bacteria 5589
39 Ga0070676_10036105 3300005328 Bacteria 2846
40 Ga0070676_10230154 3300005328 Bacteria 1228
41 Ga0070676_10568601 3300005328 Bacteria 814
42 Ga0070683_100579916 3300005329 Bacteria 1073
43 Ga0070670_100008808 3300005331 Bacteria 8614
44 Ga0070670_100023082 3300005331 Bacteria 5353
45 Ga0070670_100285927 3300005331 Bacteria 1440
46 Ga0070670_100619834 3300005331 Bacteria 969
47 Ga0068869_100023750 3300005334 Bacteria 4240
48 Ga0068869_100092707 3300005334 Bacteria 2274
49 Ga0068869_100206058 3300005334 Bacteria 1553
50 Ga0068869_100485120 3300005334 Bacteria 1030
51 Ga0070666_10025732 3300005335 Bacteria 3839
52 Ga0070666_10233307 3300005335 Bacteria 1300
53 Ga0070666_10270503 3300005335 Bacteria 1206
54 Ga0070680_100287688 3300005336 Bacteria 1393
55 Ga0068868_100566571 3300005338 Bacteria 1003
56 Ga0070660_100002628 3300005339 Bacteria 12345
57 Ga0070660_100044972 3300005339 Bacteria 3378
58 Ga0070660_100435218 3300005339 Bacteria 1087
59 Ga0070689_100206507 3300005340 Bacteria 1606
60 Ga0070689_100273707 3300005340 Bacteria 1399
61 Ga0070661_100025620 3300005344 Bacteria 4240
62 Ga0070661_100397649 3300005344 Bacteria 1089
63 Ga0070692_10126173 3300005345 Bacteria 1433
64 Ga0070668_100003929 3300005347 Bacteria 10981
65 Ga0070668_100013810 3300005347 Bacteria 6033
66 Ga0070668_100050415 3300005347 Bacteria 3205
67 Ga0070668_100183049 3300005347 Bacteria 1712
68 Ga0070669_100054722 3300005353 Bacteria 2923
69 Ga0070669_100086410 3300005353 Bacteria 2343
70 Ga0070669_100116018 3300005353 Bacteria 2037
71 Ga0070675_100026499 3300005354 Bacteria 4653
72 Ga0070675_100046336 3300005354 Bacteria 3560
73 Ga0070675_100166225 3300005354 Bacteria 1900
74 Ga0070675_100333740 3300005354 Bacteria 1342
75 Ga0070675_100413723 3300005354 Bacteria 1205
76 Ga0070671_100007502 3300005355 Bacteria 8718
77 Ga0070671_100009794 3300005355 Bacteria 7692
78 Ga0070671_100011383 3300005355 Bacteria 7151
79 Ga0070671_100157843 3300005355 Bacteria 1917
80 Ga0070671_100342983 3300005355 Bacteria 1274
81 Ga0070674_100107777 3300005356 Bacteria 2040
82 Ga0070674_100653746 3300005356 Bacteria 894
83 Ga0070673_100001049 3300005364 Bacteria 15701
84 Ga0070673_100098744 3300005364 Bacteria 2401
85 Ga0070673_100369554 3300005364 Bacteria 1277
86 Ga0070673_100516486 3300005364 Bacteria 1082
87 Ga0070667_100001066 3300005367 Bacteria 25082
88 Ga0070667_100035617 3300005367 Bacteria 4171
89 Ga0070667_100177039 3300005367 Bacteria 1885
90 Ga0070667_100209593 3300005367 Bacteria 1732
91 Ga0070667_100339828 3300005367 Bacteria 1358
92 Ga0070667_100539228 3300005367 Bacteria 1072
93 Ga0070700_100144491 3300005441 Bacteria 1620
94 Ga0070663_100004830 3300005455 Bacteria 7945
95 Ga0070663_100220453 3300005455 Bacteria 1489
96 Ga0070678_100241849 3300005456 Bacteria 1509
97 Ga0070662_100000724 3300005457 Bacteria 20163
98 Ga0070681_10018097 3300005458 Bacteria 7044
99 Ga0070681_10131011 3300005458 Bacteria 2440
100 Ga0070681_10192507 3300005458 Bacteria 1959
101 Ga0068867_100104685 3300005459 Bacteria 2166
102 Ga0068867_100177457 3300005459 Bacteria 1691
103 Ga0068867_100192918 3300005459 Bacteria 1626
104 Ga0068867_101098229 3300005459 Bacteria 726
105 Ga0070685_10076877 3300005466 Bacteria 1992
106 Ga0070706_100007578 3300005467 Bacteria 10162
107 Ga0070699_100487787 3300005518 Bacteria 1119
108 Ga0070679_100135171 3300005530 Bacteria 2447
109 Ga0070679_100698496 3300005530 Bacteria 957
110 Ga0070697_100047801 3300005536 Bacteria 3469
111 Ga0068853_100006046 3300005539 Bacteria 9577
112 Ga0068853_100378989 3300005539 Bacteria 1321
113 Ga0070672_100002831 3300005543 Bacteria 11117
114 Ga0070672_100086789 3300005543 Bacteria 2517
115 Ga0070672_100320512 3300005543 Bacteria 1317
116 Ga0070672_100343314 3300005543 Bacteria 1272
117 Ga0070695_100506115 3300005545 Bacteria 935
118 Ga0070696_100169924 3300005546 Bacteria 1611
119 Ga0070696_100281066 3300005546 Bacteria 1269
120 Ga0070696_100696538 3300005546 Bacteria 828
121 Ga0070696_100971563 3300005546 Bacteria 708
122 Ga0070665_100021536 3300005548 Bacteria 6480
123 Ga0070665_100261752 3300005548 Bacteria 1731
124 Ga0070665_100349417 3300005548 Bacteria 1484
125 Ga0070704_100396582 3300005549 Bacteria 1176
126 Ga0068855_100000749 3300005563 Bacteria 39863
127 Ga0068855_100047855 3300005563 Bacteria 5051
128 Ga0068855_100116319 3300005563 Unclassified 3065
129 Ga0070664_100005769 3300005564 Bacteria 9984
130 Ga0068856_100004974 3300005614 Bacteria 13157
131 Ga0068856_100185499 3300005614 Bacteria 2094
132 Ga0068852_100048873 3300005616 Bacteria 3616
133 Ga0068852_100081952 3300005616 Bacteria 2866
134 Ga0068852_100300425 3300005616 Bacteria 1554
135 Ga0068859_100202118 3300005617 Bacteria 2072
136 Ga0068859_100322772 3300005617 Bacteria 1638
137 Ga0068859_100676129 3300005617 Bacteria 1124
138 Ga0068859_101139887 3300005617 Bacteria 858
139 Ga0068864_100012696 3300005618 Bacteria 6962
140 Ga0068864_100034572 3300005618 Bacteria 4300
141 Ga0068864_100042324 3300005618 Bacteria 3898
142 Ga0068864_100457059 3300005618 Bacteria 1222
143 Ga0068861_100293946 3300005719 Bacteria 1404
144 Ga0068851_10001981 3300005834 Bacteria 9004
145 Ga0068851_10208675 3300005834 Bacteria 1093
146 Ga0068870_10024912 3300005840 Bacteria 2965
147 Ga0068870_10445290 3300005840 Bacteria 853
148 Ga0068863_100002825 3300005841 Bacteria 17197
149 Ga0068863_100091698 3300005841 Bacteria 2882
150 Ga0068858_100011569 3300005842 Bacteria 8324
151 Ga0068858_100046470 3300005842 Bacteria 4024
152 Ga0068858_100147675 3300005842 Bacteria 2209
153 Ga0068860_100317181 3300005843 Bacteria 1529
154 Ga0068862_100025443 3300005844 Bacteria 4970
155 Ga0068862_100078706 3300005844 Bacteria 2857
156 Ga0075364_10000107 3300006051 Bacteria 33968
157 Ga0097621_100041684 3300006237 Bacteria 3696
158 Ga0068871_100090612 3300006358 Bacteria 2547
159 Ga0068871_100161756 3300006358 Bacteria 1915
160 Ga0068871_100700449 3300006358 Bacteria 928
161 Ga0075428_100438523 3300006844 Bacteria 1399
162 Ga0068865_100050394 3300006881 Bacteria 2876
163 Ga0068865_100095393 3300006881 Bacteria 2167
164 Ga0068865_100115795 3300006881 Bacteria 1985
165 Ga0097620_100202111 3300006931 Bacteria 2072
166 Ga0097620_100322756 3300006931 Bacteria 1638
167 Ga0097620_100676087 3300006931 Bacteria 1124
168 Ga0097620_101140201 3300006931 Bacteria 858
169 Ga0099826_10000039 3300006948 Bacteria 99286
170 Ga0105240_10012576 3300009093 Bacteria 11676
171 Ga0105240_10381135 3300009093 Bacteria 1593
172 Ga0111539_10349982 3300009094 Bacteria 1719
173 Ga0111539_10714671 3300009094 Bacteria 1166
174 Ga0105245_11333065 3300009098 Bacteria 767
175 Ga0105241_10643569 3300009174 Bacteria 962
176 Ga0105242_10126830 3300009176 Bacteria 2197
177 Ga0105242_10259339 3300009176 Bacteria 1570
178 Ga0105248_10003557 3300009177 Bacteria 17271
179 Ga0105248_10029588 3300009177 Bacteria 6111
180 Ga0105237_10758638 3300009545 Bacteria 977
181 Ga0105249_10669640 3300009553 Bacteria 1096
182 Ga0157373_10001690 3300013100 Bacteria 16830
183 Ga0157371_10001950 3300013102 Bacteria 20519
184 Ga0157370_10232194 3300013104 Bacteria 1707
185 Ga0157369_10045759 3300013105 Bacteria 4757
186 Ga0157369_10290232 3300013105 Bacteria 1703
187 Ga0157374_10109724 3300013296 Bacteria 2653
188 Ga0157374_10536488 3300013296 Bacteria 1177
189 Ga0157378_10016528 3300013297 Bacteria 6463
190 Ga0157378_10086122 3300013297 Bacteria 2848
191 Ga0157378_10140651 3300013297 Bacteria 2241
192 Ga0163162_10011523 3300013306 Bacteria 8623
193 Ga0163162_10099274 3300013306 Bacteria 3002
194 Ga0163162_10101891 3300013306 Bacteria 2964
195 Ga0163162_10259562 3300013306 Bacteria 1869
196 Ga0163162_10639744 3300013306 Bacteria 1188
197 Ga0163162_11496986 3300013306 Bacteria 769
198 Ga0157372_10003134 3300013307 Bacteria 17821
199 Ga0157372_10729886 3300013307 Bacteria 1152
200 Ga0157372_10735506 3300013307 Bacteria 1147
201 Ga0157375_10022086 3300013308 Bacteria 5853
202 Ga0157375_10056119 3300013308 Bacteria 3887
203 Ga0157375_10144486 3300013308 Bacteria 2509
204 Ga0157375_10280024 3300013308 Bacteria 1831
205 Ga0157375_10591056 3300013308 Bacteria 1270
206 Ga0163163_10009902 3300014325 Bacteria 8544
207 Ga0157380_10147751 3300014326 Bacteria 2028
208 Ga0157380_10221739 3300014326 Bacteria 1692
209 Ga0157380_10231188 3300014326 Bacteria 1661
210 Ga0157380_10510284 3300014326 Bacteria 1170
211 Ga0157379_10007873 3300014968 Bacteria 9233
212 Ga0157379_10331825 3300014968 Bacteria 1390
213 Ga0163161_10027233 3300017792 Bacteria 4054
214 Ga0163161_10085616 3300017792 Bacteria 2325
215 Ga0213876_10040892 3300021384 Bacteria 2449
216 Ga0209436_104047 3300025208 Bacteria 3704
217 Ga0209436_106401 3300025208 Bacteria 2582
218 Ga0209672_101454 3300025228 Bacteria 8432
219 Ga0209147_101058 3300025229 Bacteria 11630
220 Ga0209258_100022 3300025242 Bacteria 553584
221 Ga0207425_1000180 3300025245 Bacteria 52117
222 Ga0207425_1020064 3300025245 Bacteria 1433
223 Ga0209148_1000034 3300025254 Bacteria 553584
224 Ga0209129_1000111 3300025258 Bacteria 148853
225 Ga0209129_1006271 3300025258 Bacteria 3913
226 Ga0209565_1000110 3300025263 Bacteria 119879
227 Ga0209673_1000175 3300025273 Bacteria 131239
228 Ga0209673_1000944 3300025273 Bacteria 36333
229 Ga0209673_1000992 3300025273 Bacteria 34667
230 Ga0209673_1001347 3300025273 Bacteria 24544
231 Ga0209130_1000205 3300025284 Bacteria 79260
232 Ga0209130_1000332 3300025284 Bacteria 54263
233 Ga0209675_1000192 3300025291 Bacteria 66905
234 Ga0209675_1008192 3300025291 Bacteria 3882
235 Ga0209676_1000005 3300025292 Bacteria 1076001
236 Ga0209676_1002061 3300025292 Bacteria 15661
237 Ga0209025_1000116 3300025294 Bacteria 218293
238 Ga0209025_1023711 3300025294 Bacteria 3195
239 Ga0209564_1000155 3300025295 Bacteria 165859
240 Ga0209564_1000298 3300025295 Bacteria 99805
241 Ga0209758_1000107 3300025297 Bacteria 218293
242 Ga0209758_1005110 3300025297 Bacteria 10382
243 Ga0209050_1000007 3300025298 Bacteria 1187891
244 Ga0209256_1000038 3300025299 Bacteria 375225
245 Ga0209256_1000087 3300025299 Bacteria 218290
246 Ga0207426_1000090 3300025302 Bacteria 280662
247 Ga0207426_1000123 3300025302 Bacteria 218290
248 Ga0209051_1000009 3300025303 Bacteria 706778
249 Ga0209051_1048741 3300025303 Bacteria 1433
250 Ga0209257_1000011 3300025304 Bacteria 1112630
251 Ga0209257_1000576 3300025304 Bacteria 61751
252 Ga0209257_1000870 3300025304 Bacteria 42856
253 Ga0207697_10034073 3300025315 Bacteria 2085
254 Ga0207697_10052654 3300025315 Bacteria 1685
255 Ga0207656_10010523 3300025321 Bacteria 3470
256 Ga0207656_10181002 3300025321 Bacteria 1012
257 Ga0207642_10400219 3300025899 Bacteria 821
258 Ga0207680_10032467 3300025903 Bacteria 2968
259 Ga0207680_10252236 3300025903 Bacteria 1219
260 Ga0207645_10303972 3300025907 Bacteria 1062
261 Ga0207643_10032288 3300025908 Bacteria 2924
262 Ga0207643_10201695 3300025908 Bacteria 1211
263 Ga0207705_10314285 3300025909 Bacteria 1203
264 Ga0207684_10410931 3300025910 Bacteria 1163
265 Ga0207654_10188116 3300025911 Bacteria 1351
266 Ga0207707_10255621 3300025912 Bacteria 1521
267 Ga0207695_10025753 3300025913 Bacteria 6577
268 Ga0207695_10574016 3300025913 Bacteria 1009
269 Ga0207657_10000201 3300025919 Bacteria 62212
270 Ga0207657_10052276 3300025919 Bacteria 3546
271 Ga0207649_10006211 3300025920 Bacteria 6487
272 Ga0207649_10369515 3300025920 Bacteria 1066
273 Ga0207649_10403106 3300025920 Bacteria 1024
274 Ga0207681_10019121 3300025923 Bacteria 4325
275 Ga0207681_10050063 3300025923 Bacteria 2826
276 Ga0207681_10115541 3300025923 Bacteria 1959
277 Ga0207681_10155540 3300025923 Bacteria 1718
278 Ga0207681_10228189 3300025923 Bacteria 1444
279 Ga0207681_10369063 3300025923 Bacteria 1153
280 Ga0207650_10006140 3300025925 Bacteria 8187
281 Ga0207650_10017164 3300025925 Bacteria 5066
282 Ga0207650_10029450 3300025925 Bacteria 3947
283 Ga0207650_10383905 3300025925 Bacteria 1160
284 Ga0207650_10509929 3300025925 Bacteria 1006
285 Ga0207650_10691889 3300025925 Bacteria 861
286 Ga0207659_10083998 3300025926 Bacteria 2362
287 Ga0207659_10312752 3300025926 Bacteria 1294
288 Ga0207659_10747143 3300025926 Bacteria 839
289 Ga0207659_10977417 3300025926 Bacteria 728
290 Ga0207687_10584343 3300025927 Bacteria 940
291 Ga0207644_10002735 3300025931 Bacteria 11356
292 Ga0207644_10004293 3300025931 Bacteria 9252
293 Ga0207644_10101889 3300025931 Bacteria 2158
294 Ga0207644_10172496 3300025931 Bacteria 1690
295 Ga0207644_10241935 3300025931 Bacteria 1437
296 Ga0207644_10575779 3300025931 Bacteria 933
297 Ga0207690_10002492 3300025932 Bacteria 11129
298 Ga0207690_10047341 3300025932 Bacteria 2853
299 Ga0207690_10091164 3300025932 Bacteria 2154
300 Ga0207706_10000496 3300025933 Bacteria 41991
301 Ga0207706_10058946 3300025933 Bacteria 3381
302 Ga0207706_10816890 3300025933 Bacteria 791
303 Ga0207686_10100325 3300025934 Bacteria 1931
304 Ga0207686_10199093 3300025934 Bacteria 1433
305 Ga0207670_10136427 3300025936 Bacteria 1804
306 Ga0207670_10345782 3300025936 Bacteria 1177
307 Ga0207669_10199445 3300025937 Bacteria 1451
308 Ga0207704_10249611 3300025938 Bacteria 1331
309 Ga0207704_10440789 3300025938 Bacteria 1037
310 Ga0207691_10005561 3300025940 Bacteria 12175
311 Ga0207691_10014635 3300025940 Bacteria 7479
312 Ga0207691_10017171 3300025940 Bacteria 6865
313 Ga0207691_10039725 3300025940 Bacteria 4352
314 Ga0207691_10105928 3300025940 Bacteria 2505
315 Ga0207689_10026805 3300025942 Bacteria 4826
316 Ga0207689_10082911 3300025942 Bacteria 2636
317 Ga0207689_10548021 3300025942 Bacteria 971
318 Ga0207679_10019626 3300025945 Bacteria 4545
319 Ga0207679_10023143 3300025945 Bacteria 4243
320 Ga0207679_10049806 3300025945 Bacteria 3058
321 Ga0207679_10490064 3300025945 Bacteria 1095
322 Ga0207667_10000500 3300025949 Bacteria 51747
323 Ga0207667_10001476 3300025949 Bacteria 29509
324 Ga0207667_10140983 3300025949 Bacteria 2482
325 Ga0207667_10576205 3300025949 Bacteria 1137
326 Ga0207651_10003545 3300025960 Bacteria 7669
327 Ga0207651_10034983 3300025960 Bacteria 3260
328 Ga0207651_10069534 3300025960 Bacteria 2486
329 Ga0207651_10099678 3300025960 Bacteria 2152
330 Ga0207651_10290826 3300025960 Bacteria 1355
331 Ga0207668_10013036 3300025972 Bacteria 5106
332 Ga0207668_10022698 3300025972 Bacteria 4022
333 Ga0207640_10444489 3300025981 Bacteria 1067
334 Ga0207658_10001039 3300025986 Bacteria 22553
335 Ga0207658_10024644 3300025986 Bacteria 4211
336 Ga0207658_10067886 3300025986 Bacteria 2688
337 Ga0207658_10355132 3300025986 Bacteria 1277
338 Ga0207658_10836906 3300025986 Bacteria 836
339 Ga0207677_10130259 3300026023 Bacteria 1908
340 Ga0207677_10309886 3300026023 Bacteria 1307
341 Ga0207677_10737763 3300026023 Bacteria 877
342 Ga0207703_10033179 3300026035 Bacteria 4090
343 Ga0207703_10401256 3300026035 Bacteria 1272
344 Ga0207703_10669550 3300026035 Bacteria 985
345 Ga0207703_11211570 3300026035 Bacteria 726
346 Ga0207639_10009805 3300026041 Bacteria 6619
347 Ga0207639_10115796 3300026041 Bacteria 2193
348 Ga0207678_10002559 3300026067 Bacteria 16569
349 Ga0207708_10009866 3300026075 Bacteria 7088
350 Ga0207708_10188211 3300026075 Bacteria 1642
351 Ga0207702_10008538 3300026078 Bacteria 8633
352 Ga0207702_10100423 3300026078 Bacteria 2553
353 Ga0207641_10390516 3300026088 Bacteria 1335
354 Ga0207641_10606402 3300026088 Bacteria 1072
355 Ga0207641_10974884 3300026088 Bacteria 844
356 Ga0207648_10169558 3300026089 Bacteria 1929
357 Ga0207648_10260819 3300026089 Bacteria 1546
358 Ga0207648_10350248 3300026089 Bacteria 1331
359 Ga0207648_10536704 3300026089 Bacteria 1073
360 Ga0207648_10555489 3300026089 Bacteria 1055
361 Ga0207676_10018416 3300026095 Bacteria 5075
362 Ga0207676_10036027 3300026095 Bacteria 3761
363 Ga0207676_10195354 3300026095 Bacteria 1784
364 Ga0207676_10685580 3300026095 Bacteria 991
365 Ga0207674_10596788 3300026116 Bacteria 1067
366 Ga0207674_10655523 3300026116 Bacteria 1014
367 Ga0207674_10669204 3300026116 Bacteria 1002
368 Ga0207675_100077637 3300026118 Bacteria 3111
369 Ga0207675_100197517 3300026118 Bacteria 1931
370 Ga0207675_100346513 3300026118 Bacteria 1455
371 Ga0207675_100829791 3300026118 Bacteria 939
372 Ga0207683_10587324 3300026121 Bacteria 1031
373 Ga0207683_10878805 3300026121 Bacteria 832
374 Ga0207683_11132084 3300026121 Bacteria 726
375 Ga0207698_10005482 3300026142 Bacteria 7850
376 Ga0207698_10103033 3300026142 Bacteria 2371
377 Ga0207698_10258018 3300026142 Bacteria 1600
378 Ga0207698_10840108 3300026142 Bacteria 923
379 Ga0207698_10920678 3300026142 Bacteria 882
380 Ga0209982_1024736 3300027552 Bacteria 932
381 Ga0209282_1000058 3300027666 Bacteria 99152
382 Ga0209974_10065512 3300027876 Bacteria 1234
383 Ga0207428_10343882 3300027907 Bacteria 1098
384 Ga0207428_10464857 3300027907 Bacteria 921
385 Ga0268266_10035565 3300028379 Bacteria 4238
386 Ga0268266_10193504 3300028379 Bacteria 1858
387 Ga0268266_10201610 3300028379 Bacteria 1821
388 Ga0268266_10720473 3300028379 Bacteria 962
389 Ga0268265_10173695 3300028380 Bacteria 1844
390 Ga0268264_10086146 3300028381 Bacteria 2698
391 Ga0268264_10842091 3300028381 Bacteria 918
392 Ga0268264_11264298 3300028381 Bacteria 748
393 Ga0307513_10560870 3300031456 Bacteria 854
394 Ga0307408_100127574 3300031548 Bacteria 1980
395 Ga0307516_10134644 3300031730 Bacteria 2247
396 Ga0307405_10017876 3300031731 Bacteria 3901
397 Ga0307405_10085223 3300031731 Bacteria 2076
398 Ga0307413_10067651 3300031824 Bacteria 2234
399 Ga0307410_10053041 3300031852 Bacteria 2742
400 Ga0307410_10490375 3300031852 Bacteria 1009
401 Ga0307407_10621564 3300031903 Bacteria 806
402 Ga0307412_10011034 3300031911 Bacteria 5221
403 Ga0307412_10208067 3300031911 Bacteria 1491
404 Ga0307416_100042037 3300032002 Bacteria 3565
405 Ga0307416_100057756 3300032002 Bacteria 3141
406 Ga0307416_100432724 3300032002 Bacteria 1363
407 Ga0307414_10501565 3300032004 Bacteria 1074
408 Ga0307414_11004896 3300032004 Bacteria 768
409 Ga0307411_10003694 3300032005 Bacteria 7168
410 Ga0307411_10087235 3300032005 Bacteria 2167
411 Ga0307411_10176984 3300032005 Bacteria 1615
412 Ga0307415_100018565 3300032126 Bacteria 4204
413 Ga0307415_100218817 3300032126 Bacteria 1525
414 Ga0373960_0099106 3300035121 Bacteria 942
415 Ga0373943_0366324 3300035170 Bacteria 828
416 Ga0373961_0050982 3300035241 Bacteria 1227
417 Ga0436365_0448718 3300039437 Bacteria 5773
418 Ga0451853_0749231 3300041512 Bacteria 2518
419 Ga0439449_0110807 3300042007 Bacteria 1017
420 Ga0466972_0081432 3300044658 Bacteria 1541
421 Ga0466967_0395620 3300045976 Bacteria 1344
422 Ga0495638_0031541 3300046460 Bacteria 3405
423 Ga0495580_0010452 3300046472 Bacteria 7234
424 Ga0495605_0002870 3300046474 Bacteria 10477
425 Ga0495584_0205475 3300046491 Bacteria 1001
426 Ga0495594_0042410 3300046499 Bacteria 2492
427 Ga0495596_0000320 3300046500 Bacteria 31290
428 Ga0495607_0021980 3300046501 Bacteria 4011
429 Ga0495610_0000514 3300046512 Bacteria 39181
430 Ga0495616_0003256 3300046513 Bacteria 10439
431 Ga0495616_0005265 3300046513 Bacteria 7982
432 Ga0495631_0000455 3300046518 Bacteria 27845
433 Ga0495637_0037289 3300046520 Bacteria 2111
434 Ga0495648_0012532 3300046524 Bacteria 6318
435 Ga0495663_0014664 3300046525 Bacteria 2199
436 Ga0495654_0009970 3300046530 Bacteria 5189
437 Ga0495621_0008759 3300046539 Bacteria 3045
438 Ga0495597_0045030 3300046542 Bacteria 1960
439 Ga0495622_0051809 3300046557 Bacteria 1904
440 Ga0495668_0114618 3300046616 Bacteria 1474
441 Ga0495625_0022596 3300046660 Bacteria 4819
442 Ga0495661_0022023 3300046665 Bacteria 4147
443 Ga0495588_0040880 3300046674 Bacteria 2366
444 Ga0495669_0146242 3300046684 Bacteria 1117
445 Ga0495671_0015635 3300046692 Bacteria 4061
446 Ga0495604_0003210 3300047317 Bacteria 13063
447 Ga0495672_0005431 3300047320 Bacteria 10115
448 Ga0495676_0069981 3300047321 Bacteria 2705
449 Ga0495685_117319 3300047447 Bacteria 874
450 Ga0495614_0006942 3300048089 Bacteria 5058
451 Ga0496100_0172526 3300048903 Bacteria 1559
452 Ga0496101_0105844 3300048904 Bacteria 2111
453 Ga0496102_0003972 3300048905 Bacteria 12535
454 Ga0496102_0029946 3300048905 Bacteria 4871
455 Ga0496102_0561978 3300048905 Bacteria 1064
456 Ga0496103_0007429 3300048906 Bacteria 6532
457 Ga0496104_0032318 3300048907 Bacteria 4870
458 Ga0496105_0102810 3300048908 Bacteria 2360
459 Ga0496106_0006216 3300048909 Bacteria 8835
460 Ga0496106_0295511 3300048909 Bacteria 1299
461 Ga0496107_0072954 3300048910 Bacteria 2496
462 Ga0496108_0159255 3300048911 Bacteria 1950
463 Ga0496108_0203755 3300048911 Bacteria 1717
464 Ga0496108_0344604 3300048911 Bacteria 1300
465 Ga0496109_0394691 3300048912 Bacteria 1307
466 Ga0496110_0071817 3300048913 Bacteria 3070
467 Ga0496110_0145321 3300048913 Bacteria 2145
468 Ga0496110_0200361 3300048913 Bacteria 1814
469 Ga0496110_0249770 3300048913 Bacteria 1614
470 Ga0496111_0210748 3300048914 Bacteria 1443
471 Ga0496111_0270018 3300048914 Bacteria 1262
472 Ga0496116_0051071 3300048919 Bacteria 2749
473 Ga0496117_0049833 3300048920 Bacteria 2974
474 Ga0496118_0010450 3300048921 Bacteria 9195
475 Ga0496121_0068374 3300048924 Bacteria 2873
476 Ga0496122_0007440 3300048925 Bacteria 12169
477 Ga0496123_0003848 3300048926 Bacteria 16337
478 Ga0496124_0040556 3300048927 Bacteria 4025
479 Ga0496125_0028991 3300048928 Bacteria 4984
480 Ga0496125_0106118 3300048928 Bacteria 2051
481 Ga0496125_0107460 3300048928 Bacteria 2033
482 Ga0496126_0164798 3300048929 Bacteria 1892
483 Ga0496126_0215241 3300048929 Bacteria 1616
484 Ga0501031_0006012 3300049568 Bacteria 7922
485 Ga0501031_0079890 3300049568 Bacteria 2131
486 Ga0501032_0007188 3300049569 Bacteria 8142
487 Ga0501032_0188340 3300049569 Bacteria 1349
488 Ga0501033_0002494 3300049570 Bacteria 15612
489 Ga0501033_0010856 3300049570 Bacteria 6983
490 Ga0501034_0246253 3300049571 Bacteria 1732
491 Ga0501036_0001586 3300049572 Bacteria 17583
492 Ga0501036_0003940 3300049572 Bacteria 11926
493 Ga0501036_0308356 3300049572 Bacteria 1323
494 Ga0501037_0097610 3300049573 Bacteria 2123
495 Ga0501038_0009918 3300049574 Bacteria 8721
496 Ga0501038_0009928 3300049574 Bacteria 8718
497 Ga0501038_0018946 3300049574 Bacteria 6210
498 Ga0501039_0075042 3300049575 Bacteria 2628
499 Ga0501039_0238616 3300049575 Bacteria 1429
500 Ga0501040_0149646 3300049576 Bacteria 1646
501 Ga0501041_0203667 3300049577 Unclassified 1241
502 Ga0501042_0058919 3300049578 Bacteria 2741
503 Ga0501043_0031094 3300049579 Bacteria 4198
504 Ga0501043_0037196 3300049579 Bacteria 3829
505 Ga0501043_0075866 3300049579 Bacteria 2640
506 Ga0501046_0165121 3300049580 Bacteria 1663
507 Ga0501046_0170478 3300049580 Bacteria 1634
508 Ga0501047_0020466 3300049581 Bacteria 6352
509 Ga0501048_0185479 3300049582 Bacteria 1474
510 Ga0501068_0014654 3300049584 Bacteria 4486
511 Ga0501068_0300508 3300049584 Bacteria 1027
512 Ga0501069_0136491 3300049585 Bacteria 1406
513 Ga0501070_0200763 3300049586 Bacteria 1638
514 Ga0501071_0028106 3300049587 Bacteria 3961
515 Ga0501072_0198079 3300049588 Bacteria 1601
516 Ga0501073_0011183 3300049589 Bacteria 6563
517 Ga0501075_0053942 3300049591 Bacteria 3023
518 Ga0501076_0032459 3300049592 Bacteria 4075
519 Ga0501077_0104164 3300049593 Bacteria 1798
520 Ga0501079_0283958 3300049741 Unclassified 1294
521 Ga0501080_0021094 3300049742 Bacteria 6030
522 Ga0501081_0186032 3300049743 Bacteria 1503
523 Ga0501035_0000504 3300049822 Bacteria 44035
524 Ga0501035_0107201 3300049822 Bacteria 2449
525 Ga0501044_0056622 3300049823 Bacteria 4025
526 Ga0501044_0119489 3300049823 Bacteria 2638
527 Ga0501044_0180569 3300049823 Bacteria 2077
528 Ga0501045_0078870 3300049824 Bacteria 2428
529 Ga0501045_0124039 3300049824 Unclassified 1918
530 nmdc:mga00v17_1907_c1 3300050491 Bacteria 10785
531 nmdc:mga08y16_299661_c1 3300050511 Bacteria 1657
532 nmdc:mga08y16_32273_c1 3300050511 Bacteria 5507
533 nmdc:mga08y16_491888_c1 3300050511 Bacteria 1247
534 nmdc:mga0n895_419762_c1 3300050512 Bacteria 1352
535 Ga0500643_004327 3300053087 Bacteria 6474
536 Ga0500651_0000052 3300053093 Bacteria 76301
537 Ga0500560_157918 3300053107 Bacteria 751
538 Ga0500571_000036 3300053110 Bacteria 42725
539 Ga0500592_014971 3300053116 Bacteria 1243
540 Ga0500655_004623 3300053133 Bacteria 2471
541 Ga0500658_0000033 3300053134 Bacteria 89738
542 Ga0500658_0000040 3300053134 Bacteria 79293
543 Ga0500559_0001653 3300053136 Bacteria 12335
544 Ga0500574_002546 3300053141 Bacteria 3026
545 Ga0500604_0066626 3300053151 Bacteria 1141
546 Ga0500616_0038423 3300053153 Bacteria 2585
547 Ga0500638_010945 3300053162 Bacteria 4000
548 Ga0500636_0050978 3300053177 Bacteria 2433
549 Ga0590075_062045 3300059424 Bacteria 963
550 Ga0501082_0035312 3300060353 Bacteria 4309
551 Ga0530510_0004976 3300061734 Bacteria 9180
552 Ga0530510_0306899 3300061734 Unclassified 1188

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0395620 Ga0466967_0395620_145_909 160
2 3300048907 Ga0496104_0032318 Ga0496104_0032318_1858_2436 180
3 3300005617 Ga0068859_100322772 Ga0068859_1003227722 184
4 3300005842 Ga0068858_100011569 Ga0068858_1000115693 184
5 3300006931 Ga0097620_100322756 Ga0097620_1003227562 184
6 3300014968 Ga0157379_10007873 Ga0157379_100078734 184
7 3300026035 Ga0207703_10401256 Ga0207703_104012562 184
8 3300025908 Ga0207643_10201695 Ga0207643_102016952 186
9 3300005293 Ga0065715_10351285 Ga0065715_103512851 189
10 3300005331 Ga0070670_100619834 Ga0070670_1006198342 189
11 3300005335 Ga0070666_10270503 Ga0070666_102705031 189
12 3300005347 Ga0070668_100013810 Ga0070668_1000138103 189
13 3300005354 Ga0070675_100333740 Ga0070675_1003337401 189
14 3300005459 Ga0068867_100104685 Ga0068867_1001046852 189
15 3300005548 Ga0070665_100021536 Ga0070665_1000215366 189
16 3300005617 Ga0068859_100202118 Ga0068859_1002021182 189
17 3300006931 Ga0097620_100202111 Ga0097620_1002021112 189
18 3300025903 Ga0207680_10252236 Ga0207680_102522361 189
19 3300025923 Ga0207681_10050063 Ga0207681_100500632 189
20 3300025925 Ga0207650_10691889 Ga0207650_106918892 189
21 3300025926 Ga0207659_10312752 Ga0207659_103127522 189
22 3300026089 Ga0207648_10169558 Ga0207648_101695582 189
23 3300027907 Ga0207428_10343882 Ga0207428_103438821 189
24 3300028379 Ga0268266_10035565 Ga0268266_100355652 189
25 3300050511 nmdc:mga08y16_299661_c1 nmdc:mga08y16_299661_c1_68_688 189
26 3300005546 Ga0070696_100281066 Ga0070696_1002810661 194
27 3300026075 Ga0207708_10009866 Ga0207708_100098665 194
28 iso_pu_bacteria 2643221603 2644031405 194
29 3300005334 Ga0068869_100206058 Ga0068869_1002060582 197
30 3300005614 Ga0068856_100185499 Ga0068856_1001854991 197
31 3300009545 Ga0105237_10758638 Ga0105237_107586381 197
32 3300013296 Ga0157374_10536488 Ga0157374_105364882 197
33 3300013307 Ga0157372_10735506 Ga0157372_107355062 197
34 3300025932 Ga0207690_10091164 Ga0207690_100911641 197
35 3300025933 Ga0207706_10816890 Ga0207706_108168901 197
36 3300026078 Ga0207702_10100423 Ga0207702_101004231 197
37 3300032004 Ga0307414_11004896 Ga0307414_110048961 197
38 3300032005 Ga0307411_10087235 Ga0307411_100872351 197
39 3300048905 Ga0496102_0561978 Ga0496102_0561978_144_809 197
40 3300048913 Ga0496110_0071817 Ga0496110_0071817_1044_1709 197
41 3300002075 JGI24738J21930_10044116 JGI24738J21930_100441161 198
42 3300002773 JGI25152J39213_1005172 JGI25152J39213_10051724 198
43 3300002773 JGI25152J39213_1026926 JGI25152J39213_10269261 198
44 3300002774 JGI25150J39212_1003222 JGI25150J39212_10032223 198
45 3300002987 JGI25159J45721_1007688 JGI25159J45721_10076883 198
46 3300002987 JGI25159J45721_1007832 JGI25159J45721_10078322 198
47 3300003187 JGI25151J46595_10009110 JGI25151J46595_100091105 198
48 3300003187 JGI25151J46595_10021267 JGI25151J46595_100212673 198
49 3300003215 JGI25153J46596_10009295 JGI25153J46596_100092955 198
50 3300003215 JGI25153J46596_10018378 JGI25153J46596_100183783 198
51 3300003354 JGI25160J50197_1006774 JGI25160J50197_10067745 198
52 3300003354 JGI25160J50197_1059274 JGI25160J50197_10592741 198
53 3300003374 JGI25161J50226_1008700 JGI25161J50226_10087002 198
54 3300003578 Ga0006562J51391_1114904 Ga0006562J51391_11149043 198
55 3300003761 Ga0055535_1000215 Ga0055535_100021533 198
56 3300003762 Ga0055542_1000004 Ga0055542_1000004393 198
57 3300003771 Ga0055526_1012364 Ga0055526_10123645 198
58 3300003771 Ga0055526_1012792 Ga0055526_10127922 198
59 3300003771 Ga0055526_1015757 Ga0055526_10157572 198
60 3300003773 Ga0055537_1003185 Ga0055537_10031852 198
61 3300003773 Ga0055537_1003730 Ga0055537_10037305 198
62 3300003775 Ga0055524_1005576 Ga0055524_10055765 198
63 3300003775 Ga0055524_1007567 Ga0055524_10075675 198
64 3300003781 Ga0055536_1000578 Ga0055536_100057820 198
65 3300003781 Ga0055536_1021090 Ga0055536_10210903 198
66 3300003784 Ga0055534_1003190 Ga0055534_10031905 198
67 3300003784 Ga0055534_1003831 Ga0055534_10038315 198
68 3300003790 Ga0055528_1010603 Ga0055528_10106035 198
69 3300003790 Ga0055528_1013947 Ga0055528_10139472 198
70 3300003790 Ga0055528_1027724 Ga0055528_10277242 198
71 3300003791 Ga0055530_10001680 Ga0055530_100016806 198
72 3300003792 Ga0055540_1010762 Ga0055540_10107625 198
73 3300003794 Ga0055531_10005985 Ga0055531_100059855 198
74 3300003794 Ga0055531_10011395 Ga0055531_100113954 198
75 3300004625 Ga0055543_1000713 Ga0055543_10007134 198
76 3300004625 Ga0055543_1002495 Ga0055543_10024953 198
77 3300005328 Ga0070676_10008322 Ga0070676_100083222 198
78 3300005328 Ga0070676_10036105 Ga0070676_100361053 198
79 3300005328 Ga0070676_10230154 Ga0070676_102301542 198
80 3300005328 Ga0070676_10568601 Ga0070676_105686011 198
81 3300005329 Ga0070683_100579916 Ga0070683_1005799162 198
82 3300005331 Ga0070670_100008808 Ga0070670_1000088084 198
83 3300005331 Ga0070670_100023082 Ga0070670_1000230821 198
84 3300005331 Ga0070670_100285927 Ga0070670_1002859272 198
85 3300005334 Ga0068869_100023750 Ga0068869_1000237501 198
86 3300005334 Ga0068869_100092707 Ga0068869_1000927073 198
87 3300005334 Ga0068869_100485120 Ga0068869_1004851201 198
88 3300005335 Ga0070666_10025732 Ga0070666_100257326 198
89 3300005335 Ga0070666_10233307 Ga0070666_102333071 198
90 3300005336 Ga0070680_100287688 Ga0070680_1002876882 198
91 3300005338 Ga0068868_100566571 Ga0068868_1005665712 198
92 3300005339 Ga0070660_100002628 Ga0070660_1000026283 198
93 3300005339 Ga0070660_100044972 Ga0070660_1000449721 198
94 3300005339 Ga0070660_100435218 Ga0070660_1004352181 198
95 3300005340 Ga0070689_100206507 Ga0070689_1002065072 198
96 3300005340 Ga0070689_100273707 Ga0070689_1002737072 198
97 3300005344 Ga0070661_100025620 Ga0070661_1000256203 198
98 3300005344 Ga0070661_100397649 Ga0070661_1003976492 198
99 3300005345 Ga0070692_10126173 Ga0070692_101261732 198
100 3300005347 Ga0070668_100003929 Ga0070668_1000039294 198
101 3300005347 Ga0070668_100050415 Ga0070668_1000504152 198
102 3300005347 Ga0070668_100183049 Ga0070668_1001830492 198
103 3300005353 Ga0070669_100054722 Ga0070669_1000547223 198
104 3300005353 Ga0070669_100086410 Ga0070669_1000864104 198
105 3300005353 Ga0070669_100116018 Ga0070669_1001160182 198
106 3300005354 Ga0070675_100026499 Ga0070675_1000264994 198
107 3300005354 Ga0070675_100046336 Ga0070675_1000463364 198
108 3300005354 Ga0070675_100166225 Ga0070675_1001662253 198
109 3300005354 Ga0070675_100413723 Ga0070675_1004137232 198
110 3300005355 Ga0070671_100007502 Ga0070671_1000075025 198
111 3300005355 Ga0070671_100009794 Ga0070671_1000097947 198
112 3300005355 Ga0070671_100011383 Ga0070671_1000113838 198
113 3300005355 Ga0070671_100157843 Ga0070671_1001578432 198
114 3300005355 Ga0070671_100342983 Ga0070671_1003429831 198
115 3300005356 Ga0070674_100107777 Ga0070674_1001077772 198
116 3300005356 Ga0070674_100653746 Ga0070674_1006537461 198
117 3300005364 Ga0070673_100001049 Ga0070673_10000104912 198
118 3300005364 Ga0070673_100098744 Ga0070673_1000987443 198
119 3300005364 Ga0070673_100369554 Ga0070673_1003695542 198
120 3300005364 Ga0070673_100516486 Ga0070673_1005164861 198
121 3300005367 Ga0070667_100001066 Ga0070667_10000106615 198
122 3300005367 Ga0070667_100035617 Ga0070667_1000356177 198
123 3300005367 Ga0070667_100177039 Ga0070667_1001770392 198
124 3300005367 Ga0070667_100209593 Ga0070667_1002095932 198
125 3300005367 Ga0070667_100339828 Ga0070667_1003398282 198
126 3300005367 Ga0070667_100539228 Ga0070667_1005392281 198
127 3300005441 Ga0070700_100144491 Ga0070700_1001444912 198
128 3300005455 Ga0070663_100004830 Ga0070663_1000048305 198
129 3300005455 Ga0070663_100220453 Ga0070663_1002204532 198
130 3300005456 Ga0070678_100241849 Ga0070678_1002418493 198
131 3300005457 Ga0070662_100000724 Ga0070662_10000072418 198
132 3300005458 Ga0070681_10018097 Ga0070681_100180979 198
133 3300005458 Ga0070681_10131011 Ga0070681_101310112 198
134 3300005458 Ga0070681_10192507 Ga0070681_101925073 198
135 3300005459 Ga0068867_100177457 Ga0068867_1001774571 198
136 3300005459 Ga0068867_100192918 Ga0068867_1001929182 198
137 3300005459 Ga0068867_101098229 Ga0068867_1010982291 198
138 3300005466 Ga0070685_10076877 Ga0070685_100768771 198
139 3300005467 Ga0070706_100007578 Ga0070706_1000075786 198
140 3300005518 Ga0070699_100487787 Ga0070699_1004877872 198
141 3300005530 Ga0070679_100135171 Ga0070679_1001351713 198
142 3300005530 Ga0070679_100698496 Ga0070679_1006984961 198
143 3300005536 Ga0070697_100047801 Ga0070697_1000478012 198
144 3300005539 Ga0068853_100006046 Ga0068853_1000060468 198
145 3300005539 Ga0068853_100378989 Ga0068853_1003789892 198
146 3300005543 Ga0070672_100002831 Ga0070672_1000028316 198
147 3300005543 Ga0070672_100086789 Ga0070672_1000867892 198
148 3300005543 Ga0070672_100320512 Ga0070672_1003205123 198
149 3300005543 Ga0070672_100343314 Ga0070672_1003433142 198
150 3300005545 Ga0070695_100506115 Ga0070695_1005061151 198
151 3300005546 Ga0070696_100169924 Ga0070696_1001699242 198
152 3300005546 Ga0070696_100696538 Ga0070696_1006965382 198
153 3300005546 Ga0070696_100971563 Ga0070696_1009715631 198
154 3300005548 Ga0070665_100261752 Ga0070665_1002617524 198
155 3300005548 Ga0070665_100349417 Ga0070665_1003494172 198
156 3300005549 Ga0070704_100396582 Ga0070704_1003965822 198
157 3300005563 Ga0068855_100000749 Ga0068855_10000074934 198
158 3300005563 Ga0068855_100047855 Ga0068855_1000478553 198
159 3300005563 Ga0068855_100116319 Ga0068855_1001163192 198
160 3300005564 Ga0070664_100005769 Ga0070664_1000057696 198
161 3300005614 Ga0068856_100004974 Ga0068856_10000497411 198
162 3300005616 Ga0068852_100048873 Ga0068852_1000488735 198
163 3300005616 Ga0068852_100081952 Ga0068852_1000819522 198
164 3300005616 Ga0068852_100300425 Ga0068852_1003004251 198
165 3300005617 Ga0068859_100676129 Ga0068859_1006761292 198
166 3300005617 Ga0068859_101139887 Ga0068859_1011398871 198
167 3300005618 Ga0068864_100012696 Ga0068864_1000126964 198
168 3300005618 Ga0068864_100034572 Ga0068864_1000345723 198
169 3300005618 Ga0068864_100042324 Ga0068864_1000423245 198
170 3300005618 Ga0068864_100457059 Ga0068864_1004570591 198
171 3300005719 Ga0068861_100293946 Ga0068861_1002939462 198
172 3300005834 Ga0068851_10001981 Ga0068851_100019812 198
173 3300005834 Ga0068851_10208675 Ga0068851_102086752 198
174 3300005840 Ga0068870_10024912 Ga0068870_100249124 198
175 3300005840 Ga0068870_10445290 Ga0068870_104452901 198
176 3300005841 Ga0068863_100002825 Ga0068863_1000028257 198
177 3300005841 Ga0068863_100091698 Ga0068863_1000916983 198
178 3300005842 Ga0068858_100046470 Ga0068858_1000464702 198
179 3300005842 Ga0068858_100147675 Ga0068858_1001476753 198
180 3300005843 Ga0068860_100317181 Ga0068860_1003171813 198
181 3300005844 Ga0068862_100025443 Ga0068862_1000254434 198
182 3300005844 Ga0068862_100078706 Ga0068862_1000787063 198
183 3300006051 Ga0075364_10000107 Ga0075364_100001077 198
184 3300006237 Ga0097621_100041684 Ga0097621_1000416842 198
185 3300006358 Ga0068871_100090612 Ga0068871_1000906122 198
186 3300006358 Ga0068871_100161756 Ga0068871_1001617562 198
187 3300006358 Ga0068871_100700449 Ga0068871_1007004491 198
188 3300006844 Ga0075428_100438523 Ga0075428_1004385232 198
189 3300006881 Ga0068865_100050394 Ga0068865_1000503943 198
190 3300006881 Ga0068865_100095393 Ga0068865_1000953932 198
191 3300006881 Ga0068865_100115795 Ga0068865_1001157953 198
192 3300006931 Ga0097620_100676087 Ga0097620_1006760872 198
193 3300006931 Ga0097620_101140201 Ga0097620_1011402011 198
194 3300006948 Ga0099826_10000039 Ga0099826_1000003955 198
195 3300009093 Ga0105240_10012576 Ga0105240_1001257612 198
196 3300009093 Ga0105240_10381135 Ga0105240_103811352 198
197 3300009094 Ga0111539_10349982 Ga0111539_103499822 198
198 3300009094 Ga0111539_10714671 Ga0111539_107146712 198
199 3300009098 Ga0105245_11333065 Ga0105245_113330651 198
200 3300009174 Ga0105241_10643569 Ga0105241_106435692 198
201 3300009176 Ga0105242_10126830 Ga0105242_101268303 198
202 3300009176 Ga0105242_10259339 Ga0105242_102593392 198
203 3300009177 Ga0105248_10003557 Ga0105248_100035576 198
204 3300009177 Ga0105248_10029588 Ga0105248_100295882 198
205 3300009553 Ga0105249_10669640 Ga0105249_106696402 198
206 3300013100 Ga0157373_10001690 Ga0157373_100016908 198
207 3300013102 Ga0157371_10001950 Ga0157371_100019506 198
208 3300013104 Ga0157370_10232194 Ga0157370_102321942 198
209 3300013105 Ga0157369_10045759 Ga0157369_100457595 198
210 3300013105 Ga0157369_10290232 Ga0157369_102902322 198
211 3300013296 Ga0157374_10109724 Ga0157374_101097242 198
212 3300013297 Ga0157378_10016528 Ga0157378_100165286 198
213 3300013297 Ga0157378_10086122 Ga0157378_100861224 198
214 3300013297 Ga0157378_10140651 Ga0157378_101406512 198
215 3300013306 Ga0163162_10011523 Ga0163162_100115233 198
216 3300013306 Ga0163162_10099274 Ga0163162_100992742 198
217 3300013306 Ga0163162_10101891 Ga0163162_101018912 198
218 3300013306 Ga0163162_10259562 Ga0163162_102595623 198
219 3300013306 Ga0163162_10639744 Ga0163162_106397441 198
220 3300013306 Ga0163162_11496986 Ga0163162_114969861 198
221 3300013307 Ga0157372_10003134 Ga0157372_1000313410 198
222 3300013307 Ga0157372_10729886 Ga0157372_107298862 198
223 3300013308 Ga0157375_10022086 Ga0157375_100220862 198
224 3300013308 Ga0157375_10056119 Ga0157375_100561194 198
225 3300013308 Ga0157375_10144486 Ga0157375_101444862 198
226 3300013308 Ga0157375_10280024 Ga0157375_102800242 198
227 3300013308 Ga0157375_10591056 Ga0157375_105910562 198
228 3300014325 Ga0163163_10009902 Ga0163163_100099025 198
229 3300014326 Ga0157380_10147751 Ga0157380_101477513 198
230 3300014326 Ga0157380_10221739 Ga0157380_102217392 198
231 3300014326 Ga0157380_10231188 Ga0157380_102311882 198
232 3300014326 Ga0157380_10510284 Ga0157380_105102842 198
233 3300014968 Ga0157379_10331825 Ga0157379_103318253 198
234 3300017792 Ga0163161_10027233 Ga0163161_100272336 198
235 3300017792 Ga0163161_10085616 Ga0163161_100856163 198
236 3300021384 Ga0213876_10040892 Ga0213876_100408922 198
237 3300025208 Ga0209436_104047 Ga0209436_1040473 198
238 3300025208 Ga0209436_106401 Ga0209436_1064014 198
239 3300025228 Ga0209672_101454 Ga0209672_1014548 198
240 3300025229 Ga0209147_101058 Ga0209147_1010584 198
241 3300025242 Ga0209258_100022 Ga0209258_100022393 198
242 3300025245 Ga0207425_1000180 Ga0207425_100018034 198
243 3300025245 Ga0207425_1020064 Ga0207425_10200642 198
244 3300025254 Ga0209148_1000034 Ga0209148_1000034393 198
245 3300025258 Ga0209129_1000111 Ga0209129_1000111123 198
246 3300025258 Ga0209129_1006271 Ga0209129_10062713 198
247 3300025263 Ga0209565_1000110 Ga0209565_100011035 198
248 3300025273 Ga0209673_1000175 Ga0209673_100017570 198
249 3300025273 Ga0209673_1000944 Ga0209673_100094423 198
250 3300025273 Ga0209673_1000992 Ga0209673_100099216 198
251 3300025273 Ga0209673_1001347 Ga0209673_10013474 198
252 3300025284 Ga0209130_1000205 Ga0209130_100020535 198
253 3300025284 Ga0209130_1000332 Ga0209130_100033221 198
254 3300025291 Ga0209675_1000192 Ga0209675_100019221 198
255 3300025291 Ga0209675_1008192 Ga0209675_10081923 198
256 3300025292 Ga0209676_1000005 Ga0209676_1000005309 198
257 3300025292 Ga0209676_1002061 Ga0209676_100206117 198
258 3300025294 Ga0209025_1000116 Ga0209025_1000116131 198
259 3300025294 Ga0209025_1023711 Ga0209025_10237114 198
260 3300025295 Ga0209564_1000155 Ga0209564_1000155131 198
261 3300025295 Ga0209564_1000298 Ga0209564_100029840 198
262 3300025297 Ga0209758_1000107 Ga0209758_1000107131 198
263 3300025297 Ga0209758_1005110 Ga0209758_10051103 198
264 3300025298 Ga0209050_1000007 Ga0209050_1000007788 198
265 3300025299 Ga0209256_1000038 Ga0209256_1000038171 198
266 3300025299 Ga0209256_1000087 Ga0209256_1000087131 198
267 3300025302 Ga0207426_1000090 Ga0207426_1000090122 198
268 3300025302 Ga0207426_1000123 Ga0207426_1000123131 198
269 3300025303 Ga0209051_1000009 Ga0209051_1000009309 198
270 3300025303 Ga0209051_1048741 Ga0209051_10487412 198
271 3300025304 Ga0209257_1000011 Ga0209257_1000011283 198
272 3300025304 Ga0209257_1000576 Ga0209257_100057627 198
273 3300025304 Ga0209257_1000870 Ga0209257_100087021 198
274 3300025315 Ga0207697_10034073 Ga0207697_100340732 198
275 3300025315 Ga0207697_10052654 Ga0207697_100526542 198
276 3300025321 Ga0207656_10010523 Ga0207656_100105234 198
277 3300025321 Ga0207656_10181002 Ga0207656_101810022 198
278 3300025899 Ga0207642_10400219 Ga0207642_104002191 198
279 3300025903 Ga0207680_10032467 Ga0207680_100324674 198
280 3300025907 Ga0207645_10303972 Ga0207645_103039721 198
281 3300025908 Ga0207643_10032288 Ga0207643_100322884 198
282 3300025909 Ga0207705_10314285 Ga0207705_103142852 198
283 3300025910 Ga0207684_10410931 Ga0207684_104109312 198
284 3300025911 Ga0207654_10188116 Ga0207654_101881163 198
285 3300025912 Ga0207707_10255621 Ga0207707_102556212 198
286 3300025913 Ga0207695_10025753 Ga0207695_100257536 198
287 3300025913 Ga0207695_10574016 Ga0207695_105740162 198
288 3300025919 Ga0207657_10000201 Ga0207657_1000020135 198
289 3300025919 Ga0207657_10052276 Ga0207657_100522761 198
290 3300025920 Ga0207649_10006211 Ga0207649_100062113 198
291 3300025920 Ga0207649_10369515 Ga0207649_103695152 198
292 3300025920 Ga0207649_10403106 Ga0207649_104031062 198
293 3300025923 Ga0207681_10019121 Ga0207681_100191213 198
294 3300025923 Ga0207681_10115541 Ga0207681_101155412 198
295 3300025923 Ga0207681_10155540 Ga0207681_101555402 198
296 3300025923 Ga0207681_10228189 Ga0207681_102281891 198
297 3300025923 Ga0207681_10369063 Ga0207681_103690632 198
298 3300025925 Ga0207650_10006140 Ga0207650_100061405 198
299 3300025925 Ga0207650_10017164 Ga0207650_100171644 198
300 3300025925 Ga0207650_10029450 Ga0207650_100294502 198
301 3300025925 Ga0207650_10383905 Ga0207650_103839051 198
302 3300025925 Ga0207650_10509929 Ga0207650_105099291 198
303 3300025926 Ga0207659_10083998 Ga0207659_100839981 198
304 3300025926 Ga0207659_10747143 Ga0207659_107471431 198
305 3300025926 Ga0207659_10977417 Ga0207659_109774171 198
306 3300025927 Ga0207687_10584343 Ga0207687_105843432 198
307 3300025931 Ga0207644_10002735 Ga0207644_100027354 198
308 3300025931 Ga0207644_10004293 Ga0207644_100042932 198
309 3300025931 Ga0207644_10101889 Ga0207644_101018892 198
310 3300025931 Ga0207644_10172496 Ga0207644_101724962 198
311 3300025931 Ga0207644_10241935 Ga0207644_102419351 198
312 3300025931 Ga0207644_10575779 Ga0207644_105757791 198
313 3300025932 Ga0207690_10002492 Ga0207690_100024923 198
314 3300025932 Ga0207690_10047341 Ga0207690_100473412 198
315 3300025933 Ga0207706_10000496 Ga0207706_1000049635 198
316 3300025933 Ga0207706_10058946 Ga0207706_100589463 198
317 3300025934 Ga0207686_10100325 Ga0207686_101003251 198
318 3300025934 Ga0207686_10199093 Ga0207686_101990931 198
319 3300025936 Ga0207670_10136427 Ga0207670_101364271 198
320 3300025936 Ga0207670_10345782 Ga0207670_103457822 198
321 3300025937 Ga0207669_10199445 Ga0207669_101994452 198
322 3300025938 Ga0207704_10249611 Ga0207704_102496112 198
323 3300025938 Ga0207704_10440789 Ga0207704_104407891 198
324 3300025940 Ga0207691_10005561 Ga0207691_1000556110 198
325 3300025940 Ga0207691_10014635 Ga0207691_100146354 198
326 3300025940 Ga0207691_10017171 Ga0207691_100171715 198
327 3300025940 Ga0207691_10039725 Ga0207691_100397255 198
328 3300025940 Ga0207691_10105928 Ga0207691_101059282 198
329 3300025942 Ga0207689_10026805 Ga0207689_100268054 198
330 3300025942 Ga0207689_10082911 Ga0207689_100829113 198
331 3300025942 Ga0207689_10548021 Ga0207689_105480212 198
332 3300025945 Ga0207679_10019626 Ga0207679_100196263 198
333 3300025945 Ga0207679_10023143 Ga0207679_100231433 198
334 3300025945 Ga0207679_10049806 Ga0207679_100498062 198
335 3300025945 Ga0207679_10490064 Ga0207679_104900642 198
336 3300025949 Ga0207667_10000500 Ga0207667_1000050058 198
337 3300025949 Ga0207667_10001476 Ga0207667_1000147623 198
338 3300025949 Ga0207667_10140983 Ga0207667_101409832 198
339 3300025949 Ga0207667_10576205 Ga0207667_105762052 198
340 3300025960 Ga0207651_10003545 Ga0207651_100035455 198
341 3300025960 Ga0207651_10034983 Ga0207651_100349831 198
342 3300025960 Ga0207651_10069534 Ga0207651_100695342 198
343 3300025960 Ga0207651_10099678 Ga0207651_100996782 198
344 3300025960 Ga0207651_10290826 Ga0207651_102908262 198
345 3300025972 Ga0207668_10013036 Ga0207668_100130364 198
346 3300025972 Ga0207668_10022698 Ga0207668_100226985 198
347 3300025981 Ga0207640_10444489 Ga0207640_104444892 198
348 3300025986 Ga0207658_10001039 Ga0207658_1000103912 198
349 3300025986 Ga0207658_10024644 Ga0207658_100246446 198
350 3300025986 Ga0207658_10067886 Ga0207658_100678864 198
351 3300025986 Ga0207658_10355132 Ga0207658_103551322 198
352 3300025986 Ga0207658_10836906 Ga0207658_108369061 198
353 3300026023 Ga0207677_10130259 Ga0207677_101302591 198
354 3300026023 Ga0207677_10309886 Ga0207677_103098862 198
355 3300026023 Ga0207677_10737763 Ga0207677_107377631 198
356 3300026035 Ga0207703_10033179 Ga0207703_100331794 198
357 3300026035 Ga0207703_10669550 Ga0207703_106695502 198
358 3300026035 Ga0207703_11211570 Ga0207703_112115701 198
359 3300026041 Ga0207639_10009805 Ga0207639_100098054 198
360 3300026041 Ga0207639_10115796 Ga0207639_101157962 198
361 3300026067 Ga0207678_10002559 Ga0207678_100025599 198
362 3300026075 Ga0207708_10188211 Ga0207708_101882112 198
363 3300026078 Ga0207702_10008538 Ga0207702_100085385 198
364 3300026088 Ga0207641_10390516 Ga0207641_103905161 198
365 3300026088 Ga0207641_10606402 Ga0207641_106064021 198
366 3300026088 Ga0207641_10974884 Ga0207641_109748841 198
367 3300026089 Ga0207648_10260819 Ga0207648_102608193 198
368 3300026089 Ga0207648_10350248 Ga0207648_103502481 198
369 3300026089 Ga0207648_10536704 Ga0207648_105367041 198
370 3300026089 Ga0207648_10555489 Ga0207648_105554892 198
371 3300026095 Ga0207676_10018416 Ga0207676_100184164 198
372 3300026095 Ga0207676_10036027 Ga0207676_100360272 198
373 3300026095 Ga0207676_10195354 Ga0207676_101953542 198
374 3300026095 Ga0207676_10685580 Ga0207676_106855801 198
375 3300026116 Ga0207674_10596788 Ga0207674_105967881 198
376 3300026116 Ga0207674_10655523 Ga0207674_106555232 198
377 3300026116 Ga0207674_10669204 Ga0207674_106692041 198
378 3300026118 Ga0207675_100077637 Ga0207675_1000776372 198
379 3300026118 Ga0207675_100197517 Ga0207675_1001975173 198
380 3300026118 Ga0207675_100346513 Ga0207675_1003465132 198
381 3300026118 Ga0207675_100829791 Ga0207675_1008297912 198
382 3300026121 Ga0207683_10587324 Ga0207683_105873242 198
383 3300026121 Ga0207683_10878805 Ga0207683_108788051 198
384 3300026121 Ga0207683_11132084 Ga0207683_111320841 198
385 3300026142 Ga0207698_10005482 Ga0207698_100054824 198
386 3300026142 Ga0207698_10103033 Ga0207698_101030332 198
387 3300026142 Ga0207698_10258018 Ga0207698_102580182 198
388 3300026142 Ga0207698_10840108 Ga0207698_108401081 198
389 3300026142 Ga0207698_10920678 Ga0207698_109206782 198
390 3300027552 Ga0209982_1024736 Ga0209982_10247362 198
391 3300027666 Ga0209282_1000058 Ga0209282_100005855 198
392 3300027876 Ga0209974_10065512 Ga0209974_100655122 198
393 3300027907 Ga0207428_10464857 Ga0207428_104648571 198
394 3300028379 Ga0268266_10193504 Ga0268266_101935041 198
395 3300028379 Ga0268266_10201610 Ga0268266_102016103 198
396 3300028379 Ga0268266_10720473 Ga0268266_107204732 198
397 3300028380 Ga0268265_10173695 Ga0268265_101736953 198
398 3300028381 Ga0268264_10086146 Ga0268264_100861462 198
399 3300028381 Ga0268264_10842091 Ga0268264_108420911 198
400 3300028381 Ga0268264_11264298 Ga0268264_112642981 198
401 3300031456 Ga0307513_10560870 Ga0307513_105608701 198
402 3300031548 Ga0307408_100127574 Ga0307408_1001275742 198
403 3300031730 Ga0307516_10134644 Ga0307516_101346442 198
404 3300031731 Ga0307405_10017876 Ga0307405_100178762 198
405 3300031731 Ga0307405_10085223 Ga0307405_100852233 198
406 3300031824 Ga0307413_10067651 Ga0307413_100676513 198
407 3300031852 Ga0307410_10053041 Ga0307410_100530413 198
408 3300031852 Ga0307410_10490375 Ga0307410_104903752 198
409 3300031903 Ga0307407_10621564 Ga0307407_106215642 198
410 3300031911 Ga0307412_10011034 Ga0307412_100110345 198
411 3300031911 Ga0307412_10208067 Ga0307412_102080672 198
412 3300032002 Ga0307416_100042037 Ga0307416_1000420374 198
413 3300032002 Ga0307416_100057756 Ga0307416_1000577563 198
414 3300032002 Ga0307416_100432724 Ga0307416_1004327242 198
415 3300032004 Ga0307414_10501565 Ga0307414_105015652 198
416 3300032005 Ga0307411_10003694 Ga0307411_100036949 198
417 3300032005 Ga0307411_10176984 Ga0307411_101769843 198
418 3300032126 Ga0307415_100018565 Ga0307415_1000185653 198
419 3300032126 Ga0307415_100218817 Ga0307415_1002188172 198
420 3300035121 Ga0373960_0099106 Ga0373960_0099106_229_867 198
421 3300035170 Ga0373943_0366324 Ga0373943_0366324_35_631 198
422 3300035241 Ga0373961_0050982 Ga0373961_0050982_522_1160 198
423 3300039437 Ga0436365_0448718 Ga0436365_0448718_765_1397 198
424 3300041512 Ga0451853_0749231 Ga0451853_0749231_1278_1874 198
425 3300042007 Ga0439449_0110807 Ga0439449_0110807_72_701 198
426 3300044658 Ga0466972_0081432 Ga0466972_0081432_583_1179 198
427 3300046460 Ga0495638_0031541 Ga0495638_0031541_129_767 198
428 3300046472 Ga0495580_0010452 Ga0495580_0010452_5987_6619 198
429 3300046474 Ga0495605_0002870 Ga0495605_0002870_3426_4022 198
430 3300046491 Ga0495584_0205475 Ga0495584_0205475_122_748 198
431 3300046499 Ga0495594_0042410 Ga0495594_0042410_407_1039 198
432 3300046500 Ga0495596_0000320 Ga0495596_0000320_3962_4558 198
433 3300046501 Ga0495607_0021980 Ga0495607_0021980_23_619 198
434 3300046512 Ga0495610_0000514 Ga0495610_0000514_34539_35135 198
435 3300046513 Ga0495616_0003256 Ga0495616_0003256_4554_5150 198
436 3300046513 Ga0495616_0005265 Ga0495616_0005265_5493_6131 198
437 3300046518 Ga0495631_0000455 Ga0495631_0000455_4751_5389 198
438 3300046520 Ga0495637_0037289 Ga0495637_0037289_759_1397 198
439 3300046524 Ga0495648_0012532 Ga0495648_0012532_3222_3818 198
440 3300046525 Ga0495663_0014664 Ga0495663_0014664_844_1482 198
441 3300046530 Ga0495654_0009970 Ga0495654_0009970_1207_1845 198
442 3300046539 Ga0495621_0008759 Ga0495621_0008759_2142_2780 198
443 3300046542 Ga0495597_0045030 Ga0495597_0045030_713_1309 198
444 3300046557 Ga0495622_0051809 Ga0495622_0051809_187_825 198
445 3300046616 Ga0495668_0114618 Ga0495668_0114618_682_1320 198
446 3300046660 Ga0495625_0022596 Ga0495625_0022596_4201_4797 198
447 3300046665 Ga0495661_0022023 Ga0495661_0022023_1870_2466 198
448 3300046674 Ga0495588_0040880 Ga0495588_0040880_654_1292 198
449 3300046684 Ga0495669_0146242 Ga0495669_0146242_77_673 198
450 3300046692 Ga0495671_0015635 Ga0495671_0015635_3287_3883 198
451 3300047317 Ga0495604_0003210 Ga0495604_0003210_7029_7661 198
452 3300047320 Ga0495672_0005431 Ga0495672_0005431_880_1476 198
453 3300047321 Ga0495676_0069981 Ga0495676_0069981_898_1536 198
454 3300047447 Ga0495685_117319 Ga0495685_117319_154_750 198
455 3300048089 Ga0495614_0006942 Ga0495614_0006942_4369_5007 198
456 3300048903 Ga0496100_0172526 Ga0496100_0172526_617_1213 198
457 3300048904 Ga0496101_0105844 Ga0496101_0105844_50_682 198
458 3300048905 Ga0496102_0003972 Ga0496102_0003972_10893_11621 198
459 3300048905 Ga0496102_0029946 Ga0496102_0029946_3634_4266 198
460 3300048906 Ga0496103_0007429 Ga0496103_0007429_296_1024 198
461 3300048908 Ga0496105_0102810 Ga0496105_0102810_1562_2194 198
462 3300048909 Ga0496106_0006216 Ga0496106_0006216_4390_5118 198
463 3300048909 Ga0496106_0295511 Ga0496106_0295511_408_1004 198
464 3300048910 Ga0496107_0072954 Ga0496107_0072954_25_744 198
465 3300048911 Ga0496108_0159255 Ga0496108_0159255_951_1547 198
466 3300048911 Ga0496108_0203755 Ga0496108_0203755_195_854 198
467 3300048911 Ga0496108_0344604 Ga0496108_0344604_522_1118 198
468 3300048912 Ga0496109_0394691 Ga0496109_0394691_413_1009 198
469 3300048913 Ga0496110_0145321 Ga0496110_0145321_26_754 198
470 3300048913 Ga0496110_0200361 Ga0496110_0200361_236_832 198
471 3300048913 Ga0496110_0249770 Ga0496110_0249770_641_1273 198
472 3300048914 Ga0496111_0210748 Ga0496111_0210748_182_814 198
473 3300048914 Ga0496111_0270018 Ga0496111_0270018_406_1044 198
474 3300048919 Ga0496116_0051071 Ga0496116_0051071_1470_2066 198
475 3300048920 Ga0496117_0049833 Ga0496117_0049833_1731_2369 198
476 3300048921 Ga0496118_0010450 Ga0496118_0010450_6212_6850 198
477 3300048924 Ga0496121_0068374 Ga0496121_0068374_541_1179 198
478 3300048925 Ga0496122_0007440 Ga0496122_0007440_4019_4615 198
479 3300048926 Ga0496123_0003848 Ga0496123_0003848_3380_3976 198
480 3300048927 Ga0496124_0040556 Ga0496124_0040556_2679_3317 198
481 3300048928 Ga0496125_0028991 Ga0496125_0028991_3577_4215 198
482 3300048928 Ga0496125_0106118 Ga0496125_0106118_1122_1718 198
483 3300048928 Ga0496125_0107460 Ga0496125_0107460_1092_1730 198
484 3300048929 Ga0496126_0164798 Ga0496126_0164798_523_1161 198
485 3300048929 Ga0496126_0215241 Ga0496126_0215241_938_1534 198
486 3300049568 Ga0501031_0006012 Ga0501031_0006012_1276_1872 198
487 3300049568 Ga0501031_0079890 Ga0501031_0079890_848_1444 198
488 3300049569 Ga0501032_0007188 Ga0501032_0007188_6691_7287 198
489 3300049569 Ga0501032_0188340 Ga0501032_0188340_145_741 198
490 3300049570 Ga0501033_0002494 Ga0501033_0002494_11706_12302 198
491 3300049570 Ga0501033_0010856 Ga0501033_0010856_2377_2973 198
492 3300049571 Ga0501034_0246253 Ga0501034_0246253_67_663 198
493 3300049572 Ga0501036_0001586 Ga0501036_0001586_10638_11234 198
494 3300049572 Ga0501036_0003940 Ga0501036_0003940_3660_4256 198
495 3300049572 Ga0501036_0308356 Ga0501036_0308356_661_1257 198
496 3300049573 Ga0501037_0097610 Ga0501037_0097610_1090_1686 198
497 3300049574 Ga0501038_0009918 Ga0501038_0009918_7895_8491 198
498 3300049574 Ga0501038_0009928 Ga0501038_0009928_1571_2167 198
499 3300049574 Ga0501038_0018946 Ga0501038_0018946_2279_2875 198
500 3300049575 Ga0501039_0075042 Ga0501039_0075042_471_1067 198
501 3300049575 Ga0501039_0238616 Ga0501039_0238616_146_742 198
502 3300049576 Ga0501040_0149646 Ga0501040_0149646_196_792 198
503 3300049577 Ga0501041_0203667 Ga0501041_0203667_451_1119 198
504 3300049578 Ga0501042_0058919 Ga0501042_0058919_856_1452 198
505 3300049579 Ga0501043_0031094 Ga0501043_0031094_372_968 198
506 3300049579 Ga0501043_0037196 Ga0501043_0037196_339_935 198
507 3300049579 Ga0501043_0075866 Ga0501043_0075866_2004_2600 198
508 3300049580 Ga0501046_0165121 Ga0501046_0165121_555_1151 198
509 3300049580 Ga0501046_0170478 Ga0501046_0170478_358_996 198
510 3300049581 Ga0501047_0020466 Ga0501047_0020466_3744_4340 198
511 3300049582 Ga0501048_0185479 Ga0501048_0185479_780_1376 198
512 3300049584 Ga0501068_0014654 Ga0501068_0014654_1448_2044 198
513 3300049584 Ga0501068_0300508 Ga0501068_0300508_274_912 198
514 3300049585 Ga0501069_0136491 Ga0501069_0136491_245_880 198
515 3300049586 Ga0501070_0200763 Ga0501070_0200763_875_1471 198
516 3300049587 Ga0501071_0028106 Ga0501071_0028106_2077_2745 198
517 3300049588 Ga0501072_0198079 Ga0501072_0198079_557_1195 198
518 3300049589 Ga0501073_0011183 Ga0501073_0011183_1598_2236 198
519 3300049591 Ga0501075_0053942 Ga0501075_0053942_308_976 198
520 3300049592 Ga0501076_0032459 Ga0501076_0032459_569_1207 198
521 3300049593 Ga0501077_0104164 Ga0501077_0104164_486_1124 198
522 3300049741 Ga0501079_0283958 Ga0501079_0283958_639_1277 198
523 3300049742 Ga0501080_0021094 Ga0501080_0021094_3939_4577 198
524 3300049743 Ga0501081_0186032 Ga0501081_0186032_156_824 198
525 3300049822 Ga0501035_0000504 Ga0501035_0000504_27710_28306 198
526 3300049822 Ga0501035_0107201 Ga0501035_0107201_1534_2130 198
527 3300049823 Ga0501044_0056622 Ga0501044_0056622_786_1382 198
528 3300049823 Ga0501044_0119489 Ga0501044_0119489_453_1049 198
529 3300049823 Ga0501044_0180569 Ga0501044_0180569_231_827 198
530 3300049824 Ga0501045_0078870 Ga0501045_0078870_493_1161 198
531 3300049824 Ga0501045_0124039 Ga0501045_0124039_55_693 198
532 3300050491 nmdc:mga00v17_1907_c1 nmdc:mga00v17_1907_c1_1946_2563 198
533 3300050511 nmdc:mga08y16_32273_c1 nmdc:mga08y16_32273_c1_1455_2051 198
534 3300050511 nmdc:mga08y16_491888_c1 nmdc:mga08y16_491888_c1_21_665 198
535 3300050512 nmdc:mga0n895_419762_c1 nmdc:mga0n895_419762_c1_128_748 198
536 3300053087 Ga0500643_004327 Ga0500643_004327_4712_5350 198
537 3300053093 Ga0500651_0000052 Ga0500651_0000052_67146_67784 198
538 3300053107 Ga0500560_157918 Ga0500560_157918_93_731 198
539 3300053110 Ga0500571_000036 Ga0500571_000036_21820_22458 198
540 3300053116 Ga0500592_014971 Ga0500592_014971_351_989 198
541 3300053133 Ga0500655_004623 Ga0500655_004623_1042_1680 198
542 3300053134 Ga0500658_0000033 Ga0500658_0000033_37639_38277 198
543 3300053134 Ga0500658_0000040 Ga0500658_0000040_57954_58592 198
544 3300053136 Ga0500559_0001653 Ga0500559_0001653_1634_2272 198
545 3300053141 Ga0500574_002546 Ga0500574_002546_132_770 198
546 3300053151 Ga0500604_0066626 Ga0500604_0066626_208_846 198
547 3300053153 Ga0500616_0038423 Ga0500616_0038423_1927_2565 198
548 3300053162 Ga0500638_010945 Ga0500638_010945_1041_1679 198
549 3300053177 Ga0500636_0050978 Ga0500636_0050978_231_869 198
550 3300059424 Ga0590075_062045 Ga0590075_062045_238_906 198
551 3300060353 Ga0501082_0035312 Ga0501082_0035312_3365_4003 198
552 3300061734 Ga0530510_0004976 Ga0530510_0004976_7899_8537 198
553 3300061734 Ga0530510_0306899 Ga0530510_0306899_548_1144 198
554 iso_pu_bacteria 2599185214 2599625965 198
555 iso_pu_bacteria 2599185226 2599674953 198
556 iso_pu_bacteria 2599185227 2599683847 198
557 iso_pu_bacteria 2599185229 2599695550 198
558 iso_pu_bacteria 2738541277 2738722411 198
559 iso_pu_bacteria 2738543019 2739282775 198
560 iso_pu_bacteria 2818991446 2819596185 198
561 iso_pu_bacteria 2831265667 2831270472 198
562 iso_pu_bacteria 2885198086 2885199687 198
563 iso_pu_bacteria 2885211737 2885213338 198
564 iso_pu_bacteria 2899924645 2899925566 198
565 iso_pu_bacteria 2928037797 2928038339 198
566 iso_pu_bacteria 2928044640 2928046056 198
567 iso_pu_bacteria 2928051484 2928053755 198
568 iso_pu_bacteria 2928064002 2928067298 198
569 iso_pu_bacteria 2928070936 2928076264 198
570 iso_pu_bacteria 2928084124 2928085209 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

29

212

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.806 2 198
4o6m-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) 0.7245 11 187
4q7c-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase 0.7216 8 187
4q7c-assembly1.cif.gz_B structure of af2299, a cdp-alcohol phosphotransferase 0.6986 8 188
4mnd-assembly1.cif.gz_A-2 crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein 0.6744 7 189
ID Description Score Start End Superfamily
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.928 2 195 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9241 1 184 1.20.120.1760
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9055 2 195 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8919 1 184 1.20.120.1760
af_Q58609_4_200_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8476 6 198 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A507CX03-F1-model_v4 RNA polymerase II transcription factor B subunit 2 0.9633 2 198 GO:0000439
GO:0001671
GO:0003690
GO:0005675
GO:0006289
GO:0008654
GO:0016020
GO:0016780
AF-A0A068S3H5-F1-model_v4 Pyruvate carboxylase 0.9611 2 91 GO:0005524
GO:0008654
GO:0016020
GO:0016780
GO:0016874
GO:0046872
AF-U9TLP1-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9569 3 198 GO:0008654
GO:0012505
GO:0016020
GO:0016780
AF-A0A1I3TDV0-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9566 1 197 GO:0008654
GO:0016020
GO:0016780
AF-A0A015LXI4-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9545 8 198 GO:0008654
GO:0012505
GO:0016020
GO:0016780

Feature Viewer

pLDDT pTM Quality
83.11 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map