F464833
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 570 | 307 | 552 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300025912|Ga0207707_10255621|Ga0207707_102556212 |
| Length | 224 |
| Sequence | MRRAHDTITLATMPASPSPPKHFSMVRSLHLADAFTLANAACGVAAVFCAMAYVAGQASAYYFAAAALAPAAFVFDVLDGRVARARRTHSALGRELDSLSDVISFGVAPAALGFAAGLRGGWDWVVLVYFVCCGVARLARYNVTAEALAGSSETGKVAYFEGTPIPTSVVLVAVLAFAAWRGRIGEQLWGGAWTIAFWDLHPLSLLFFVSGTLMISKTLRIPKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 2 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 3 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 4 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 5 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 6 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 7 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 8 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 9 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 10 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 11 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 12 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 13 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 14 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 15 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 16 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 17 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 18 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 19 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 20 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 21 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 22 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 27 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 28 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 207 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 208 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 251 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 252 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 293 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 294 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 295 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 297 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 298 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 300 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 302 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 304 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 305 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.67 |
| Metatranscriptomes | 0.18 |
| Isolates | 3.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.44 |
| Nodule | 0.35 |
| Rhizoplane | 4.21 |
| Rhizosphere | 74.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10044116 | 3300002075 | Bacteria | 906 |
| 2 | JGI25152J39213_1005172 | 3300002773 | Bacteria | 3895 |
| 3 | JGI25152J39213_1026926 | 3300002773 | Bacteria | 931 |
| 4 | JGI25150J39212_1003222 | 3300002774 | Bacteria | 3860 |
| 5 | JGI25159J45721_1007688 | 3300002987 | Bacteria | 3055 |
| 6 | JGI25159J45721_1007832 | 3300002987 | Bacteria | 3007 |
| 7 | JGI25151J46595_10009110 | 3300003187 | Bacteria | 4728 |
| 8 | JGI25151J46595_10021267 | 3300003187 | Bacteria | 2718 |
| 9 | JGI25153J46596_10009295 | 3300003215 | Bacteria | 4594 |
| 10 | JGI25153J46596_10018378 | 3300003215 | Bacteria | 2718 |
| 11 | JGI25160J50197_1006774 | 3300003354 | Bacteria | 4594 |
| 12 | JGI25160J50197_1059274 | 3300003354 | Bacteria | 772 |
| 13 | JGI25161J50226_1008700 | 3300003374 | Bacteria | 1533 |
| 14 | Ga0006562J51391_1114904 | 3300003578 | Bacteria | 2002 |
| 15 | Ga0055535_1000215 | 3300003761 | Bacteria | 61211 |
| 16 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 17 | Ga0055526_1012364 | 3300003771 | Bacteria | 3735 |
| 18 | Ga0055526_1012792 | 3300003771 | Bacteria | 3621 |
| 19 | Ga0055526_1015757 | 3300003771 | Bacteria | 3011 |
| 20 | Ga0055537_1003185 | 3300003773 | Bacteria | 5127 |
| 21 | Ga0055537_1003730 | 3300003773 | Bacteria | 4594 |
| 22 | Ga0055524_1005576 | 3300003775 | Bacteria | 5596 |
| 23 | Ga0055524_1007567 | 3300003775 | Bacteria | 4594 |
| 24 | Ga0055536_1000578 | 3300003781 | Bacteria | 24963 |
| 25 | Ga0055536_1021090 | 3300003781 | Bacteria | 1989 |
| 26 | Ga0055534_1003190 | 3300003784 | Bacteria | 5292 |
| 27 | Ga0055534_1003831 | 3300003784 | Bacteria | 4594 |
| 28 | Ga0055528_1010603 | 3300003790 | Bacteria | 3735 |
| 29 | Ga0055528_1013947 | 3300003790 | Bacteria | 3011 |
| 30 | Ga0055528_1027724 | 3300003790 | Bacteria | 1584 |
| 31 | Ga0055530_10001680 | 3300003791 | Bacteria | 15705 |
| 32 | Ga0055540_1010762 | 3300003792 | Bacteria | 3018 |
| 33 | Ga0055531_10005985 | 3300003794 | Bacteria | 6984 |
| 34 | Ga0055531_10011395 | 3300003794 | Bacteria | 4293 |
| 35 | Ga0055543_1000713 | 3300004625 | Bacteria | 16829 |
| 36 | Ga0055543_1002495 | 3300004625 | Bacteria | 6043 |
| 37 | Ga0065715_10351285 | 3300005293 | Bacteria | 950 |
| 38 | Ga0070676_10008322 | 3300005328 | Bacteria | 5589 |
| 39 | Ga0070676_10036105 | 3300005328 | Bacteria | 2846 |
| 40 | Ga0070676_10230154 | 3300005328 | Bacteria | 1228 |
| 41 | Ga0070676_10568601 | 3300005328 | Bacteria | 814 |
| 42 | Ga0070683_100579916 | 3300005329 | Bacteria | 1073 |
| 43 | Ga0070670_100008808 | 3300005331 | Bacteria | 8614 |
| 44 | Ga0070670_100023082 | 3300005331 | Bacteria | 5353 |
| 45 | Ga0070670_100285927 | 3300005331 | Bacteria | 1440 |
| 46 | Ga0070670_100619834 | 3300005331 | Bacteria | 969 |
| 47 | Ga0068869_100023750 | 3300005334 | Bacteria | 4240 |
| 48 | Ga0068869_100092707 | 3300005334 | Bacteria | 2274 |
| 49 | Ga0068869_100206058 | 3300005334 | Bacteria | 1553 |
| 50 | Ga0068869_100485120 | 3300005334 | Bacteria | 1030 |
| 51 | Ga0070666_10025732 | 3300005335 | Bacteria | 3839 |
| 52 | Ga0070666_10233307 | 3300005335 | Bacteria | 1300 |
| 53 | Ga0070666_10270503 | 3300005335 | Bacteria | 1206 |
| 54 | Ga0070680_100287688 | 3300005336 | Bacteria | 1393 |
| 55 | Ga0068868_100566571 | 3300005338 | Bacteria | 1003 |
| 56 | Ga0070660_100002628 | 3300005339 | Bacteria | 12345 |
| 57 | Ga0070660_100044972 | 3300005339 | Bacteria | 3378 |
| 58 | Ga0070660_100435218 | 3300005339 | Bacteria | 1087 |
| 59 | Ga0070689_100206507 | 3300005340 | Bacteria | 1606 |
| 60 | Ga0070689_100273707 | 3300005340 | Bacteria | 1399 |
| 61 | Ga0070661_100025620 | 3300005344 | Bacteria | 4240 |
| 62 | Ga0070661_100397649 | 3300005344 | Bacteria | 1089 |
| 63 | Ga0070692_10126173 | 3300005345 | Bacteria | 1433 |
| 64 | Ga0070668_100003929 | 3300005347 | Bacteria | 10981 |
| 65 | Ga0070668_100013810 | 3300005347 | Bacteria | 6033 |
| 66 | Ga0070668_100050415 | 3300005347 | Bacteria | 3205 |
| 67 | Ga0070668_100183049 | 3300005347 | Bacteria | 1712 |
| 68 | Ga0070669_100054722 | 3300005353 | Bacteria | 2923 |
| 69 | Ga0070669_100086410 | 3300005353 | Bacteria | 2343 |
| 70 | Ga0070669_100116018 | 3300005353 | Bacteria | 2037 |
| 71 | Ga0070675_100026499 | 3300005354 | Bacteria | 4653 |
| 72 | Ga0070675_100046336 | 3300005354 | Bacteria | 3560 |
| 73 | Ga0070675_100166225 | 3300005354 | Bacteria | 1900 |
| 74 | Ga0070675_100333740 | 3300005354 | Bacteria | 1342 |
| 75 | Ga0070675_100413723 | 3300005354 | Bacteria | 1205 |
| 76 | Ga0070671_100007502 | 3300005355 | Bacteria | 8718 |
| 77 | Ga0070671_100009794 | 3300005355 | Bacteria | 7692 |
| 78 | Ga0070671_100011383 | 3300005355 | Bacteria | 7151 |
| 79 | Ga0070671_100157843 | 3300005355 | Bacteria | 1917 |
| 80 | Ga0070671_100342983 | 3300005355 | Bacteria | 1274 |
| 81 | Ga0070674_100107777 | 3300005356 | Bacteria | 2040 |
| 82 | Ga0070674_100653746 | 3300005356 | Bacteria | 894 |
| 83 | Ga0070673_100001049 | 3300005364 | Bacteria | 15701 |
| 84 | Ga0070673_100098744 | 3300005364 | Bacteria | 2401 |
| 85 | Ga0070673_100369554 | 3300005364 | Bacteria | 1277 |
| 86 | Ga0070673_100516486 | 3300005364 | Bacteria | 1082 |
| 87 | Ga0070667_100001066 | 3300005367 | Bacteria | 25082 |
| 88 | Ga0070667_100035617 | 3300005367 | Bacteria | 4171 |
| 89 | Ga0070667_100177039 | 3300005367 | Bacteria | 1885 |
| 90 | Ga0070667_100209593 | 3300005367 | Bacteria | 1732 |
| 91 | Ga0070667_100339828 | 3300005367 | Bacteria | 1358 |
| 92 | Ga0070667_100539228 | 3300005367 | Bacteria | 1072 |
| 93 | Ga0070700_100144491 | 3300005441 | Bacteria | 1620 |
| 94 | Ga0070663_100004830 | 3300005455 | Bacteria | 7945 |
| 95 | Ga0070663_100220453 | 3300005455 | Bacteria | 1489 |
| 96 | Ga0070678_100241849 | 3300005456 | Bacteria | 1509 |
| 97 | Ga0070662_100000724 | 3300005457 | Bacteria | 20163 |
| 98 | Ga0070681_10018097 | 3300005458 | Bacteria | 7044 |
| 99 | Ga0070681_10131011 | 3300005458 | Bacteria | 2440 |
| 100 | Ga0070681_10192507 | 3300005458 | Bacteria | 1959 |
| 101 | Ga0068867_100104685 | 3300005459 | Bacteria | 2166 |
| 102 | Ga0068867_100177457 | 3300005459 | Bacteria | 1691 |
| 103 | Ga0068867_100192918 | 3300005459 | Bacteria | 1626 |
| 104 | Ga0068867_101098229 | 3300005459 | Bacteria | 726 |
| 105 | Ga0070685_10076877 | 3300005466 | Bacteria | 1992 |
| 106 | Ga0070706_100007578 | 3300005467 | Bacteria | 10162 |
| 107 | Ga0070699_100487787 | 3300005518 | Bacteria | 1119 |
| 108 | Ga0070679_100135171 | 3300005530 | Bacteria | 2447 |
| 109 | Ga0070679_100698496 | 3300005530 | Bacteria | 957 |
| 110 | Ga0070697_100047801 | 3300005536 | Bacteria | 3469 |
| 111 | Ga0068853_100006046 | 3300005539 | Bacteria | 9577 |
| 112 | Ga0068853_100378989 | 3300005539 | Bacteria | 1321 |
| 113 | Ga0070672_100002831 | 3300005543 | Bacteria | 11117 |
| 114 | Ga0070672_100086789 | 3300005543 | Bacteria | 2517 |
| 115 | Ga0070672_100320512 | 3300005543 | Bacteria | 1317 |
| 116 | Ga0070672_100343314 | 3300005543 | Bacteria | 1272 |
| 117 | Ga0070695_100506115 | 3300005545 | Bacteria | 935 |
| 118 | Ga0070696_100169924 | 3300005546 | Bacteria | 1611 |
| 119 | Ga0070696_100281066 | 3300005546 | Bacteria | 1269 |
| 120 | Ga0070696_100696538 | 3300005546 | Bacteria | 828 |
| 121 | Ga0070696_100971563 | 3300005546 | Bacteria | 708 |
| 122 | Ga0070665_100021536 | 3300005548 | Bacteria | 6480 |
| 123 | Ga0070665_100261752 | 3300005548 | Bacteria | 1731 |
| 124 | Ga0070665_100349417 | 3300005548 | Bacteria | 1484 |
| 125 | Ga0070704_100396582 | 3300005549 | Bacteria | 1176 |
| 126 | Ga0068855_100000749 | 3300005563 | Bacteria | 39863 |
| 127 | Ga0068855_100047855 | 3300005563 | Bacteria | 5051 |
| 128 | Ga0068855_100116319 | 3300005563 | Unclassified | 3065 |
| 129 | Ga0070664_100005769 | 3300005564 | Bacteria | 9984 |
| 130 | Ga0068856_100004974 | 3300005614 | Bacteria | 13157 |
| 131 | Ga0068856_100185499 | 3300005614 | Bacteria | 2094 |
| 132 | Ga0068852_100048873 | 3300005616 | Bacteria | 3616 |
| 133 | Ga0068852_100081952 | 3300005616 | Bacteria | 2866 |
| 134 | Ga0068852_100300425 | 3300005616 | Bacteria | 1554 |
| 135 | Ga0068859_100202118 | 3300005617 | Bacteria | 2072 |
| 136 | Ga0068859_100322772 | 3300005617 | Bacteria | 1638 |
| 137 | Ga0068859_100676129 | 3300005617 | Bacteria | 1124 |
| 138 | Ga0068859_101139887 | 3300005617 | Bacteria | 858 |
| 139 | Ga0068864_100012696 | 3300005618 | Bacteria | 6962 |
| 140 | Ga0068864_100034572 | 3300005618 | Bacteria | 4300 |
| 141 | Ga0068864_100042324 | 3300005618 | Bacteria | 3898 |
| 142 | Ga0068864_100457059 | 3300005618 | Bacteria | 1222 |
| 143 | Ga0068861_100293946 | 3300005719 | Bacteria | 1404 |
| 144 | Ga0068851_10001981 | 3300005834 | Bacteria | 9004 |
| 145 | Ga0068851_10208675 | 3300005834 | Bacteria | 1093 |
| 146 | Ga0068870_10024912 | 3300005840 | Bacteria | 2965 |
| 147 | Ga0068870_10445290 | 3300005840 | Bacteria | 853 |
| 148 | Ga0068863_100002825 | 3300005841 | Bacteria | 17197 |
| 149 | Ga0068863_100091698 | 3300005841 | Bacteria | 2882 |
| 150 | Ga0068858_100011569 | 3300005842 | Bacteria | 8324 |
| 151 | Ga0068858_100046470 | 3300005842 | Bacteria | 4024 |
| 152 | Ga0068858_100147675 | 3300005842 | Bacteria | 2209 |
| 153 | Ga0068860_100317181 | 3300005843 | Bacteria | 1529 |
| 154 | Ga0068862_100025443 | 3300005844 | Bacteria | 4970 |
| 155 | Ga0068862_100078706 | 3300005844 | Bacteria | 2857 |
| 156 | Ga0075364_10000107 | 3300006051 | Bacteria | 33968 |
| 157 | Ga0097621_100041684 | 3300006237 | Bacteria | 3696 |
| 158 | Ga0068871_100090612 | 3300006358 | Bacteria | 2547 |
| 159 | Ga0068871_100161756 | 3300006358 | Bacteria | 1915 |
| 160 | Ga0068871_100700449 | 3300006358 | Bacteria | 928 |
| 161 | Ga0075428_100438523 | 3300006844 | Bacteria | 1399 |
| 162 | Ga0068865_100050394 | 3300006881 | Bacteria | 2876 |
| 163 | Ga0068865_100095393 | 3300006881 | Bacteria | 2167 |
| 164 | Ga0068865_100115795 | 3300006881 | Bacteria | 1985 |
| 165 | Ga0097620_100202111 | 3300006931 | Bacteria | 2072 |
| 166 | Ga0097620_100322756 | 3300006931 | Bacteria | 1638 |
| 167 | Ga0097620_100676087 | 3300006931 | Bacteria | 1124 |
| 168 | Ga0097620_101140201 | 3300006931 | Bacteria | 858 |
| 169 | Ga0099826_10000039 | 3300006948 | Bacteria | 99286 |
| 170 | Ga0105240_10012576 | 3300009093 | Bacteria | 11676 |
| 171 | Ga0105240_10381135 | 3300009093 | Bacteria | 1593 |
| 172 | Ga0111539_10349982 | 3300009094 | Bacteria | 1719 |
| 173 | Ga0111539_10714671 | 3300009094 | Bacteria | 1166 |
| 174 | Ga0105245_11333065 | 3300009098 | Bacteria | 767 |
| 175 | Ga0105241_10643569 | 3300009174 | Bacteria | 962 |
| 176 | Ga0105242_10126830 | 3300009176 | Bacteria | 2197 |
| 177 | Ga0105242_10259339 | 3300009176 | Bacteria | 1570 |
| 178 | Ga0105248_10003557 | 3300009177 | Bacteria | 17271 |
| 179 | Ga0105248_10029588 | 3300009177 | Bacteria | 6111 |
| 180 | Ga0105237_10758638 | 3300009545 | Bacteria | 977 |
| 181 | Ga0105249_10669640 | 3300009553 | Bacteria | 1096 |
| 182 | Ga0157373_10001690 | 3300013100 | Bacteria | 16830 |
| 183 | Ga0157371_10001950 | 3300013102 | Bacteria | 20519 |
| 184 | Ga0157370_10232194 | 3300013104 | Bacteria | 1707 |
| 185 | Ga0157369_10045759 | 3300013105 | Bacteria | 4757 |
| 186 | Ga0157369_10290232 | 3300013105 | Bacteria | 1703 |
| 187 | Ga0157374_10109724 | 3300013296 | Bacteria | 2653 |
| 188 | Ga0157374_10536488 | 3300013296 | Bacteria | 1177 |
| 189 | Ga0157378_10016528 | 3300013297 | Bacteria | 6463 |
| 190 | Ga0157378_10086122 | 3300013297 | Bacteria | 2848 |
| 191 | Ga0157378_10140651 | 3300013297 | Bacteria | 2241 |
| 192 | Ga0163162_10011523 | 3300013306 | Bacteria | 8623 |
| 193 | Ga0163162_10099274 | 3300013306 | Bacteria | 3002 |
| 194 | Ga0163162_10101891 | 3300013306 | Bacteria | 2964 |
| 195 | Ga0163162_10259562 | 3300013306 | Bacteria | 1869 |
| 196 | Ga0163162_10639744 | 3300013306 | Bacteria | 1188 |
| 197 | Ga0163162_11496986 | 3300013306 | Bacteria | 769 |
| 198 | Ga0157372_10003134 | 3300013307 | Bacteria | 17821 |
| 199 | Ga0157372_10729886 | 3300013307 | Bacteria | 1152 |
| 200 | Ga0157372_10735506 | 3300013307 | Bacteria | 1147 |
| 201 | Ga0157375_10022086 | 3300013308 | Bacteria | 5853 |
| 202 | Ga0157375_10056119 | 3300013308 | Bacteria | 3887 |
| 203 | Ga0157375_10144486 | 3300013308 | Bacteria | 2509 |
| 204 | Ga0157375_10280024 | 3300013308 | Bacteria | 1831 |
| 205 | Ga0157375_10591056 | 3300013308 | Bacteria | 1270 |
| 206 | Ga0163163_10009902 | 3300014325 | Bacteria | 8544 |
| 207 | Ga0157380_10147751 | 3300014326 | Bacteria | 2028 |
| 208 | Ga0157380_10221739 | 3300014326 | Bacteria | 1692 |
| 209 | Ga0157380_10231188 | 3300014326 | Bacteria | 1661 |
| 210 | Ga0157380_10510284 | 3300014326 | Bacteria | 1170 |
| 211 | Ga0157379_10007873 | 3300014968 | Bacteria | 9233 |
| 212 | Ga0157379_10331825 | 3300014968 | Bacteria | 1390 |
| 213 | Ga0163161_10027233 | 3300017792 | Bacteria | 4054 |
| 214 | Ga0163161_10085616 | 3300017792 | Bacteria | 2325 |
| 215 | Ga0213876_10040892 | 3300021384 | Bacteria | 2449 |
| 216 | Ga0209436_104047 | 3300025208 | Bacteria | 3704 |
| 217 | Ga0209436_106401 | 3300025208 | Bacteria | 2582 |
| 218 | Ga0209672_101454 | 3300025228 | Bacteria | 8432 |
| 219 | Ga0209147_101058 | 3300025229 | Bacteria | 11630 |
| 220 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 221 | Ga0207425_1000180 | 3300025245 | Bacteria | 52117 |
| 222 | Ga0207425_1020064 | 3300025245 | Bacteria | 1433 |
| 223 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 224 | Ga0209129_1000111 | 3300025258 | Bacteria | 148853 |
| 225 | Ga0209129_1006271 | 3300025258 | Bacteria | 3913 |
| 226 | Ga0209565_1000110 | 3300025263 | Bacteria | 119879 |
| 227 | Ga0209673_1000175 | 3300025273 | Bacteria | 131239 |
| 228 | Ga0209673_1000944 | 3300025273 | Bacteria | 36333 |
| 229 | Ga0209673_1000992 | 3300025273 | Bacteria | 34667 |
| 230 | Ga0209673_1001347 | 3300025273 | Bacteria | 24544 |
| 231 | Ga0209130_1000205 | 3300025284 | Bacteria | 79260 |
| 232 | Ga0209130_1000332 | 3300025284 | Bacteria | 54263 |
| 233 | Ga0209675_1000192 | 3300025291 | Bacteria | 66905 |
| 234 | Ga0209675_1008192 | 3300025291 | Bacteria | 3882 |
| 235 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 236 | Ga0209676_1002061 | 3300025292 | Bacteria | 15661 |
| 237 | Ga0209025_1000116 | 3300025294 | Bacteria | 218293 |
| 238 | Ga0209025_1023711 | 3300025294 | Bacteria | 3195 |
| 239 | Ga0209564_1000155 | 3300025295 | Bacteria | 165859 |
| 240 | Ga0209564_1000298 | 3300025295 | Bacteria | 99805 |
| 241 | Ga0209758_1000107 | 3300025297 | Bacteria | 218293 |
| 242 | Ga0209758_1005110 | 3300025297 | Bacteria | 10382 |
| 243 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 244 | Ga0209256_1000038 | 3300025299 | Bacteria | 375225 |
| 245 | Ga0209256_1000087 | 3300025299 | Bacteria | 218290 |
| 246 | Ga0207426_1000090 | 3300025302 | Bacteria | 280662 |
| 247 | Ga0207426_1000123 | 3300025302 | Bacteria | 218290 |
| 248 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 249 | Ga0209051_1048741 | 3300025303 | Bacteria | 1433 |
| 250 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 251 | Ga0209257_1000576 | 3300025304 | Bacteria | 61751 |
| 252 | Ga0209257_1000870 | 3300025304 | Bacteria | 42856 |
| 253 | Ga0207697_10034073 | 3300025315 | Bacteria | 2085 |
| 254 | Ga0207697_10052654 | 3300025315 | Bacteria | 1685 |
| 255 | Ga0207656_10010523 | 3300025321 | Bacteria | 3470 |
| 256 | Ga0207656_10181002 | 3300025321 | Bacteria | 1012 |
| 257 | Ga0207642_10400219 | 3300025899 | Bacteria | 821 |
| 258 | Ga0207680_10032467 | 3300025903 | Bacteria | 2968 |
| 259 | Ga0207680_10252236 | 3300025903 | Bacteria | 1219 |
| 260 | Ga0207645_10303972 | 3300025907 | Bacteria | 1062 |
| 261 | Ga0207643_10032288 | 3300025908 | Bacteria | 2924 |
| 262 | Ga0207643_10201695 | 3300025908 | Bacteria | 1211 |
| 263 | Ga0207705_10314285 | 3300025909 | Bacteria | 1203 |
| 264 | Ga0207684_10410931 | 3300025910 | Bacteria | 1163 |
| 265 | Ga0207654_10188116 | 3300025911 | Bacteria | 1351 |
| 266 | Ga0207707_10255621 | 3300025912 | Bacteria | 1521 |
| 267 | Ga0207695_10025753 | 3300025913 | Bacteria | 6577 |
| 268 | Ga0207695_10574016 | 3300025913 | Bacteria | 1009 |
| 269 | Ga0207657_10000201 | 3300025919 | Bacteria | 62212 |
| 270 | Ga0207657_10052276 | 3300025919 | Bacteria | 3546 |
| 271 | Ga0207649_10006211 | 3300025920 | Bacteria | 6487 |
| 272 | Ga0207649_10369515 | 3300025920 | Bacteria | 1066 |
| 273 | Ga0207649_10403106 | 3300025920 | Bacteria | 1024 |
| 274 | Ga0207681_10019121 | 3300025923 | Bacteria | 4325 |
| 275 | Ga0207681_10050063 | 3300025923 | Bacteria | 2826 |
| 276 | Ga0207681_10115541 | 3300025923 | Bacteria | 1959 |
| 277 | Ga0207681_10155540 | 3300025923 | Bacteria | 1718 |
| 278 | Ga0207681_10228189 | 3300025923 | Bacteria | 1444 |
| 279 | Ga0207681_10369063 | 3300025923 | Bacteria | 1153 |
| 280 | Ga0207650_10006140 | 3300025925 | Bacteria | 8187 |
| 281 | Ga0207650_10017164 | 3300025925 | Bacteria | 5066 |
| 282 | Ga0207650_10029450 | 3300025925 | Bacteria | 3947 |
| 283 | Ga0207650_10383905 | 3300025925 | Bacteria | 1160 |
| 284 | Ga0207650_10509929 | 3300025925 | Bacteria | 1006 |
| 285 | Ga0207650_10691889 | 3300025925 | Bacteria | 861 |
| 286 | Ga0207659_10083998 | 3300025926 | Bacteria | 2362 |
| 287 | Ga0207659_10312752 | 3300025926 | Bacteria | 1294 |
| 288 | Ga0207659_10747143 | 3300025926 | Bacteria | 839 |
| 289 | Ga0207659_10977417 | 3300025926 | Bacteria | 728 |
| 290 | Ga0207687_10584343 | 3300025927 | Bacteria | 940 |
| 291 | Ga0207644_10002735 | 3300025931 | Bacteria | 11356 |
| 292 | Ga0207644_10004293 | 3300025931 | Bacteria | 9252 |
| 293 | Ga0207644_10101889 | 3300025931 | Bacteria | 2158 |
| 294 | Ga0207644_10172496 | 3300025931 | Bacteria | 1690 |
| 295 | Ga0207644_10241935 | 3300025931 | Bacteria | 1437 |
| 296 | Ga0207644_10575779 | 3300025931 | Bacteria | 933 |
| 297 | Ga0207690_10002492 | 3300025932 | Bacteria | 11129 |
| 298 | Ga0207690_10047341 | 3300025932 | Bacteria | 2853 |
| 299 | Ga0207690_10091164 | 3300025932 | Bacteria | 2154 |
| 300 | Ga0207706_10000496 | 3300025933 | Bacteria | 41991 |
| 301 | Ga0207706_10058946 | 3300025933 | Bacteria | 3381 |
| 302 | Ga0207706_10816890 | 3300025933 | Bacteria | 791 |
| 303 | Ga0207686_10100325 | 3300025934 | Bacteria | 1931 |
| 304 | Ga0207686_10199093 | 3300025934 | Bacteria | 1433 |
| 305 | Ga0207670_10136427 | 3300025936 | Bacteria | 1804 |
| 306 | Ga0207670_10345782 | 3300025936 | Bacteria | 1177 |
| 307 | Ga0207669_10199445 | 3300025937 | Bacteria | 1451 |
| 308 | Ga0207704_10249611 | 3300025938 | Bacteria | 1331 |
| 309 | Ga0207704_10440789 | 3300025938 | Bacteria | 1037 |
| 310 | Ga0207691_10005561 | 3300025940 | Bacteria | 12175 |
| 311 | Ga0207691_10014635 | 3300025940 | Bacteria | 7479 |
| 312 | Ga0207691_10017171 | 3300025940 | Bacteria | 6865 |
| 313 | Ga0207691_10039725 | 3300025940 | Bacteria | 4352 |
| 314 | Ga0207691_10105928 | 3300025940 | Bacteria | 2505 |
| 315 | Ga0207689_10026805 | 3300025942 | Bacteria | 4826 |
| 316 | Ga0207689_10082911 | 3300025942 | Bacteria | 2636 |
| 317 | Ga0207689_10548021 | 3300025942 | Bacteria | 971 |
| 318 | Ga0207679_10019626 | 3300025945 | Bacteria | 4545 |
| 319 | Ga0207679_10023143 | 3300025945 | Bacteria | 4243 |
| 320 | Ga0207679_10049806 | 3300025945 | Bacteria | 3058 |
| 321 | Ga0207679_10490064 | 3300025945 | Bacteria | 1095 |
| 322 | Ga0207667_10000500 | 3300025949 | Bacteria | 51747 |
| 323 | Ga0207667_10001476 | 3300025949 | Bacteria | 29509 |
| 324 | Ga0207667_10140983 | 3300025949 | Bacteria | 2482 |
| 325 | Ga0207667_10576205 | 3300025949 | Bacteria | 1137 |
| 326 | Ga0207651_10003545 | 3300025960 | Bacteria | 7669 |
| 327 | Ga0207651_10034983 | 3300025960 | Bacteria | 3260 |
| 328 | Ga0207651_10069534 | 3300025960 | Bacteria | 2486 |
| 329 | Ga0207651_10099678 | 3300025960 | Bacteria | 2152 |
| 330 | Ga0207651_10290826 | 3300025960 | Bacteria | 1355 |
| 331 | Ga0207668_10013036 | 3300025972 | Bacteria | 5106 |
| 332 | Ga0207668_10022698 | 3300025972 | Bacteria | 4022 |
| 333 | Ga0207640_10444489 | 3300025981 | Bacteria | 1067 |
| 334 | Ga0207658_10001039 | 3300025986 | Bacteria | 22553 |
| 335 | Ga0207658_10024644 | 3300025986 | Bacteria | 4211 |
| 336 | Ga0207658_10067886 | 3300025986 | Bacteria | 2688 |
| 337 | Ga0207658_10355132 | 3300025986 | Bacteria | 1277 |
| 338 | Ga0207658_10836906 | 3300025986 | Bacteria | 836 |
| 339 | Ga0207677_10130259 | 3300026023 | Bacteria | 1908 |
| 340 | Ga0207677_10309886 | 3300026023 | Bacteria | 1307 |
| 341 | Ga0207677_10737763 | 3300026023 | Bacteria | 877 |
| 342 | Ga0207703_10033179 | 3300026035 | Bacteria | 4090 |
| 343 | Ga0207703_10401256 | 3300026035 | Bacteria | 1272 |
| 344 | Ga0207703_10669550 | 3300026035 | Bacteria | 985 |
| 345 | Ga0207703_11211570 | 3300026035 | Bacteria | 726 |
| 346 | Ga0207639_10009805 | 3300026041 | Bacteria | 6619 |
| 347 | Ga0207639_10115796 | 3300026041 | Bacteria | 2193 |
| 348 | Ga0207678_10002559 | 3300026067 | Bacteria | 16569 |
| 349 | Ga0207708_10009866 | 3300026075 | Bacteria | 7088 |
| 350 | Ga0207708_10188211 | 3300026075 | Bacteria | 1642 |
| 351 | Ga0207702_10008538 | 3300026078 | Bacteria | 8633 |
| 352 | Ga0207702_10100423 | 3300026078 | Bacteria | 2553 |
| 353 | Ga0207641_10390516 | 3300026088 | Bacteria | 1335 |
| 354 | Ga0207641_10606402 | 3300026088 | Bacteria | 1072 |
| 355 | Ga0207641_10974884 | 3300026088 | Bacteria | 844 |
| 356 | Ga0207648_10169558 | 3300026089 | Bacteria | 1929 |
| 357 | Ga0207648_10260819 | 3300026089 | Bacteria | 1546 |
| 358 | Ga0207648_10350248 | 3300026089 | Bacteria | 1331 |
| 359 | Ga0207648_10536704 | 3300026089 | Bacteria | 1073 |
| 360 | Ga0207648_10555489 | 3300026089 | Bacteria | 1055 |
| 361 | Ga0207676_10018416 | 3300026095 | Bacteria | 5075 |
| 362 | Ga0207676_10036027 | 3300026095 | Bacteria | 3761 |
| 363 | Ga0207676_10195354 | 3300026095 | Bacteria | 1784 |
| 364 | Ga0207676_10685580 | 3300026095 | Bacteria | 991 |
| 365 | Ga0207674_10596788 | 3300026116 | Bacteria | 1067 |
| 366 | Ga0207674_10655523 | 3300026116 | Bacteria | 1014 |
| 367 | Ga0207674_10669204 | 3300026116 | Bacteria | 1002 |
| 368 | Ga0207675_100077637 | 3300026118 | Bacteria | 3111 |
| 369 | Ga0207675_100197517 | 3300026118 | Bacteria | 1931 |
| 370 | Ga0207675_100346513 | 3300026118 | Bacteria | 1455 |
| 371 | Ga0207675_100829791 | 3300026118 | Bacteria | 939 |
| 372 | Ga0207683_10587324 | 3300026121 | Bacteria | 1031 |
| 373 | Ga0207683_10878805 | 3300026121 | Bacteria | 832 |
| 374 | Ga0207683_11132084 | 3300026121 | Bacteria | 726 |
| 375 | Ga0207698_10005482 | 3300026142 | Bacteria | 7850 |
| 376 | Ga0207698_10103033 | 3300026142 | Bacteria | 2371 |
| 377 | Ga0207698_10258018 | 3300026142 | Bacteria | 1600 |
| 378 | Ga0207698_10840108 | 3300026142 | Bacteria | 923 |
| 379 | Ga0207698_10920678 | 3300026142 | Bacteria | 882 |
| 380 | Ga0209982_1024736 | 3300027552 | Bacteria | 932 |
| 381 | Ga0209282_1000058 | 3300027666 | Bacteria | 99152 |
| 382 | Ga0209974_10065512 | 3300027876 | Bacteria | 1234 |
| 383 | Ga0207428_10343882 | 3300027907 | Bacteria | 1098 |
| 384 | Ga0207428_10464857 | 3300027907 | Bacteria | 921 |
| 385 | Ga0268266_10035565 | 3300028379 | Bacteria | 4238 |
| 386 | Ga0268266_10193504 | 3300028379 | Bacteria | 1858 |
| 387 | Ga0268266_10201610 | 3300028379 | Bacteria | 1821 |
| 388 | Ga0268266_10720473 | 3300028379 | Bacteria | 962 |
| 389 | Ga0268265_10173695 | 3300028380 | Bacteria | 1844 |
| 390 | Ga0268264_10086146 | 3300028381 | Bacteria | 2698 |
| 391 | Ga0268264_10842091 | 3300028381 | Bacteria | 918 |
| 392 | Ga0268264_11264298 | 3300028381 | Bacteria | 748 |
| 393 | Ga0307513_10560870 | 3300031456 | Bacteria | 854 |
| 394 | Ga0307408_100127574 | 3300031548 | Bacteria | 1980 |
| 395 | Ga0307516_10134644 | 3300031730 | Bacteria | 2247 |
| 396 | Ga0307405_10017876 | 3300031731 | Bacteria | 3901 |
| 397 | Ga0307405_10085223 | 3300031731 | Bacteria | 2076 |
| 398 | Ga0307413_10067651 | 3300031824 | Bacteria | 2234 |
| 399 | Ga0307410_10053041 | 3300031852 | Bacteria | 2742 |
| 400 | Ga0307410_10490375 | 3300031852 | Bacteria | 1009 |
| 401 | Ga0307407_10621564 | 3300031903 | Bacteria | 806 |
| 402 | Ga0307412_10011034 | 3300031911 | Bacteria | 5221 |
| 403 | Ga0307412_10208067 | 3300031911 | Bacteria | 1491 |
| 404 | Ga0307416_100042037 | 3300032002 | Bacteria | 3565 |
| 405 | Ga0307416_100057756 | 3300032002 | Bacteria | 3141 |
| 406 | Ga0307416_100432724 | 3300032002 | Bacteria | 1363 |
| 407 | Ga0307414_10501565 | 3300032004 | Bacteria | 1074 |
| 408 | Ga0307414_11004896 | 3300032004 | Bacteria | 768 |
| 409 | Ga0307411_10003694 | 3300032005 | Bacteria | 7168 |
| 410 | Ga0307411_10087235 | 3300032005 | Bacteria | 2167 |
| 411 | Ga0307411_10176984 | 3300032005 | Bacteria | 1615 |
| 412 | Ga0307415_100018565 | 3300032126 | Bacteria | 4204 |
| 413 | Ga0307415_100218817 | 3300032126 | Bacteria | 1525 |
| 414 | Ga0373960_0099106 | 3300035121 | Bacteria | 942 |
| 415 | Ga0373943_0366324 | 3300035170 | Bacteria | 828 |
| 416 | Ga0373961_0050982 | 3300035241 | Bacteria | 1227 |
| 417 | Ga0436365_0448718 | 3300039437 | Bacteria | 5773 |
| 418 | Ga0451853_0749231 | 3300041512 | Bacteria | 2518 |
| 419 | Ga0439449_0110807 | 3300042007 | Bacteria | 1017 |
| 420 | Ga0466972_0081432 | 3300044658 | Bacteria | 1541 |
| 421 | Ga0466967_0395620 | 3300045976 | Bacteria | 1344 |
| 422 | Ga0495638_0031541 | 3300046460 | Bacteria | 3405 |
| 423 | Ga0495580_0010452 | 3300046472 | Bacteria | 7234 |
| 424 | Ga0495605_0002870 | 3300046474 | Bacteria | 10477 |
| 425 | Ga0495584_0205475 | 3300046491 | Bacteria | 1001 |
| 426 | Ga0495594_0042410 | 3300046499 | Bacteria | 2492 |
| 427 | Ga0495596_0000320 | 3300046500 | Bacteria | 31290 |
| 428 | Ga0495607_0021980 | 3300046501 | Bacteria | 4011 |
| 429 | Ga0495610_0000514 | 3300046512 | Bacteria | 39181 |
| 430 | Ga0495616_0003256 | 3300046513 | Bacteria | 10439 |
| 431 | Ga0495616_0005265 | 3300046513 | Bacteria | 7982 |
| 432 | Ga0495631_0000455 | 3300046518 | Bacteria | 27845 |
| 433 | Ga0495637_0037289 | 3300046520 | Bacteria | 2111 |
| 434 | Ga0495648_0012532 | 3300046524 | Bacteria | 6318 |
| 435 | Ga0495663_0014664 | 3300046525 | Bacteria | 2199 |
| 436 | Ga0495654_0009970 | 3300046530 | Bacteria | 5189 |
| 437 | Ga0495621_0008759 | 3300046539 | Bacteria | 3045 |
| 438 | Ga0495597_0045030 | 3300046542 | Bacteria | 1960 |
| 439 | Ga0495622_0051809 | 3300046557 | Bacteria | 1904 |
| 440 | Ga0495668_0114618 | 3300046616 | Bacteria | 1474 |
| 441 | Ga0495625_0022596 | 3300046660 | Bacteria | 4819 |
| 442 | Ga0495661_0022023 | 3300046665 | Bacteria | 4147 |
| 443 | Ga0495588_0040880 | 3300046674 | Bacteria | 2366 |
| 444 | Ga0495669_0146242 | 3300046684 | Bacteria | 1117 |
| 445 | Ga0495671_0015635 | 3300046692 | Bacteria | 4061 |
| 446 | Ga0495604_0003210 | 3300047317 | Bacteria | 13063 |
| 447 | Ga0495672_0005431 | 3300047320 | Bacteria | 10115 |
| 448 | Ga0495676_0069981 | 3300047321 | Bacteria | 2705 |
| 449 | Ga0495685_117319 | 3300047447 | Bacteria | 874 |
| 450 | Ga0495614_0006942 | 3300048089 | Bacteria | 5058 |
| 451 | Ga0496100_0172526 | 3300048903 | Bacteria | 1559 |
| 452 | Ga0496101_0105844 | 3300048904 | Bacteria | 2111 |
| 453 | Ga0496102_0003972 | 3300048905 | Bacteria | 12535 |
| 454 | Ga0496102_0029946 | 3300048905 | Bacteria | 4871 |
| 455 | Ga0496102_0561978 | 3300048905 | Bacteria | 1064 |
| 456 | Ga0496103_0007429 | 3300048906 | Bacteria | 6532 |
| 457 | Ga0496104_0032318 | 3300048907 | Bacteria | 4870 |
| 458 | Ga0496105_0102810 | 3300048908 | Bacteria | 2360 |
| 459 | Ga0496106_0006216 | 3300048909 | Bacteria | 8835 |
| 460 | Ga0496106_0295511 | 3300048909 | Bacteria | 1299 |
| 461 | Ga0496107_0072954 | 3300048910 | Bacteria | 2496 |
| 462 | Ga0496108_0159255 | 3300048911 | Bacteria | 1950 |
| 463 | Ga0496108_0203755 | 3300048911 | Bacteria | 1717 |
| 464 | Ga0496108_0344604 | 3300048911 | Bacteria | 1300 |
| 465 | Ga0496109_0394691 | 3300048912 | Bacteria | 1307 |
| 466 | Ga0496110_0071817 | 3300048913 | Bacteria | 3070 |
| 467 | Ga0496110_0145321 | 3300048913 | Bacteria | 2145 |
| 468 | Ga0496110_0200361 | 3300048913 | Bacteria | 1814 |
| 469 | Ga0496110_0249770 | 3300048913 | Bacteria | 1614 |
| 470 | Ga0496111_0210748 | 3300048914 | Bacteria | 1443 |
| 471 | Ga0496111_0270018 | 3300048914 | Bacteria | 1262 |
| 472 | Ga0496116_0051071 | 3300048919 | Bacteria | 2749 |
| 473 | Ga0496117_0049833 | 3300048920 | Bacteria | 2974 |
| 474 | Ga0496118_0010450 | 3300048921 | Bacteria | 9195 |
| 475 | Ga0496121_0068374 | 3300048924 | Bacteria | 2873 |
| 476 | Ga0496122_0007440 | 3300048925 | Bacteria | 12169 |
| 477 | Ga0496123_0003848 | 3300048926 | Bacteria | 16337 |
| 478 | Ga0496124_0040556 | 3300048927 | Bacteria | 4025 |
| 479 | Ga0496125_0028991 | 3300048928 | Bacteria | 4984 |
| 480 | Ga0496125_0106118 | 3300048928 | Bacteria | 2051 |
| 481 | Ga0496125_0107460 | 3300048928 | Bacteria | 2033 |
| 482 | Ga0496126_0164798 | 3300048929 | Bacteria | 1892 |
| 483 | Ga0496126_0215241 | 3300048929 | Bacteria | 1616 |
| 484 | Ga0501031_0006012 | 3300049568 | Bacteria | 7922 |
| 485 | Ga0501031_0079890 | 3300049568 | Bacteria | 2131 |
| 486 | Ga0501032_0007188 | 3300049569 | Bacteria | 8142 |
| 487 | Ga0501032_0188340 | 3300049569 | Bacteria | 1349 |
| 488 | Ga0501033_0002494 | 3300049570 | Bacteria | 15612 |
| 489 | Ga0501033_0010856 | 3300049570 | Bacteria | 6983 |
| 490 | Ga0501034_0246253 | 3300049571 | Bacteria | 1732 |
| 491 | Ga0501036_0001586 | 3300049572 | Bacteria | 17583 |
| 492 | Ga0501036_0003940 | 3300049572 | Bacteria | 11926 |
| 493 | Ga0501036_0308356 | 3300049572 | Bacteria | 1323 |
| 494 | Ga0501037_0097610 | 3300049573 | Bacteria | 2123 |
| 495 | Ga0501038_0009918 | 3300049574 | Bacteria | 8721 |
| 496 | Ga0501038_0009928 | 3300049574 | Bacteria | 8718 |
| 497 | Ga0501038_0018946 | 3300049574 | Bacteria | 6210 |
| 498 | Ga0501039_0075042 | 3300049575 | Bacteria | 2628 |
| 499 | Ga0501039_0238616 | 3300049575 | Bacteria | 1429 |
| 500 | Ga0501040_0149646 | 3300049576 | Bacteria | 1646 |
| 501 | Ga0501041_0203667 | 3300049577 | Unclassified | 1241 |
| 502 | Ga0501042_0058919 | 3300049578 | Bacteria | 2741 |
| 503 | Ga0501043_0031094 | 3300049579 | Bacteria | 4198 |
| 504 | Ga0501043_0037196 | 3300049579 | Bacteria | 3829 |
| 505 | Ga0501043_0075866 | 3300049579 | Bacteria | 2640 |
| 506 | Ga0501046_0165121 | 3300049580 | Bacteria | 1663 |
| 507 | Ga0501046_0170478 | 3300049580 | Bacteria | 1634 |
| 508 | Ga0501047_0020466 | 3300049581 | Bacteria | 6352 |
| 509 | Ga0501048_0185479 | 3300049582 | Bacteria | 1474 |
| 510 | Ga0501068_0014654 | 3300049584 | Bacteria | 4486 |
| 511 | Ga0501068_0300508 | 3300049584 | Bacteria | 1027 |
| 512 | Ga0501069_0136491 | 3300049585 | Bacteria | 1406 |
| 513 | Ga0501070_0200763 | 3300049586 | Bacteria | 1638 |
| 514 | Ga0501071_0028106 | 3300049587 | Bacteria | 3961 |
| 515 | Ga0501072_0198079 | 3300049588 | Bacteria | 1601 |
| 516 | Ga0501073_0011183 | 3300049589 | Bacteria | 6563 |
| 517 | Ga0501075_0053942 | 3300049591 | Bacteria | 3023 |
| 518 | Ga0501076_0032459 | 3300049592 | Bacteria | 4075 |
| 519 | Ga0501077_0104164 | 3300049593 | Bacteria | 1798 |
| 520 | Ga0501079_0283958 | 3300049741 | Unclassified | 1294 |
| 521 | Ga0501080_0021094 | 3300049742 | Bacteria | 6030 |
| 522 | Ga0501081_0186032 | 3300049743 | Bacteria | 1503 |
| 523 | Ga0501035_0000504 | 3300049822 | Bacteria | 44035 |
| 524 | Ga0501035_0107201 | 3300049822 | Bacteria | 2449 |
| 525 | Ga0501044_0056622 | 3300049823 | Bacteria | 4025 |
| 526 | Ga0501044_0119489 | 3300049823 | Bacteria | 2638 |
| 527 | Ga0501044_0180569 | 3300049823 | Bacteria | 2077 |
| 528 | Ga0501045_0078870 | 3300049824 | Bacteria | 2428 |
| 529 | Ga0501045_0124039 | 3300049824 | Unclassified | 1918 |
| 530 | nmdc:mga00v17_1907_c1 | 3300050491 | Bacteria | 10785 |
| 531 | nmdc:mga08y16_299661_c1 | 3300050511 | Bacteria | 1657 |
| 532 | nmdc:mga08y16_32273_c1 | 3300050511 | Bacteria | 5507 |
| 533 | nmdc:mga08y16_491888_c1 | 3300050511 | Bacteria | 1247 |
| 534 | nmdc:mga0n895_419762_c1 | 3300050512 | Bacteria | 1352 |
| 535 | Ga0500643_004327 | 3300053087 | Bacteria | 6474 |
| 536 | Ga0500651_0000052 | 3300053093 | Bacteria | 76301 |
| 537 | Ga0500560_157918 | 3300053107 | Bacteria | 751 |
| 538 | Ga0500571_000036 | 3300053110 | Bacteria | 42725 |
| 539 | Ga0500592_014971 | 3300053116 | Bacteria | 1243 |
| 540 | Ga0500655_004623 | 3300053133 | Bacteria | 2471 |
| 541 | Ga0500658_0000033 | 3300053134 | Bacteria | 89738 |
| 542 | Ga0500658_0000040 | 3300053134 | Bacteria | 79293 |
| 543 | Ga0500559_0001653 | 3300053136 | Bacteria | 12335 |
| 544 | Ga0500574_002546 | 3300053141 | Bacteria | 3026 |
| 545 | Ga0500604_0066626 | 3300053151 | Bacteria | 1141 |
| 546 | Ga0500616_0038423 | 3300053153 | Bacteria | 2585 |
| 547 | Ga0500638_010945 | 3300053162 | Bacteria | 4000 |
| 548 | Ga0500636_0050978 | 3300053177 | Bacteria | 2433 |
| 549 | Ga0590075_062045 | 3300059424 | Bacteria | 963 |
| 550 | Ga0501082_0035312 | 3300060353 | Bacteria | 4309 |
| 551 | Ga0530510_0004976 | 3300061734 | Bacteria | 9180 |
| 552 | Ga0530510_0306899 | 3300061734 | Unclassified | 1188 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0395620 | Ga0466967_0395620_145_909 | 160 |
| 2 | 3300048907 | Ga0496104_0032318 | Ga0496104_0032318_1858_2436 | 180 |
| 3 | 3300005617 | Ga0068859_100322772 | Ga0068859_1003227722 | 184 |
| 4 | 3300005842 | Ga0068858_100011569 | Ga0068858_1000115693 | 184 |
| 5 | 3300006931 | Ga0097620_100322756 | Ga0097620_1003227562 | 184 |
| 6 | 3300014968 | Ga0157379_10007873 | Ga0157379_100078734 | 184 |
| 7 | 3300026035 | Ga0207703_10401256 | Ga0207703_104012562 | 184 |
| 8 | 3300025908 | Ga0207643_10201695 | Ga0207643_102016952 | 186 |
| 9 | 3300005293 | Ga0065715_10351285 | Ga0065715_103512851 | 189 |
| 10 | 3300005331 | Ga0070670_100619834 | Ga0070670_1006198342 | 189 |
| 11 | 3300005335 | Ga0070666_10270503 | Ga0070666_102705031 | 189 |
| 12 | 3300005347 | Ga0070668_100013810 | Ga0070668_1000138103 | 189 |
| 13 | 3300005354 | Ga0070675_100333740 | Ga0070675_1003337401 | 189 |
| 14 | 3300005459 | Ga0068867_100104685 | Ga0068867_1001046852 | 189 |
| 15 | 3300005548 | Ga0070665_100021536 | Ga0070665_1000215366 | 189 |
| 16 | 3300005617 | Ga0068859_100202118 | Ga0068859_1002021182 | 189 |
| 17 | 3300006931 | Ga0097620_100202111 | Ga0097620_1002021112 | 189 |
| 18 | 3300025903 | Ga0207680_10252236 | Ga0207680_102522361 | 189 |
| 19 | 3300025923 | Ga0207681_10050063 | Ga0207681_100500632 | 189 |
| 20 | 3300025925 | Ga0207650_10691889 | Ga0207650_106918892 | 189 |
| 21 | 3300025926 | Ga0207659_10312752 | Ga0207659_103127522 | 189 |
| 22 | 3300026089 | Ga0207648_10169558 | Ga0207648_101695582 | 189 |
| 23 | 3300027907 | Ga0207428_10343882 | Ga0207428_103438821 | 189 |
| 24 | 3300028379 | Ga0268266_10035565 | Ga0268266_100355652 | 189 |
| 25 | 3300050511 | nmdc:mga08y16_299661_c1 | nmdc:mga08y16_299661_c1_68_688 | 189 |
| 26 | 3300005546 | Ga0070696_100281066 | Ga0070696_1002810661 | 194 |
| 27 | 3300026075 | Ga0207708_10009866 | Ga0207708_100098665 | 194 |
| 28 | iso_pu_bacteria | 2643221603 | 2644031405 | 194 |
| 29 | 3300005334 | Ga0068869_100206058 | Ga0068869_1002060582 | 197 |
| 30 | 3300005614 | Ga0068856_100185499 | Ga0068856_1001854991 | 197 |
| 31 | 3300009545 | Ga0105237_10758638 | Ga0105237_107586381 | 197 |
| 32 | 3300013296 | Ga0157374_10536488 | Ga0157374_105364882 | 197 |
| 33 | 3300013307 | Ga0157372_10735506 | Ga0157372_107355062 | 197 |
| 34 | 3300025932 | Ga0207690_10091164 | Ga0207690_100911641 | 197 |
| 35 | 3300025933 | Ga0207706_10816890 | Ga0207706_108168901 | 197 |
| 36 | 3300026078 | Ga0207702_10100423 | Ga0207702_101004231 | 197 |
| 37 | 3300032004 | Ga0307414_11004896 | Ga0307414_110048961 | 197 |
| 38 | 3300032005 | Ga0307411_10087235 | Ga0307411_100872351 | 197 |
| 39 | 3300048905 | Ga0496102_0561978 | Ga0496102_0561978_144_809 | 197 |
| 40 | 3300048913 | Ga0496110_0071817 | Ga0496110_0071817_1044_1709 | 197 |
| 41 | 3300002075 | JGI24738J21930_10044116 | JGI24738J21930_100441161 | 198 |
| 42 | 3300002773 | JGI25152J39213_1005172 | JGI25152J39213_10051724 | 198 |
| 43 | 3300002773 | JGI25152J39213_1026926 | JGI25152J39213_10269261 | 198 |
| 44 | 3300002774 | JGI25150J39212_1003222 | JGI25150J39212_10032223 | 198 |
| 45 | 3300002987 | JGI25159J45721_1007688 | JGI25159J45721_10076883 | 198 |
| 46 | 3300002987 | JGI25159J45721_1007832 | JGI25159J45721_10078322 | 198 |
| 47 | 3300003187 | JGI25151J46595_10009110 | JGI25151J46595_100091105 | 198 |
| 48 | 3300003187 | JGI25151J46595_10021267 | JGI25151J46595_100212673 | 198 |
| 49 | 3300003215 | JGI25153J46596_10009295 | JGI25153J46596_100092955 | 198 |
| 50 | 3300003215 | JGI25153J46596_10018378 | JGI25153J46596_100183783 | 198 |
| 51 | 3300003354 | JGI25160J50197_1006774 | JGI25160J50197_10067745 | 198 |
| 52 | 3300003354 | JGI25160J50197_1059274 | JGI25160J50197_10592741 | 198 |
| 53 | 3300003374 | JGI25161J50226_1008700 | JGI25161J50226_10087002 | 198 |
| 54 | 3300003578 | Ga0006562J51391_1114904 | Ga0006562J51391_11149043 | 198 |
| 55 | 3300003761 | Ga0055535_1000215 | Ga0055535_100021533 | 198 |
| 56 | 3300003762 | Ga0055542_1000004 | Ga0055542_1000004393 | 198 |
| 57 | 3300003771 | Ga0055526_1012364 | Ga0055526_10123645 | 198 |
| 58 | 3300003771 | Ga0055526_1012792 | Ga0055526_10127922 | 198 |
| 59 | 3300003771 | Ga0055526_1015757 | Ga0055526_10157572 | 198 |
| 60 | 3300003773 | Ga0055537_1003185 | Ga0055537_10031852 | 198 |
| 61 | 3300003773 | Ga0055537_1003730 | Ga0055537_10037305 | 198 |
| 62 | 3300003775 | Ga0055524_1005576 | Ga0055524_10055765 | 198 |
| 63 | 3300003775 | Ga0055524_1007567 | Ga0055524_10075675 | 198 |
| 64 | 3300003781 | Ga0055536_1000578 | Ga0055536_100057820 | 198 |
| 65 | 3300003781 | Ga0055536_1021090 | Ga0055536_10210903 | 198 |
| 66 | 3300003784 | Ga0055534_1003190 | Ga0055534_10031905 | 198 |
| 67 | 3300003784 | Ga0055534_1003831 | Ga0055534_10038315 | 198 |
| 68 | 3300003790 | Ga0055528_1010603 | Ga0055528_10106035 | 198 |
| 69 | 3300003790 | Ga0055528_1013947 | Ga0055528_10139472 | 198 |
| 70 | 3300003790 | Ga0055528_1027724 | Ga0055528_10277242 | 198 |
| 71 | 3300003791 | Ga0055530_10001680 | Ga0055530_100016806 | 198 |
| 72 | 3300003792 | Ga0055540_1010762 | Ga0055540_10107625 | 198 |
| 73 | 3300003794 | Ga0055531_10005985 | Ga0055531_100059855 | 198 |
| 74 | 3300003794 | Ga0055531_10011395 | Ga0055531_100113954 | 198 |
| 75 | 3300004625 | Ga0055543_1000713 | Ga0055543_10007134 | 198 |
| 76 | 3300004625 | Ga0055543_1002495 | Ga0055543_10024953 | 198 |
| 77 | 3300005328 | Ga0070676_10008322 | Ga0070676_100083222 | 198 |
| 78 | 3300005328 | Ga0070676_10036105 | Ga0070676_100361053 | 198 |
| 79 | 3300005328 | Ga0070676_10230154 | Ga0070676_102301542 | 198 |
| 80 | 3300005328 | Ga0070676_10568601 | Ga0070676_105686011 | 198 |
| 81 | 3300005329 | Ga0070683_100579916 | Ga0070683_1005799162 | 198 |
| 82 | 3300005331 | Ga0070670_100008808 | Ga0070670_1000088084 | 198 |
| 83 | 3300005331 | Ga0070670_100023082 | Ga0070670_1000230821 | 198 |
| 84 | 3300005331 | Ga0070670_100285927 | Ga0070670_1002859272 | 198 |
| 85 | 3300005334 | Ga0068869_100023750 | Ga0068869_1000237501 | 198 |
| 86 | 3300005334 | Ga0068869_100092707 | Ga0068869_1000927073 | 198 |
| 87 | 3300005334 | Ga0068869_100485120 | Ga0068869_1004851201 | 198 |
| 88 | 3300005335 | Ga0070666_10025732 | Ga0070666_100257326 | 198 |
| 89 | 3300005335 | Ga0070666_10233307 | Ga0070666_102333071 | 198 |
| 90 | 3300005336 | Ga0070680_100287688 | Ga0070680_1002876882 | 198 |
| 91 | 3300005338 | Ga0068868_100566571 | Ga0068868_1005665712 | 198 |
| 92 | 3300005339 | Ga0070660_100002628 | Ga0070660_1000026283 | 198 |
| 93 | 3300005339 | Ga0070660_100044972 | Ga0070660_1000449721 | 198 |
| 94 | 3300005339 | Ga0070660_100435218 | Ga0070660_1004352181 | 198 |
| 95 | 3300005340 | Ga0070689_100206507 | Ga0070689_1002065072 | 198 |
| 96 | 3300005340 | Ga0070689_100273707 | Ga0070689_1002737072 | 198 |
| 97 | 3300005344 | Ga0070661_100025620 | Ga0070661_1000256203 | 198 |
| 98 | 3300005344 | Ga0070661_100397649 | Ga0070661_1003976492 | 198 |
| 99 | 3300005345 | Ga0070692_10126173 | Ga0070692_101261732 | 198 |
| 100 | 3300005347 | Ga0070668_100003929 | Ga0070668_1000039294 | 198 |
| 101 | 3300005347 | Ga0070668_100050415 | Ga0070668_1000504152 | 198 |
| 102 | 3300005347 | Ga0070668_100183049 | Ga0070668_1001830492 | 198 |
| 103 | 3300005353 | Ga0070669_100054722 | Ga0070669_1000547223 | 198 |
| 104 | 3300005353 | Ga0070669_100086410 | Ga0070669_1000864104 | 198 |
| 105 | 3300005353 | Ga0070669_100116018 | Ga0070669_1001160182 | 198 |
| 106 | 3300005354 | Ga0070675_100026499 | Ga0070675_1000264994 | 198 |
| 107 | 3300005354 | Ga0070675_100046336 | Ga0070675_1000463364 | 198 |
| 108 | 3300005354 | Ga0070675_100166225 | Ga0070675_1001662253 | 198 |
| 109 | 3300005354 | Ga0070675_100413723 | Ga0070675_1004137232 | 198 |
| 110 | 3300005355 | Ga0070671_100007502 | Ga0070671_1000075025 | 198 |
| 111 | 3300005355 | Ga0070671_100009794 | Ga0070671_1000097947 | 198 |
| 112 | 3300005355 | Ga0070671_100011383 | Ga0070671_1000113838 | 198 |
| 113 | 3300005355 | Ga0070671_100157843 | Ga0070671_1001578432 | 198 |
| 114 | 3300005355 | Ga0070671_100342983 | Ga0070671_1003429831 | 198 |
| 115 | 3300005356 | Ga0070674_100107777 | Ga0070674_1001077772 | 198 |
| 116 | 3300005356 | Ga0070674_100653746 | Ga0070674_1006537461 | 198 |
| 117 | 3300005364 | Ga0070673_100001049 | Ga0070673_10000104912 | 198 |
| 118 | 3300005364 | Ga0070673_100098744 | Ga0070673_1000987443 | 198 |
| 119 | 3300005364 | Ga0070673_100369554 | Ga0070673_1003695542 | 198 |
| 120 | 3300005364 | Ga0070673_100516486 | Ga0070673_1005164861 | 198 |
| 121 | 3300005367 | Ga0070667_100001066 | Ga0070667_10000106615 | 198 |
| 122 | 3300005367 | Ga0070667_100035617 | Ga0070667_1000356177 | 198 |
| 123 | 3300005367 | Ga0070667_100177039 | Ga0070667_1001770392 | 198 |
| 124 | 3300005367 | Ga0070667_100209593 | Ga0070667_1002095932 | 198 |
| 125 | 3300005367 | Ga0070667_100339828 | Ga0070667_1003398282 | 198 |
| 126 | 3300005367 | Ga0070667_100539228 | Ga0070667_1005392281 | 198 |
| 127 | 3300005441 | Ga0070700_100144491 | Ga0070700_1001444912 | 198 |
| 128 | 3300005455 | Ga0070663_100004830 | Ga0070663_1000048305 | 198 |
| 129 | 3300005455 | Ga0070663_100220453 | Ga0070663_1002204532 | 198 |
| 130 | 3300005456 | Ga0070678_100241849 | Ga0070678_1002418493 | 198 |
| 131 | 3300005457 | Ga0070662_100000724 | Ga0070662_10000072418 | 198 |
| 132 | 3300005458 | Ga0070681_10018097 | Ga0070681_100180979 | 198 |
| 133 | 3300005458 | Ga0070681_10131011 | Ga0070681_101310112 | 198 |
| 134 | 3300005458 | Ga0070681_10192507 | Ga0070681_101925073 | 198 |
| 135 | 3300005459 | Ga0068867_100177457 | Ga0068867_1001774571 | 198 |
| 136 | 3300005459 | Ga0068867_100192918 | Ga0068867_1001929182 | 198 |
| 137 | 3300005459 | Ga0068867_101098229 | Ga0068867_1010982291 | 198 |
| 138 | 3300005466 | Ga0070685_10076877 | Ga0070685_100768771 | 198 |
| 139 | 3300005467 | Ga0070706_100007578 | Ga0070706_1000075786 | 198 |
| 140 | 3300005518 | Ga0070699_100487787 | Ga0070699_1004877872 | 198 |
| 141 | 3300005530 | Ga0070679_100135171 | Ga0070679_1001351713 | 198 |
| 142 | 3300005530 | Ga0070679_100698496 | Ga0070679_1006984961 | 198 |
| 143 | 3300005536 | Ga0070697_100047801 | Ga0070697_1000478012 | 198 |
| 144 | 3300005539 | Ga0068853_100006046 | Ga0068853_1000060468 | 198 |
| 145 | 3300005539 | Ga0068853_100378989 | Ga0068853_1003789892 | 198 |
| 146 | 3300005543 | Ga0070672_100002831 | Ga0070672_1000028316 | 198 |
| 147 | 3300005543 | Ga0070672_100086789 | Ga0070672_1000867892 | 198 |
| 148 | 3300005543 | Ga0070672_100320512 | Ga0070672_1003205123 | 198 |
| 149 | 3300005543 | Ga0070672_100343314 | Ga0070672_1003433142 | 198 |
| 150 | 3300005545 | Ga0070695_100506115 | Ga0070695_1005061151 | 198 |
| 151 | 3300005546 | Ga0070696_100169924 | Ga0070696_1001699242 | 198 |
| 152 | 3300005546 | Ga0070696_100696538 | Ga0070696_1006965382 | 198 |
| 153 | 3300005546 | Ga0070696_100971563 | Ga0070696_1009715631 | 198 |
| 154 | 3300005548 | Ga0070665_100261752 | Ga0070665_1002617524 | 198 |
| 155 | 3300005548 | Ga0070665_100349417 | Ga0070665_1003494172 | 198 |
| 156 | 3300005549 | Ga0070704_100396582 | Ga0070704_1003965822 | 198 |
| 157 | 3300005563 | Ga0068855_100000749 | Ga0068855_10000074934 | 198 |
| 158 | 3300005563 | Ga0068855_100047855 | Ga0068855_1000478553 | 198 |
| 159 | 3300005563 | Ga0068855_100116319 | Ga0068855_1001163192 | 198 |
| 160 | 3300005564 | Ga0070664_100005769 | Ga0070664_1000057696 | 198 |
| 161 | 3300005614 | Ga0068856_100004974 | Ga0068856_10000497411 | 198 |
| 162 | 3300005616 | Ga0068852_100048873 | Ga0068852_1000488735 | 198 |
| 163 | 3300005616 | Ga0068852_100081952 | Ga0068852_1000819522 | 198 |
| 164 | 3300005616 | Ga0068852_100300425 | Ga0068852_1003004251 | 198 |
| 165 | 3300005617 | Ga0068859_100676129 | Ga0068859_1006761292 | 198 |
| 166 | 3300005617 | Ga0068859_101139887 | Ga0068859_1011398871 | 198 |
| 167 | 3300005618 | Ga0068864_100012696 | Ga0068864_1000126964 | 198 |
| 168 | 3300005618 | Ga0068864_100034572 | Ga0068864_1000345723 | 198 |
| 169 | 3300005618 | Ga0068864_100042324 | Ga0068864_1000423245 | 198 |
| 170 | 3300005618 | Ga0068864_100457059 | Ga0068864_1004570591 | 198 |
| 171 | 3300005719 | Ga0068861_100293946 | Ga0068861_1002939462 | 198 |
| 172 | 3300005834 | Ga0068851_10001981 | Ga0068851_100019812 | 198 |
| 173 | 3300005834 | Ga0068851_10208675 | Ga0068851_102086752 | 198 |
| 174 | 3300005840 | Ga0068870_10024912 | Ga0068870_100249124 | 198 |
| 175 | 3300005840 | Ga0068870_10445290 | Ga0068870_104452901 | 198 |
| 176 | 3300005841 | Ga0068863_100002825 | Ga0068863_1000028257 | 198 |
| 177 | 3300005841 | Ga0068863_100091698 | Ga0068863_1000916983 | 198 |
| 178 | 3300005842 | Ga0068858_100046470 | Ga0068858_1000464702 | 198 |
| 179 | 3300005842 | Ga0068858_100147675 | Ga0068858_1001476753 | 198 |
| 180 | 3300005843 | Ga0068860_100317181 | Ga0068860_1003171813 | 198 |
| 181 | 3300005844 | Ga0068862_100025443 | Ga0068862_1000254434 | 198 |
| 182 | 3300005844 | Ga0068862_100078706 | Ga0068862_1000787063 | 198 |
| 183 | 3300006051 | Ga0075364_10000107 | Ga0075364_100001077 | 198 |
| 184 | 3300006237 | Ga0097621_100041684 | Ga0097621_1000416842 | 198 |
| 185 | 3300006358 | Ga0068871_100090612 | Ga0068871_1000906122 | 198 |
| 186 | 3300006358 | Ga0068871_100161756 | Ga0068871_1001617562 | 198 |
| 187 | 3300006358 | Ga0068871_100700449 | Ga0068871_1007004491 | 198 |
| 188 | 3300006844 | Ga0075428_100438523 | Ga0075428_1004385232 | 198 |
| 189 | 3300006881 | Ga0068865_100050394 | Ga0068865_1000503943 | 198 |
| 190 | 3300006881 | Ga0068865_100095393 | Ga0068865_1000953932 | 198 |
| 191 | 3300006881 | Ga0068865_100115795 | Ga0068865_1001157953 | 198 |
| 192 | 3300006931 | Ga0097620_100676087 | Ga0097620_1006760872 | 198 |
| 193 | 3300006931 | Ga0097620_101140201 | Ga0097620_1011402011 | 198 |
| 194 | 3300006948 | Ga0099826_10000039 | Ga0099826_1000003955 | 198 |
| 195 | 3300009093 | Ga0105240_10012576 | Ga0105240_1001257612 | 198 |
| 196 | 3300009093 | Ga0105240_10381135 | Ga0105240_103811352 | 198 |
| 197 | 3300009094 | Ga0111539_10349982 | Ga0111539_103499822 | 198 |
| 198 | 3300009094 | Ga0111539_10714671 | Ga0111539_107146712 | 198 |
| 199 | 3300009098 | Ga0105245_11333065 | Ga0105245_113330651 | 198 |
| 200 | 3300009174 | Ga0105241_10643569 | Ga0105241_106435692 | 198 |
| 201 | 3300009176 | Ga0105242_10126830 | Ga0105242_101268303 | 198 |
| 202 | 3300009176 | Ga0105242_10259339 | Ga0105242_102593392 | 198 |
| 203 | 3300009177 | Ga0105248_10003557 | Ga0105248_100035576 | 198 |
| 204 | 3300009177 | Ga0105248_10029588 | Ga0105248_100295882 | 198 |
| 205 | 3300009553 | Ga0105249_10669640 | Ga0105249_106696402 | 198 |
| 206 | 3300013100 | Ga0157373_10001690 | Ga0157373_100016908 | 198 |
| 207 | 3300013102 | Ga0157371_10001950 | Ga0157371_100019506 | 198 |
| 208 | 3300013104 | Ga0157370_10232194 | Ga0157370_102321942 | 198 |
| 209 | 3300013105 | Ga0157369_10045759 | Ga0157369_100457595 | 198 |
| 210 | 3300013105 | Ga0157369_10290232 | Ga0157369_102902322 | 198 |
| 211 | 3300013296 | Ga0157374_10109724 | Ga0157374_101097242 | 198 |
| 212 | 3300013297 | Ga0157378_10016528 | Ga0157378_100165286 | 198 |
| 213 | 3300013297 | Ga0157378_10086122 | Ga0157378_100861224 | 198 |
| 214 | 3300013297 | Ga0157378_10140651 | Ga0157378_101406512 | 198 |
| 215 | 3300013306 | Ga0163162_10011523 | Ga0163162_100115233 | 198 |
| 216 | 3300013306 | Ga0163162_10099274 | Ga0163162_100992742 | 198 |
| 217 | 3300013306 | Ga0163162_10101891 | Ga0163162_101018912 | 198 |
| 218 | 3300013306 | Ga0163162_10259562 | Ga0163162_102595623 | 198 |
| 219 | 3300013306 | Ga0163162_10639744 | Ga0163162_106397441 | 198 |
| 220 | 3300013306 | Ga0163162_11496986 | Ga0163162_114969861 | 198 |
| 221 | 3300013307 | Ga0157372_10003134 | Ga0157372_1000313410 | 198 |
| 222 | 3300013307 | Ga0157372_10729886 | Ga0157372_107298862 | 198 |
| 223 | 3300013308 | Ga0157375_10022086 | Ga0157375_100220862 | 198 |
| 224 | 3300013308 | Ga0157375_10056119 | Ga0157375_100561194 | 198 |
| 225 | 3300013308 | Ga0157375_10144486 | Ga0157375_101444862 | 198 |
| 226 | 3300013308 | Ga0157375_10280024 | Ga0157375_102800242 | 198 |
| 227 | 3300013308 | Ga0157375_10591056 | Ga0157375_105910562 | 198 |
| 228 | 3300014325 | Ga0163163_10009902 | Ga0163163_100099025 | 198 |
| 229 | 3300014326 | Ga0157380_10147751 | Ga0157380_101477513 | 198 |
| 230 | 3300014326 | Ga0157380_10221739 | Ga0157380_102217392 | 198 |
| 231 | 3300014326 | Ga0157380_10231188 | Ga0157380_102311882 | 198 |
| 232 | 3300014326 | Ga0157380_10510284 | Ga0157380_105102842 | 198 |
| 233 | 3300014968 | Ga0157379_10331825 | Ga0157379_103318253 | 198 |
| 234 | 3300017792 | Ga0163161_10027233 | Ga0163161_100272336 | 198 |
| 235 | 3300017792 | Ga0163161_10085616 | Ga0163161_100856163 | 198 |
| 236 | 3300021384 | Ga0213876_10040892 | Ga0213876_100408922 | 198 |
| 237 | 3300025208 | Ga0209436_104047 | Ga0209436_1040473 | 198 |
| 238 | 3300025208 | Ga0209436_106401 | Ga0209436_1064014 | 198 |
| 239 | 3300025228 | Ga0209672_101454 | Ga0209672_1014548 | 198 |
| 240 | 3300025229 | Ga0209147_101058 | Ga0209147_1010584 | 198 |
| 241 | 3300025242 | Ga0209258_100022 | Ga0209258_100022393 | 198 |
| 242 | 3300025245 | Ga0207425_1000180 | Ga0207425_100018034 | 198 |
| 243 | 3300025245 | Ga0207425_1020064 | Ga0207425_10200642 | 198 |
| 244 | 3300025254 | Ga0209148_1000034 | Ga0209148_1000034393 | 198 |
| 245 | 3300025258 | Ga0209129_1000111 | Ga0209129_1000111123 | 198 |
| 246 | 3300025258 | Ga0209129_1006271 | Ga0209129_10062713 | 198 |
| 247 | 3300025263 | Ga0209565_1000110 | Ga0209565_100011035 | 198 |
| 248 | 3300025273 | Ga0209673_1000175 | Ga0209673_100017570 | 198 |
| 249 | 3300025273 | Ga0209673_1000944 | Ga0209673_100094423 | 198 |
| 250 | 3300025273 | Ga0209673_1000992 | Ga0209673_100099216 | 198 |
| 251 | 3300025273 | Ga0209673_1001347 | Ga0209673_10013474 | 198 |
| 252 | 3300025284 | Ga0209130_1000205 | Ga0209130_100020535 | 198 |
| 253 | 3300025284 | Ga0209130_1000332 | Ga0209130_100033221 | 198 |
| 254 | 3300025291 | Ga0209675_1000192 | Ga0209675_100019221 | 198 |
| 255 | 3300025291 | Ga0209675_1008192 | Ga0209675_10081923 | 198 |
| 256 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005309 | 198 |
| 257 | 3300025292 | Ga0209676_1002061 | Ga0209676_100206117 | 198 |
| 258 | 3300025294 | Ga0209025_1000116 | Ga0209025_1000116131 | 198 |
| 259 | 3300025294 | Ga0209025_1023711 | Ga0209025_10237114 | 198 |
| 260 | 3300025295 | Ga0209564_1000155 | Ga0209564_1000155131 | 198 |
| 261 | 3300025295 | Ga0209564_1000298 | Ga0209564_100029840 | 198 |
| 262 | 3300025297 | Ga0209758_1000107 | Ga0209758_1000107131 | 198 |
| 263 | 3300025297 | Ga0209758_1005110 | Ga0209758_10051103 | 198 |
| 264 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007788 | 198 |
| 265 | 3300025299 | Ga0209256_1000038 | Ga0209256_1000038171 | 198 |
| 266 | 3300025299 | Ga0209256_1000087 | Ga0209256_1000087131 | 198 |
| 267 | 3300025302 | Ga0207426_1000090 | Ga0207426_1000090122 | 198 |
| 268 | 3300025302 | Ga0207426_1000123 | Ga0207426_1000123131 | 198 |
| 269 | 3300025303 | Ga0209051_1000009 | Ga0209051_1000009309 | 198 |
| 270 | 3300025303 | Ga0209051_1048741 | Ga0209051_10487412 | 198 |
| 271 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011283 | 198 |
| 272 | 3300025304 | Ga0209257_1000576 | Ga0209257_100057627 | 198 |
| 273 | 3300025304 | Ga0209257_1000870 | Ga0209257_100087021 | 198 |
| 274 | 3300025315 | Ga0207697_10034073 | Ga0207697_100340732 | 198 |
| 275 | 3300025315 | Ga0207697_10052654 | Ga0207697_100526542 | 198 |
| 276 | 3300025321 | Ga0207656_10010523 | Ga0207656_100105234 | 198 |
| 277 | 3300025321 | Ga0207656_10181002 | Ga0207656_101810022 | 198 |
| 278 | 3300025899 | Ga0207642_10400219 | Ga0207642_104002191 | 198 |
| 279 | 3300025903 | Ga0207680_10032467 | Ga0207680_100324674 | 198 |
| 280 | 3300025907 | Ga0207645_10303972 | Ga0207645_103039721 | 198 |
| 281 | 3300025908 | Ga0207643_10032288 | Ga0207643_100322884 | 198 |
| 282 | 3300025909 | Ga0207705_10314285 | Ga0207705_103142852 | 198 |
| 283 | 3300025910 | Ga0207684_10410931 | Ga0207684_104109312 | 198 |
| 284 | 3300025911 | Ga0207654_10188116 | Ga0207654_101881163 | 198 |
| 285 | 3300025912 | Ga0207707_10255621 | Ga0207707_102556212 | 198 |
| 286 | 3300025913 | Ga0207695_10025753 | Ga0207695_100257536 | 198 |
| 287 | 3300025913 | Ga0207695_10574016 | Ga0207695_105740162 | 198 |
| 288 | 3300025919 | Ga0207657_10000201 | Ga0207657_1000020135 | 198 |
| 289 | 3300025919 | Ga0207657_10052276 | Ga0207657_100522761 | 198 |
| 290 | 3300025920 | Ga0207649_10006211 | Ga0207649_100062113 | 198 |
| 291 | 3300025920 | Ga0207649_10369515 | Ga0207649_103695152 | 198 |
| 292 | 3300025920 | Ga0207649_10403106 | Ga0207649_104031062 | 198 |
| 293 | 3300025923 | Ga0207681_10019121 | Ga0207681_100191213 | 198 |
| 294 | 3300025923 | Ga0207681_10115541 | Ga0207681_101155412 | 198 |
| 295 | 3300025923 | Ga0207681_10155540 | Ga0207681_101555402 | 198 |
| 296 | 3300025923 | Ga0207681_10228189 | Ga0207681_102281891 | 198 |
| 297 | 3300025923 | Ga0207681_10369063 | Ga0207681_103690632 | 198 |
| 298 | 3300025925 | Ga0207650_10006140 | Ga0207650_100061405 | 198 |
| 299 | 3300025925 | Ga0207650_10017164 | Ga0207650_100171644 | 198 |
| 300 | 3300025925 | Ga0207650_10029450 | Ga0207650_100294502 | 198 |
| 301 | 3300025925 | Ga0207650_10383905 | Ga0207650_103839051 | 198 |
| 302 | 3300025925 | Ga0207650_10509929 | Ga0207650_105099291 | 198 |
| 303 | 3300025926 | Ga0207659_10083998 | Ga0207659_100839981 | 198 |
| 304 | 3300025926 | Ga0207659_10747143 | Ga0207659_107471431 | 198 |
| 305 | 3300025926 | Ga0207659_10977417 | Ga0207659_109774171 | 198 |
| 306 | 3300025927 | Ga0207687_10584343 | Ga0207687_105843432 | 198 |
| 307 | 3300025931 | Ga0207644_10002735 | Ga0207644_100027354 | 198 |
| 308 | 3300025931 | Ga0207644_10004293 | Ga0207644_100042932 | 198 |
| 309 | 3300025931 | Ga0207644_10101889 | Ga0207644_101018892 | 198 |
| 310 | 3300025931 | Ga0207644_10172496 | Ga0207644_101724962 | 198 |
| 311 | 3300025931 | Ga0207644_10241935 | Ga0207644_102419351 | 198 |
| 312 | 3300025931 | Ga0207644_10575779 | Ga0207644_105757791 | 198 |
| 313 | 3300025932 | Ga0207690_10002492 | Ga0207690_100024923 | 198 |
| 314 | 3300025932 | Ga0207690_10047341 | Ga0207690_100473412 | 198 |
| 315 | 3300025933 | Ga0207706_10000496 | Ga0207706_1000049635 | 198 |
| 316 | 3300025933 | Ga0207706_10058946 | Ga0207706_100589463 | 198 |
| 317 | 3300025934 | Ga0207686_10100325 | Ga0207686_101003251 | 198 |
| 318 | 3300025934 | Ga0207686_10199093 | Ga0207686_101990931 | 198 |
| 319 | 3300025936 | Ga0207670_10136427 | Ga0207670_101364271 | 198 |
| 320 | 3300025936 | Ga0207670_10345782 | Ga0207670_103457822 | 198 |
| 321 | 3300025937 | Ga0207669_10199445 | Ga0207669_101994452 | 198 |
| 322 | 3300025938 | Ga0207704_10249611 | Ga0207704_102496112 | 198 |
| 323 | 3300025938 | Ga0207704_10440789 | Ga0207704_104407891 | 198 |
| 324 | 3300025940 | Ga0207691_10005561 | Ga0207691_1000556110 | 198 |
| 325 | 3300025940 | Ga0207691_10014635 | Ga0207691_100146354 | 198 |
| 326 | 3300025940 | Ga0207691_10017171 | Ga0207691_100171715 | 198 |
| 327 | 3300025940 | Ga0207691_10039725 | Ga0207691_100397255 | 198 |
| 328 | 3300025940 | Ga0207691_10105928 | Ga0207691_101059282 | 198 |
| 329 | 3300025942 | Ga0207689_10026805 | Ga0207689_100268054 | 198 |
| 330 | 3300025942 | Ga0207689_10082911 | Ga0207689_100829113 | 198 |
| 331 | 3300025942 | Ga0207689_10548021 | Ga0207689_105480212 | 198 |
| 332 | 3300025945 | Ga0207679_10019626 | Ga0207679_100196263 | 198 |
| 333 | 3300025945 | Ga0207679_10023143 | Ga0207679_100231433 | 198 |
| 334 | 3300025945 | Ga0207679_10049806 | Ga0207679_100498062 | 198 |
| 335 | 3300025945 | Ga0207679_10490064 | Ga0207679_104900642 | 198 |
| 336 | 3300025949 | Ga0207667_10000500 | Ga0207667_1000050058 | 198 |
| 337 | 3300025949 | Ga0207667_10001476 | Ga0207667_1000147623 | 198 |
| 338 | 3300025949 | Ga0207667_10140983 | Ga0207667_101409832 | 198 |
| 339 | 3300025949 | Ga0207667_10576205 | Ga0207667_105762052 | 198 |
| 340 | 3300025960 | Ga0207651_10003545 | Ga0207651_100035455 | 198 |
| 341 | 3300025960 | Ga0207651_10034983 | Ga0207651_100349831 | 198 |
| 342 | 3300025960 | Ga0207651_10069534 | Ga0207651_100695342 | 198 |
| 343 | 3300025960 | Ga0207651_10099678 | Ga0207651_100996782 | 198 |
| 344 | 3300025960 | Ga0207651_10290826 | Ga0207651_102908262 | 198 |
| 345 | 3300025972 | Ga0207668_10013036 | Ga0207668_100130364 | 198 |
| 346 | 3300025972 | Ga0207668_10022698 | Ga0207668_100226985 | 198 |
| 347 | 3300025981 | Ga0207640_10444489 | Ga0207640_104444892 | 198 |
| 348 | 3300025986 | Ga0207658_10001039 | Ga0207658_1000103912 | 198 |
| 349 | 3300025986 | Ga0207658_10024644 | Ga0207658_100246446 | 198 |
| 350 | 3300025986 | Ga0207658_10067886 | Ga0207658_100678864 | 198 |
| 351 | 3300025986 | Ga0207658_10355132 | Ga0207658_103551322 | 198 |
| 352 | 3300025986 | Ga0207658_10836906 | Ga0207658_108369061 | 198 |
| 353 | 3300026023 | Ga0207677_10130259 | Ga0207677_101302591 | 198 |
| 354 | 3300026023 | Ga0207677_10309886 | Ga0207677_103098862 | 198 |
| 355 | 3300026023 | Ga0207677_10737763 | Ga0207677_107377631 | 198 |
| 356 | 3300026035 | Ga0207703_10033179 | Ga0207703_100331794 | 198 |
| 357 | 3300026035 | Ga0207703_10669550 | Ga0207703_106695502 | 198 |
| 358 | 3300026035 | Ga0207703_11211570 | Ga0207703_112115701 | 198 |
| 359 | 3300026041 | Ga0207639_10009805 | Ga0207639_100098054 | 198 |
| 360 | 3300026041 | Ga0207639_10115796 | Ga0207639_101157962 | 198 |
| 361 | 3300026067 | Ga0207678_10002559 | Ga0207678_100025599 | 198 |
| 362 | 3300026075 | Ga0207708_10188211 | Ga0207708_101882112 | 198 |
| 363 | 3300026078 | Ga0207702_10008538 | Ga0207702_100085385 | 198 |
| 364 | 3300026088 | Ga0207641_10390516 | Ga0207641_103905161 | 198 |
| 365 | 3300026088 | Ga0207641_10606402 | Ga0207641_106064021 | 198 |
| 366 | 3300026088 | Ga0207641_10974884 | Ga0207641_109748841 | 198 |
| 367 | 3300026089 | Ga0207648_10260819 | Ga0207648_102608193 | 198 |
| 368 | 3300026089 | Ga0207648_10350248 | Ga0207648_103502481 | 198 |
| 369 | 3300026089 | Ga0207648_10536704 | Ga0207648_105367041 | 198 |
| 370 | 3300026089 | Ga0207648_10555489 | Ga0207648_105554892 | 198 |
| 371 | 3300026095 | Ga0207676_10018416 | Ga0207676_100184164 | 198 |
| 372 | 3300026095 | Ga0207676_10036027 | Ga0207676_100360272 | 198 |
| 373 | 3300026095 | Ga0207676_10195354 | Ga0207676_101953542 | 198 |
| 374 | 3300026095 | Ga0207676_10685580 | Ga0207676_106855801 | 198 |
| 375 | 3300026116 | Ga0207674_10596788 | Ga0207674_105967881 | 198 |
| 376 | 3300026116 | Ga0207674_10655523 | Ga0207674_106555232 | 198 |
| 377 | 3300026116 | Ga0207674_10669204 | Ga0207674_106692041 | 198 |
| 378 | 3300026118 | Ga0207675_100077637 | Ga0207675_1000776372 | 198 |
| 379 | 3300026118 | Ga0207675_100197517 | Ga0207675_1001975173 | 198 |
| 380 | 3300026118 | Ga0207675_100346513 | Ga0207675_1003465132 | 198 |
| 381 | 3300026118 | Ga0207675_100829791 | Ga0207675_1008297912 | 198 |
| 382 | 3300026121 | Ga0207683_10587324 | Ga0207683_105873242 | 198 |
| 383 | 3300026121 | Ga0207683_10878805 | Ga0207683_108788051 | 198 |
| 384 | 3300026121 | Ga0207683_11132084 | Ga0207683_111320841 | 198 |
| 385 | 3300026142 | Ga0207698_10005482 | Ga0207698_100054824 | 198 |
| 386 | 3300026142 | Ga0207698_10103033 | Ga0207698_101030332 | 198 |
| 387 | 3300026142 | Ga0207698_10258018 | Ga0207698_102580182 | 198 |
| 388 | 3300026142 | Ga0207698_10840108 | Ga0207698_108401081 | 198 |
| 389 | 3300026142 | Ga0207698_10920678 | Ga0207698_109206782 | 198 |
| 390 | 3300027552 | Ga0209982_1024736 | Ga0209982_10247362 | 198 |
| 391 | 3300027666 | Ga0209282_1000058 | Ga0209282_100005855 | 198 |
| 392 | 3300027876 | Ga0209974_10065512 | Ga0209974_100655122 | 198 |
| 393 | 3300027907 | Ga0207428_10464857 | Ga0207428_104648571 | 198 |
| 394 | 3300028379 | Ga0268266_10193504 | Ga0268266_101935041 | 198 |
| 395 | 3300028379 | Ga0268266_10201610 | Ga0268266_102016103 | 198 |
| 396 | 3300028379 | Ga0268266_10720473 | Ga0268266_107204732 | 198 |
| 397 | 3300028380 | Ga0268265_10173695 | Ga0268265_101736953 | 198 |
| 398 | 3300028381 | Ga0268264_10086146 | Ga0268264_100861462 | 198 |
| 399 | 3300028381 | Ga0268264_10842091 | Ga0268264_108420911 | 198 |
| 400 | 3300028381 | Ga0268264_11264298 | Ga0268264_112642981 | 198 |
| 401 | 3300031456 | Ga0307513_10560870 | Ga0307513_105608701 | 198 |
| 402 | 3300031548 | Ga0307408_100127574 | Ga0307408_1001275742 | 198 |
| 403 | 3300031730 | Ga0307516_10134644 | Ga0307516_101346442 | 198 |
| 404 | 3300031731 | Ga0307405_10017876 | Ga0307405_100178762 | 198 |
| 405 | 3300031731 | Ga0307405_10085223 | Ga0307405_100852233 | 198 |
| 406 | 3300031824 | Ga0307413_10067651 | Ga0307413_100676513 | 198 |
| 407 | 3300031852 | Ga0307410_10053041 | Ga0307410_100530413 | 198 |
| 408 | 3300031852 | Ga0307410_10490375 | Ga0307410_104903752 | 198 |
| 409 | 3300031903 | Ga0307407_10621564 | Ga0307407_106215642 | 198 |
| 410 | 3300031911 | Ga0307412_10011034 | Ga0307412_100110345 | 198 |
| 411 | 3300031911 | Ga0307412_10208067 | Ga0307412_102080672 | 198 |
| 412 | 3300032002 | Ga0307416_100042037 | Ga0307416_1000420374 | 198 |
| 413 | 3300032002 | Ga0307416_100057756 | Ga0307416_1000577563 | 198 |
| 414 | 3300032002 | Ga0307416_100432724 | Ga0307416_1004327242 | 198 |
| 415 | 3300032004 | Ga0307414_10501565 | Ga0307414_105015652 | 198 |
| 416 | 3300032005 | Ga0307411_10003694 | Ga0307411_100036949 | 198 |
| 417 | 3300032005 | Ga0307411_10176984 | Ga0307411_101769843 | 198 |
| 418 | 3300032126 | Ga0307415_100018565 | Ga0307415_1000185653 | 198 |
| 419 | 3300032126 | Ga0307415_100218817 | Ga0307415_1002188172 | 198 |
| 420 | 3300035121 | Ga0373960_0099106 | Ga0373960_0099106_229_867 | 198 |
| 421 | 3300035170 | Ga0373943_0366324 | Ga0373943_0366324_35_631 | 198 |
| 422 | 3300035241 | Ga0373961_0050982 | Ga0373961_0050982_522_1160 | 198 |
| 423 | 3300039437 | Ga0436365_0448718 | Ga0436365_0448718_765_1397 | 198 |
| 424 | 3300041512 | Ga0451853_0749231 | Ga0451853_0749231_1278_1874 | 198 |
| 425 | 3300042007 | Ga0439449_0110807 | Ga0439449_0110807_72_701 | 198 |
| 426 | 3300044658 | Ga0466972_0081432 | Ga0466972_0081432_583_1179 | 198 |
| 427 | 3300046460 | Ga0495638_0031541 | Ga0495638_0031541_129_767 | 198 |
| 428 | 3300046472 | Ga0495580_0010452 | Ga0495580_0010452_5987_6619 | 198 |
| 429 | 3300046474 | Ga0495605_0002870 | Ga0495605_0002870_3426_4022 | 198 |
| 430 | 3300046491 | Ga0495584_0205475 | Ga0495584_0205475_122_748 | 198 |
| 431 | 3300046499 | Ga0495594_0042410 | Ga0495594_0042410_407_1039 | 198 |
| 432 | 3300046500 | Ga0495596_0000320 | Ga0495596_0000320_3962_4558 | 198 |
| 433 | 3300046501 | Ga0495607_0021980 | Ga0495607_0021980_23_619 | 198 |
| 434 | 3300046512 | Ga0495610_0000514 | Ga0495610_0000514_34539_35135 | 198 |
| 435 | 3300046513 | Ga0495616_0003256 | Ga0495616_0003256_4554_5150 | 198 |
| 436 | 3300046513 | Ga0495616_0005265 | Ga0495616_0005265_5493_6131 | 198 |
| 437 | 3300046518 | Ga0495631_0000455 | Ga0495631_0000455_4751_5389 | 198 |
| 438 | 3300046520 | Ga0495637_0037289 | Ga0495637_0037289_759_1397 | 198 |
| 439 | 3300046524 | Ga0495648_0012532 | Ga0495648_0012532_3222_3818 | 198 |
| 440 | 3300046525 | Ga0495663_0014664 | Ga0495663_0014664_844_1482 | 198 |
| 441 | 3300046530 | Ga0495654_0009970 | Ga0495654_0009970_1207_1845 | 198 |
| 442 | 3300046539 | Ga0495621_0008759 | Ga0495621_0008759_2142_2780 | 198 |
| 443 | 3300046542 | Ga0495597_0045030 | Ga0495597_0045030_713_1309 | 198 |
| 444 | 3300046557 | Ga0495622_0051809 | Ga0495622_0051809_187_825 | 198 |
| 445 | 3300046616 | Ga0495668_0114618 | Ga0495668_0114618_682_1320 | 198 |
| 446 | 3300046660 | Ga0495625_0022596 | Ga0495625_0022596_4201_4797 | 198 |
| 447 | 3300046665 | Ga0495661_0022023 | Ga0495661_0022023_1870_2466 | 198 |
| 448 | 3300046674 | Ga0495588_0040880 | Ga0495588_0040880_654_1292 | 198 |
| 449 | 3300046684 | Ga0495669_0146242 | Ga0495669_0146242_77_673 | 198 |
| 450 | 3300046692 | Ga0495671_0015635 | Ga0495671_0015635_3287_3883 | 198 |
| 451 | 3300047317 | Ga0495604_0003210 | Ga0495604_0003210_7029_7661 | 198 |
| 452 | 3300047320 | Ga0495672_0005431 | Ga0495672_0005431_880_1476 | 198 |
| 453 | 3300047321 | Ga0495676_0069981 | Ga0495676_0069981_898_1536 | 198 |
| 454 | 3300047447 | Ga0495685_117319 | Ga0495685_117319_154_750 | 198 |
| 455 | 3300048089 | Ga0495614_0006942 | Ga0495614_0006942_4369_5007 | 198 |
| 456 | 3300048903 | Ga0496100_0172526 | Ga0496100_0172526_617_1213 | 198 |
| 457 | 3300048904 | Ga0496101_0105844 | Ga0496101_0105844_50_682 | 198 |
| 458 | 3300048905 | Ga0496102_0003972 | Ga0496102_0003972_10893_11621 | 198 |
| 459 | 3300048905 | Ga0496102_0029946 | Ga0496102_0029946_3634_4266 | 198 |
| 460 | 3300048906 | Ga0496103_0007429 | Ga0496103_0007429_296_1024 | 198 |
| 461 | 3300048908 | Ga0496105_0102810 | Ga0496105_0102810_1562_2194 | 198 |
| 462 | 3300048909 | Ga0496106_0006216 | Ga0496106_0006216_4390_5118 | 198 |
| 463 | 3300048909 | Ga0496106_0295511 | Ga0496106_0295511_408_1004 | 198 |
| 464 | 3300048910 | Ga0496107_0072954 | Ga0496107_0072954_25_744 | 198 |
| 465 | 3300048911 | Ga0496108_0159255 | Ga0496108_0159255_951_1547 | 198 |
| 466 | 3300048911 | Ga0496108_0203755 | Ga0496108_0203755_195_854 | 198 |
| 467 | 3300048911 | Ga0496108_0344604 | Ga0496108_0344604_522_1118 | 198 |
| 468 | 3300048912 | Ga0496109_0394691 | Ga0496109_0394691_413_1009 | 198 |
| 469 | 3300048913 | Ga0496110_0145321 | Ga0496110_0145321_26_754 | 198 |
| 470 | 3300048913 | Ga0496110_0200361 | Ga0496110_0200361_236_832 | 198 |
| 471 | 3300048913 | Ga0496110_0249770 | Ga0496110_0249770_641_1273 | 198 |
| 472 | 3300048914 | Ga0496111_0210748 | Ga0496111_0210748_182_814 | 198 |
| 473 | 3300048914 | Ga0496111_0270018 | Ga0496111_0270018_406_1044 | 198 |
| 474 | 3300048919 | Ga0496116_0051071 | Ga0496116_0051071_1470_2066 | 198 |
| 475 | 3300048920 | Ga0496117_0049833 | Ga0496117_0049833_1731_2369 | 198 |
| 476 | 3300048921 | Ga0496118_0010450 | Ga0496118_0010450_6212_6850 | 198 |
| 477 | 3300048924 | Ga0496121_0068374 | Ga0496121_0068374_541_1179 | 198 |
| 478 | 3300048925 | Ga0496122_0007440 | Ga0496122_0007440_4019_4615 | 198 |
| 479 | 3300048926 | Ga0496123_0003848 | Ga0496123_0003848_3380_3976 | 198 |
| 480 | 3300048927 | Ga0496124_0040556 | Ga0496124_0040556_2679_3317 | 198 |
| 481 | 3300048928 | Ga0496125_0028991 | Ga0496125_0028991_3577_4215 | 198 |
| 482 | 3300048928 | Ga0496125_0106118 | Ga0496125_0106118_1122_1718 | 198 |
| 483 | 3300048928 | Ga0496125_0107460 | Ga0496125_0107460_1092_1730 | 198 |
| 484 | 3300048929 | Ga0496126_0164798 | Ga0496126_0164798_523_1161 | 198 |
| 485 | 3300048929 | Ga0496126_0215241 | Ga0496126_0215241_938_1534 | 198 |
| 486 | 3300049568 | Ga0501031_0006012 | Ga0501031_0006012_1276_1872 | 198 |
| 487 | 3300049568 | Ga0501031_0079890 | Ga0501031_0079890_848_1444 | 198 |
| 488 | 3300049569 | Ga0501032_0007188 | Ga0501032_0007188_6691_7287 | 198 |
| 489 | 3300049569 | Ga0501032_0188340 | Ga0501032_0188340_145_741 | 198 |
| 490 | 3300049570 | Ga0501033_0002494 | Ga0501033_0002494_11706_12302 | 198 |
| 491 | 3300049570 | Ga0501033_0010856 | Ga0501033_0010856_2377_2973 | 198 |
| 492 | 3300049571 | Ga0501034_0246253 | Ga0501034_0246253_67_663 | 198 |
| 493 | 3300049572 | Ga0501036_0001586 | Ga0501036_0001586_10638_11234 | 198 |
| 494 | 3300049572 | Ga0501036_0003940 | Ga0501036_0003940_3660_4256 | 198 |
| 495 | 3300049572 | Ga0501036_0308356 | Ga0501036_0308356_661_1257 | 198 |
| 496 | 3300049573 | Ga0501037_0097610 | Ga0501037_0097610_1090_1686 | 198 |
| 497 | 3300049574 | Ga0501038_0009918 | Ga0501038_0009918_7895_8491 | 198 |
| 498 | 3300049574 | Ga0501038_0009928 | Ga0501038_0009928_1571_2167 | 198 |
| 499 | 3300049574 | Ga0501038_0018946 | Ga0501038_0018946_2279_2875 | 198 |
| 500 | 3300049575 | Ga0501039_0075042 | Ga0501039_0075042_471_1067 | 198 |
| 501 | 3300049575 | Ga0501039_0238616 | Ga0501039_0238616_146_742 | 198 |
| 502 | 3300049576 | Ga0501040_0149646 | Ga0501040_0149646_196_792 | 198 |
| 503 | 3300049577 | Ga0501041_0203667 | Ga0501041_0203667_451_1119 | 198 |
| 504 | 3300049578 | Ga0501042_0058919 | Ga0501042_0058919_856_1452 | 198 |
| 505 | 3300049579 | Ga0501043_0031094 | Ga0501043_0031094_372_968 | 198 |
| 506 | 3300049579 | Ga0501043_0037196 | Ga0501043_0037196_339_935 | 198 |
| 507 | 3300049579 | Ga0501043_0075866 | Ga0501043_0075866_2004_2600 | 198 |
| 508 | 3300049580 | Ga0501046_0165121 | Ga0501046_0165121_555_1151 | 198 |
| 509 | 3300049580 | Ga0501046_0170478 | Ga0501046_0170478_358_996 | 198 |
| 510 | 3300049581 | Ga0501047_0020466 | Ga0501047_0020466_3744_4340 | 198 |
| 511 | 3300049582 | Ga0501048_0185479 | Ga0501048_0185479_780_1376 | 198 |
| 512 | 3300049584 | Ga0501068_0014654 | Ga0501068_0014654_1448_2044 | 198 |
| 513 | 3300049584 | Ga0501068_0300508 | Ga0501068_0300508_274_912 | 198 |
| 514 | 3300049585 | Ga0501069_0136491 | Ga0501069_0136491_245_880 | 198 |
| 515 | 3300049586 | Ga0501070_0200763 | Ga0501070_0200763_875_1471 | 198 |
| 516 | 3300049587 | Ga0501071_0028106 | Ga0501071_0028106_2077_2745 | 198 |
| 517 | 3300049588 | Ga0501072_0198079 | Ga0501072_0198079_557_1195 | 198 |
| 518 | 3300049589 | Ga0501073_0011183 | Ga0501073_0011183_1598_2236 | 198 |
| 519 | 3300049591 | Ga0501075_0053942 | Ga0501075_0053942_308_976 | 198 |
| 520 | 3300049592 | Ga0501076_0032459 | Ga0501076_0032459_569_1207 | 198 |
| 521 | 3300049593 | Ga0501077_0104164 | Ga0501077_0104164_486_1124 | 198 |
| 522 | 3300049741 | Ga0501079_0283958 | Ga0501079_0283958_639_1277 | 198 |
| 523 | 3300049742 | Ga0501080_0021094 | Ga0501080_0021094_3939_4577 | 198 |
| 524 | 3300049743 | Ga0501081_0186032 | Ga0501081_0186032_156_824 | 198 |
| 525 | 3300049822 | Ga0501035_0000504 | Ga0501035_0000504_27710_28306 | 198 |
| 526 | 3300049822 | Ga0501035_0107201 | Ga0501035_0107201_1534_2130 | 198 |
| 527 | 3300049823 | Ga0501044_0056622 | Ga0501044_0056622_786_1382 | 198 |
| 528 | 3300049823 | Ga0501044_0119489 | Ga0501044_0119489_453_1049 | 198 |
| 529 | 3300049823 | Ga0501044_0180569 | Ga0501044_0180569_231_827 | 198 |
| 530 | 3300049824 | Ga0501045_0078870 | Ga0501045_0078870_493_1161 | 198 |
| 531 | 3300049824 | Ga0501045_0124039 | Ga0501045_0124039_55_693 | 198 |
| 532 | 3300050491 | nmdc:mga00v17_1907_c1 | nmdc:mga00v17_1907_c1_1946_2563 | 198 |
| 533 | 3300050511 | nmdc:mga08y16_32273_c1 | nmdc:mga08y16_32273_c1_1455_2051 | 198 |
| 534 | 3300050511 | nmdc:mga08y16_491888_c1 | nmdc:mga08y16_491888_c1_21_665 | 198 |
| 535 | 3300050512 | nmdc:mga0n895_419762_c1 | nmdc:mga0n895_419762_c1_128_748 | 198 |
| 536 | 3300053087 | Ga0500643_004327 | Ga0500643_004327_4712_5350 | 198 |
| 537 | 3300053093 | Ga0500651_0000052 | Ga0500651_0000052_67146_67784 | 198 |
| 538 | 3300053107 | Ga0500560_157918 | Ga0500560_157918_93_731 | 198 |
| 539 | 3300053110 | Ga0500571_000036 | Ga0500571_000036_21820_22458 | 198 |
| 540 | 3300053116 | Ga0500592_014971 | Ga0500592_014971_351_989 | 198 |
| 541 | 3300053133 | Ga0500655_004623 | Ga0500655_004623_1042_1680 | 198 |
| 542 | 3300053134 | Ga0500658_0000033 | Ga0500658_0000033_37639_38277 | 198 |
| 543 | 3300053134 | Ga0500658_0000040 | Ga0500658_0000040_57954_58592 | 198 |
| 544 | 3300053136 | Ga0500559_0001653 | Ga0500559_0001653_1634_2272 | 198 |
| 545 | 3300053141 | Ga0500574_002546 | Ga0500574_002546_132_770 | 198 |
| 546 | 3300053151 | Ga0500604_0066626 | Ga0500604_0066626_208_846 | 198 |
| 547 | 3300053153 | Ga0500616_0038423 | Ga0500616_0038423_1927_2565 | 198 |
| 548 | 3300053162 | Ga0500638_010945 | Ga0500638_010945_1041_1679 | 198 |
| 549 | 3300053177 | Ga0500636_0050978 | Ga0500636_0050978_231_869 | 198 |
| 550 | 3300059424 | Ga0590075_062045 | Ga0590075_062045_238_906 | 198 |
| 551 | 3300060353 | Ga0501082_0035312 | Ga0501082_0035312_3365_4003 | 198 |
| 552 | 3300061734 | Ga0530510_0004976 | Ga0530510_0004976_7899_8537 | 198 |
| 553 | 3300061734 | Ga0530510_0306899 | Ga0530510_0306899_548_1144 | 198 |
| 554 | iso_pu_bacteria | 2599185214 | 2599625965 | 198 |
| 555 | iso_pu_bacteria | 2599185226 | 2599674953 | 198 |
| 556 | iso_pu_bacteria | 2599185227 | 2599683847 | 198 |
| 557 | iso_pu_bacteria | 2599185229 | 2599695550 | 198 |
| 558 | iso_pu_bacteria | 2738541277 | 2738722411 | 198 |
| 559 | iso_pu_bacteria | 2738543019 | 2739282775 | 198 |
| 560 | iso_pu_bacteria | 2818991446 | 2819596185 | 198 |
| 561 | iso_pu_bacteria | 2831265667 | 2831270472 | 198 |
| 562 | iso_pu_bacteria | 2885198086 | 2885199687 | 198 |
| 563 | iso_pu_bacteria | 2885211737 | 2885213338 | 198 |
| 564 | iso_pu_bacteria | 2899924645 | 2899925566 | 198 |
| 565 | iso_pu_bacteria | 2928037797 | 2928038339 | 198 |
| 566 | iso_pu_bacteria | 2928044640 | 2928046056 | 198 |
| 567 | iso_pu_bacteria | 2928051484 | 2928053755 | 198 |
| 568 | iso_pu_bacteria | 2928064002 | 2928067298 | 198 |
| 569 | iso_pu_bacteria | 2928070936 | 2928076264 | 198 |
| 570 | iso_pu_bacteria | 2928084124 | 2928085209 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.806 | 2 | 198 |
| 4o6m-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) | 0.7245 | 11 | 187 |
| 4q7c-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase | 0.7216 | 8 | 187 |
| 4q7c-assembly1.cif.gz_B | structure of af2299, a cdp-alcohol phosphotransferase | 0.6986 | 8 | 188 |
| 4mnd-assembly1.cif.gz_A-2 | crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein | 0.6744 | 7 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O94584_24_237_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.928 | 2 | 195 | 1.20.120.1760 |
| af_A0A1D8PF32_71_260_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9241 | 1 | 184 | 1.20.120.1760 |
| af_O94584_24_237_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9055 | 2 | 195 | 1.20.120.1760 |
| af_A0A1D8PF32_71_260_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8919 | 1 | 184 | 1.20.120.1760 |
| af_Q58609_4_200_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8476 | 6 | 198 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A507CX03-F1-model_v4 | RNA polymerase II transcription factor B subunit 2 | 0.9633 | 2 | 198 |
GO:0000439
GO:0001671 GO:0003690 GO:0005675 GO:0006289 GO:0008654 GO:0016020 GO:0016780 |
| AF-A0A068S3H5-F1-model_v4 | Pyruvate carboxylase | 0.9611 | 2 | 91 |
GO:0005524
GO:0008654 GO:0016020 GO:0016780 GO:0016874 GO:0046872 |
| AF-U9TLP1-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9569 | 3 | 198 |
GO:0008654
GO:0012505 GO:0016020 GO:0016780 |
| AF-A0A1I3TDV0-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9566 | 1 | 197 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A015LXI4-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9545 | 8 | 198 |
GO:0008654
GO:0012505 GO:0016020 GO:0016780 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar