F464803

General Info

Members Datasets Scaffolds Average Seq Length
570 250 1140 141

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100033575|Ga0070711_1000335756
Length 159
Sequence VVPGGLQVGESGIKWGAVDPLLGEHEHSLDEKNRLTLPSKQRAAFEDGVFVTRGLDGCLFAYPRPAWEHMAERIQSLDPLSPGSRVMQRHFFAGAAQSDLDKQGRVVIPAGLIEQAGLGREVTVAGVFDHLEIWDRAKWRQQLHEVEGSAEDVAERLAN

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
245 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 3.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.42
Rhizosphere 89.82
Stem 0
Stem Tuber 0
Unclassified 13.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100033575 3300005439 Unclassified 3417
2 JGI25405J52794_10155949 3300003911 Viruses 521
3 Ga0070658_10001449 3300005327 Bacteria 20243
4 Ga0070658_10340646 3300005327 Bacteria 1282
5 Ga0070658_10380540 3300005327 Unclassified 1211
6 Ga0070658_11490935 3300005327 Bacteria 586
7 Ga0070683_100024141 3300005329 Bacteria 5442
8 Ga0070683_100062448 3300005329 Bacteria 3464
9 Ga0070683_100091156 3300005329 Bacteria 2862
10 Ga0070683_100109839 3300005329 Bacteria 2601
11 Ga0070683_100201571 3300005329 Bacteria 1889
12 Ga0070683_101471630 3300005329 Unclassified 655
13 Ga0070680_100005133 3300005336 Bacteria 9892
14 Ga0070680_100033903 3300005336 Bacteria 4117
15 Ga0070680_100078226 3300005336 Bacteria 2724
16 Ga0070680_100087113 3300005336 Bacteria 2582
17 Ga0070682_100777299 3300005337 Unclassified 776
18 Ga0070682_100945229 3300005337 Bacteria 711
19 Ga0070660_100000987 3300005339 Bacteria 19063
20 Ga0070660_100003524 3300005339 Bacteria 10789
21 Ga0070660_100114267 3300005339 Bacteria 2150
22 Ga0070660_100284418 3300005339 Bacteria 1353
23 Ga0070660_100576707 3300005339 Bacteria 939
24 Ga0070660_100753857 3300005339 Bacteria 817
25 Ga0070660_100933003 3300005339 Bacteria 732
26 Ga0070691_10859107 3300005341 Bacteria 557
27 Ga0070661_100012623 3300005344 Bacteria 5911
28 Ga0070661_100294238 3300005344 Bacteria 1262
29 Ga0070692_11414713 3300005345 Bacteria 503
30 Ga0070659_100445727 3300005366 Bacteria 1097
31 Ga0070659_101191038 3300005366 Bacteria 673
32 Ga0070667_100021689 3300005367 Bacteria 5330
33 Ga0070709_10220693 3300005434 Bacteria 1352
34 Ga0070709_10858302 3300005434 Bacteria 716
35 Ga0070714_100228397 3300005435 Bacteria 1714
36 Ga0070714_100841581 3300005435 Bacteria 889
37 Ga0070713_100175105 3300005436 Bacteria 1925
38 Ga0070713_100915389 3300005436 Bacteria 844
39 Ga0070713_101982622 3300005436 Bacteria 565
40 Ga0070711_100043703 3300005439 Bacteria 3036
41 Ga0070711_100756266 3300005439 Unclassified 822
42 Ga0070711_102065253 3300005439 Bacteria 502
43 Ga0070694_100269590 3300005444 Bacteria 1294
44 Ga0070708_100049681 3300005445 Bacteria 3711
45 Ga0070663_100415450 3300005455 Bacteria 1102
46 Ga0070681_10003201 3300005458 Bacteria 15251
47 Ga0070681_10004684 3300005458 Bacteria 13081
48 Ga0070681_10019124 3300005458 Bacteria 6855
49 Ga0070681_10133570 3300005458 Bacteria 2413
50 Ga0070681_10264839 3300005458 Bacteria 1630
51 Ga0070681_10310656 3300005458 Bacteria 1486
52 Ga0070681_10396769 3300005458 Bacteria 1291
53 Ga0070706_100169905 3300005467 Bacteria 2036
54 Ga0070706_100848230 3300005467 Bacteria 845
55 Ga0070698_100386289 3300005471 Bacteria 1333
56 Ga0070698_100411237 3300005471 Bacteria 1287
57 Ga0070679_100001995 3300005530 Bacteria 18331
58 Ga0070679_100015162 3300005530 Bacteria 7406
59 Ga0070679_100132429 3300005530 Bacteria 2474
60 Ga0070679_100335359 3300005530 Bacteria 1460
61 Ga0070679_100617232 3300005530 Bacteria 1027
62 Ga0070679_101123969 3300005530 Bacteria 730
63 Ga0070679_101583493 3300005530 Unclassified 603
64 Ga0070684_100002106 3300005535 Bacteria 14655
65 Ga0070684_100186520 3300005535 Bacteria 1886
66 Ga0070684_100299128 3300005535 Bacteria 1476
67 Ga0070684_100316769 3300005535 Bacteria 1432
68 Ga0070684_100504803 3300005535 Bacteria 1120
69 Ga0070684_100535106 3300005535 Bacteria 1086
70 Ga0068853_100264356 3300005539 Bacteria 1583
71 Ga0070696_100093087 3300005546 Bacteria 2149
72 Ga0070696_101292701 3300005546 Bacteria 619
73 Ga0070665_100082096 3300005548 Bacteria 3228
74 Ga0068855_100009118 3300005563 Bacteria 11985
75 Ga0068855_100014710 3300005563 Bacteria 9428
76 Ga0068855_100020718 3300005563 Bacteria 7886
77 Ga0068855_100110948 3300005563 Bacteria 3148
78 Ga0068855_100208951 3300005563 Bacteria 2194
79 Ga0068855_100330673 3300005563 Bacteria 1682
80 Ga0068855_100536054 3300005563 Bacteria 1268
81 Ga0068855_102292429 3300005563 Bacteria 540
82 Ga0068857_100121709 3300005577 Unclassified 2350
83 Ga0068857_101664263 3300005577 Unclassified 623
84 Ga0068854_101104981 3300005578 Bacteria 706
85 Ga0068856_100036588 3300005614 Bacteria 4813
86 Ga0068856_100206811 3300005614 Bacteria 1977
87 Ga0068856_101430604 3300005614 Unclassified 705
88 Ga0070702_100861122 3300005615 Unclassified 706
89 Ga0068852_100061117 3300005616 Bacteria 3273
90 Ga0068852_100500558 3300005616 Bacteria 1210
91 Ga0068852_100822515 3300005616 Bacteria 944
92 Ga0068852_101197737 3300005616 Bacteria 780
93 Ga0068851_10126285 3300005834 Bacteria 1379
94 Ga0081455_10112510 3300005937 Bacteria 2161
95 Ga0070717_10043876 3300006028 Bacteria 3651
96 Ga0070716_100379598 3300006173 Bacteria 1010
97 Ga0070712_100071543 3300006175 Bacteria 2482
98 Ga0070712_100229493 3300006175 Bacteria 1474
99 Ga0070712_100382659 3300006175 Bacteria 1159
100 Ga0097621_100173069 3300006237 Bacteria 1862
101 Ga0068871_100380079 3300006358 Bacteria 1254
102 Ga0075428_100911875 3300006844 Unclassified 932
103 Ga0075433_10079382 3300006852 Bacteria 2892
104 Ga0075434_100082418 3300006871 Bacteria 3214
105 Ga0075434_100469081 3300006871 Bacteria 1280
106 Ga0075436_101139609 3300006914 Bacteria 588
107 Ga0075435_100362723 3300007076 Bacteria 1243
108 Ga0105240_10044103 3300009093 Bacteria 5670
109 Ga0105240_10410527 3300009093 Bacteria 1523
110 Ga0105240_10431317 3300009093 Bacteria 1479
111 Ga0105240_11152267 3300009093 Bacteria 823
112 Ga0105240_11457322 3300009093 Bacteria 719
113 Ga0105240_11549704 3300009093 Bacteria 694
114 Ga0105245_10260938 3300009098 Bacteria 1686
115 Ga0105245_10924941 3300009098 Bacteria 914
116 Ga0114129_10074307 3300009147 Bacteria 4735
117 Ga0114129_10649666 3300009147 Bacteria 1362
118 Ga0105241_10794956 3300009174 Bacteria 871
119 Ga0105241_10968419 3300009174 Unclassified 794
120 Ga0105242_10693700 3300009176 Unclassified 995
121 Ga0105242_11892589 3300009176 Unclassified 637
122 Ga0105248_10766734 3300009177 Bacteria 1089
123 Ga0105237_11464839 3300009545 Unclassified 689
124 Ga0105238_10553560 3300009551 Bacteria 1155
125 Ga0105239_10126011 3300010375 Bacteria 2846
126 Ga0105239_11753558 3300010375 Bacteria 719
127 Ga0157338_1026681 3300012515 Unclassified 711
128 Ga0157373_10312011 3300013100 Bacteria 1118
129 Ga0157371_10306732 3300013102 Bacteria 1150
130 Ga0157370_10011042 3300013104 Bacteria 9471
131 Ga0157370_10016302 3300013104 Bacteria 7528
132 Ga0157370_10064632 3300013104 Bacteria 3463
133 Ga0157370_10189865 3300013104 Bacteria 1907
134 Ga0157370_10366013 3300013104 Bacteria 1329
135 Ga0157369_10008335 3300013105 Bacteria 11881
136 Ga0157369_10009744 3300013105 Bacteria 10986
137 Ga0157369_10014825 3300013105 Bacteria 8795
138 Ga0157369_10094474 3300013105 Bacteria 3192
139 Ga0157369_10173236 3300013105 Bacteria 2273
140 Ga0157369_10196521 3300013105 Bacteria 2118
141 Ga0157369_10895423 3300013105 Unclassified 910
142 Ga0157374_10388707 3300013296 Bacteria 1390
143 Ga0157374_10883511 3300013296 Unclassified 911
144 Ga0157378_10273640 3300013297 Bacteria 1625
145 Ga0157372_10178075 3300013307 Bacteria 2461
146 Ga0157372_10390622 3300013307 Bacteria 1621
147 Ga0157372_10729296 3300013307 Unclassified 1153
148 Ga0157372_11278025 3300013307 Unclassified 847
149 Ga0157375_10331121 3300013308 Bacteria 1688
150 Ga0157375_10714343 3300013308 Bacteria 1155
151 Ga0182008_10055450 3300014497 Bacteria 1960
152 Ga0182008_10209013 3300014497 Bacteria 995
153 Ga0157376_10142382 3300014969 Bacteria 2153
154 Ga0157376_10699101 3300014969 Bacteria 1019
155 Ga0182006_1241420 3300015261 Bacteria 594
156 Ga0182007_10095210 3300015262 Bacteria 982
157 Ga0182005_1251454 3300015265 Unclassified 547
158 Ga0197907_10923657 3300020069 Bacteria 827
159 Ga0197907_11480162 3300020069 Bacteria 2548
160 Ga0206356_10083395 3300020070 Bacteria 1198
161 Ga0206356_10150529 3300020070 Unclassified 1583
162 Ga0206356_10471932 3300020070 Unclassified 630
163 Ga0206356_10487161 3300020070 Unclassified 1603
164 Ga0206356_11433091 3300020070 Bacteria 1430
165 Ga0206356_11437141 3300020070 Bacteria 1560
166 Ga0206349_1403473 3300020075 Unclassified 682
167 Ga0206355_1266765 3300020076 Bacteria 954
168 Ga0206350_10155568 3300020080 Unclassified 512
169 Ga0206354_10077757 3300020081 Bacteria 1054
170 Ga0206354_10535991 3300020081 Unclassified 643
171 Ga0206354_10749136 3300020081 Bacteria 1129
172 Ga0206354_11534743 3300020081 Bacteria 4768
173 Ga0206353_10285970 3300020082 Bacteria 8659
174 Ga0206353_10688407 3300020082 Bacteria 6713
175 Ga0206353_10725415 3300020082 Bacteria 3196
176 Ga0206353_11340468 3300020082 Bacteria 911
177 Ga0213873_10216895 3300021358 Unclassified 598
178 Ga0213874_10079705 3300021377 Bacteria 1059
179 Ga0213876_10436084 3300021384 Bacteria 697
180 Ga0213876_10797635 3300021384 Unclassified 503
181 Ga0207692_10377745 3300025898 Bacteria 879
182 Ga0207699_10320702 3300025906 Bacteria 1087
183 Ga0207699_10505019 3300025906 Unclassified 873
184 Ga0207705_10041926 3300025909 Bacteria 3284
185 Ga0207705_10058898 3300025909 Bacteria 2771
186 Ga0207705_10367839 3300025909 Bacteria 1109
187 Ga0207684_10354408 3300025910 Bacteria 1263
188 Ga0207684_10685533 3300025910 Bacteria 872
189 Ga0207654_10644381 3300025911 Unclassified 758
190 Ga0207707_10016739 3300025912 Bacteria 6389
191 Ga0207707_10083988 3300025912 Bacteria 2780
192 Ga0207707_10349970 3300025912 Unclassified 1273
193 Ga0207695_10320370 3300025913 Bacteria 1440
194 Ga0207695_11276292 3300025913 Bacteria 615
195 Ga0207671_11224717 3300025914 Bacteria 587
196 Ga0207693_10074807 3300025915 Bacteria 2652
197 Ga0207693_10197300 3300025915 Bacteria 1583
198 Ga0207693_10201446 3300025915 Bacteria 1565
199 Ga0207663_10026060 3300025916 Bacteria 3389
200 Ga0207663_10240498 3300025916 Bacteria 1328
201 Ga0207663_10758026 3300025916 Bacteria 771
202 Ga0207660_10045690 3300025917 Bacteria 3086
203 Ga0207660_10081042 3300025917 Bacteria 2384
204 Ga0207660_10221114 3300025917 Bacteria 1486
205 Ga0207660_10483451 3300025917 Bacteria 1004
206 Ga0207657_10000046 3300025919 Bacteria 113887
207 Ga0207657_10024169 3300025919 Bacteria 5639
208 Ga0207657_10484052 3300025919 Bacteria 970
209 Ga0207649_11011513 3300025920 Unclassified 654
210 Ga0207652_10031048 3300025921 Bacteria 4483
211 Ga0207652_10075474 3300025921 Bacteria 2938
212 Ga0207652_10093410 3300025921 Bacteria 2647
213 Ga0207652_10211054 3300025921 Bacteria 1748
214 Ga0207652_11300069 3300025921 Unclassified 630
215 Ga0207646_11375008 3300025922 Unclassified 615
216 Ga0207694_10265025 3300025924 Bacteria 1408
217 Ga0207694_10665942 3300025924 Bacteria 877
218 Ga0207687_10146630 3300025927 Bacteria 1796
219 Ga0207700_10282644 3300025928 Unclassified 1428
220 Ga0207700_11235838 3300025928 Unclassified 666
221 Ga0207664_10482069 3300025929 Bacteria 1109
222 Ga0207664_10668183 3300025929 Bacteria 934
223 Ga0207664_10815094 3300025929 Unclassified 839
224 Ga0207664_11775617 3300025929 Bacteria 539
225 Ga0207644_11871687 3300025931 Unclassified 502
226 Ga0207690_10115842 3300025932 Bacteria 1937
227 Ga0207690_10286186 3300025932 Bacteria 1285
228 Ga0207665_10315778 3300025939 Bacteria 1171
229 Ga0207711_10581163 3300025941 Bacteria 1045
230 Ga0207689_10579906 3300025942 Bacteria 943
231 Ga0207661_10074964 3300025944 Bacteria 2775
232 Ga0207661_10133014 3300025944 Bacteria 2133
233 Ga0207661_10316423 3300025944 Bacteria 1402
234 Ga0207661_10522763 3300025944 Bacteria 1085
235 Ga0207661_10594469 3300025944 Bacteria 1015
236 Ga0207661_11156181 3300025944 Unclassified 712
237 Ga0207679_10953994 3300025945 Bacteria 786
238 Ga0207667_10062676 3300025949 Bacteria 3887
239 Ga0207667_10064407 3300025949 Bacteria 3827
240 Ga0207667_10184165 3300025949 Bacteria 2144
241 Ga0207667_10201892 3300025949 Bacteria 2039
242 Ga0207667_10307208 3300025949 Bacteria 1620
243 Ga0207667_10340274 3300025949 Bacteria 1531
244 Ga0207667_10383093 3300025949 Bacteria 1433
245 Ga0207667_10828900 3300025949 Bacteria 920
246 Ga0207651_10974404 3300025960 Bacteria 757
247 Ga0207658_10014868 3300025986 Bacteria 5333
248 Ga0207639_10685063 3300026041 Bacteria 950
249 Ga0207639_11524272 3300026041 Bacteria 627
250 Ga0207678_10920349 3300026067 Bacteria 773
251 Ga0207678_11612253 3300026067 Unclassified 571
252 Ga0207702_10187588 3300026078 Bacteria 1908
253 Ga0207674_10080828 3300026116 Bacteria 3253
254 Ga0207698_10150953 3300026142 Bacteria 2016
255 Ga0207698_12451749 3300026142 Unclassified 532
256 Ga0268266_10155440 3300028379 Bacteria 2065
257 Ga0265318_10320562 3300028577 Unclassified 566
258 Ga0265338_10008970 3300028800 Bacteria 12029
259 Ga0265338_10090933 3300028800 Bacteria 2524
260 Ga0265330_10024688 3300031235 Bacteria 2726
261 Ga0265320_10057643 3300031240 Bacteria 1863
262 Ga0265320_10263142 3300031240 Bacteria 764
263 Ga0265340_10259305 3300031247 Bacteria 774
264 Ga0265339_10049329 3300031249 Bacteria 2306
265 Ga0265327_10004459 3300031251 Bacteria 12377
266 Ga0265316_10003711 3300031344 Bacteria 15368
267 Ga0265313_10015692 3300031595 Bacteria 4393
268 Ga0265314_10003383 3300031711 Bacteria 15460
269 Ga0265314_10681446 3300031711 Bacteria 521
270 Ga0265342_10025737 3300031712 Bacteria 3694
271 Ga0307409_100249452 3300031995 Bacteria 1622
272 Ga0307416_102659985 3300032002 Bacteria 597
273 Ga0307415_100511244 3300032126 Bacteria 1052
274 Ga0373926_0016043 3300035083 Bacteria 2559
275 Ga0373934_0332888 3300035086 Unclassified 631
276 Ga0373944_0029015 3300035089 Bacteria 1651
277 Ga0373936_0244090 3300035113 Bacteria 801
278 Ga0373945_0027190 3300035116 Bacteria 1997
279 Ga0373953_0018419 3300035117 Bacteria 2584
280 Ga0373954_0113328 3300035118 Bacteria 1313
281 Ga0373943_0001192 3300035170 Bacteria 11613
282 Ga0373943_0002076 3300035170 Bacteria 9095
283 Ga0373946_0008675 3300035171 Bacteria 3733
284 Ga0373946_0012412 3300035171 Unclassified 3189
285 Ga0373942_0103722 3300035207 Bacteria 872
286 Ga0373935_0029018 3300035692 Bacteria 3422
287 Ga0373935_0486496 3300035692 Bacteria 895
288 Ga0373933_0556889 3300035724 Unclassified 752
289 Ga0373947_0006355 3300035725 Bacteria 6865
290 Ga0373947_0065448 3300035725 Bacteria 2217
291 Ga0373947_0674184 3300035725 Bacteria 705
292 Ga0373937_0033772 3300036401 Bacteria 4649
293 Ga0373925_0005621 3300037068 Bacteria 9327
294 Ga0373925_0005903 3300037068 Bacteria 9082
295 Ga0395899_0105959 3300037312 Bacteria 2024
296 Ga0395899_0108061 3300037312 Bacteria 2002
297 Ga0395899_0236483 3300037312 Bacteria 1259
298 Ga0395899_0975299 3300037312 Bacteria 512
299 Ga0395900_0036672 3300037418 Bacteria 5055
300 Ga0395900_0095726 3300037418 Bacteria 3050
301 Ga0395900_0687649 3300037418 Bacteria 957
302 Ga0395900_0887791 3300037418 Bacteria 815
303 Ga0395898_0007189 3300037466 Bacteria 11818
304 Ga0395898_0029790 3300037466 Bacteria 5463
305 Ga0395898_0236587 3300037466 Bacteria 1742
306 Ga0395898_0459246 3300037466 Bacteria 1212
307 Ga0395898_0523626 3300037466 Bacteria 1127
308 Ga0395898_0600839 3300037466 Bacteria 1043
309 Ga0395898_1005412 3300037466 Bacteria 770
310 Ga0395905_0030028 3300037471 Bacteria 5123
311 Ga0395905_0053635 3300037471 Bacteria 3773
312 Ga0395905_0096992 3300037471 Bacteria 2768
313 Ga0395905_0660542 3300037471 Bacteria 947
314 Ga0395901_0045312 3300038443 Bacteria 4563
315 Ga0395901_0084737 3300038443 Unclassified 3312
316 Ga0395901_0375631 3300038443 Bacteria 1464
317 Ga0395901_0382959 3300038443 Bacteria 1447
318 Ga0395901_0641448 3300038443 Unclassified 1066
319 Ga0436365_0102858 3300039437 Bacteria 2559
320 Ga0436365_1489176 3300039437 Bacteria 895
321 Ga0436365_1507410 3300039437 Unclassified 917
322 Ga0436363_0092653 3300039450 Bacteria 1258
323 Ga0436363_0795855 3300039450 Bacteria 578
324 Ga0436362_0999390 3300039453 Bacteria 1374
325 Ga0451853_0231954 3300041512 Bacteria 1262
326 Ga0451853_3542244 3300041512 Bacteria 1258
327 Ga0439448_0255674 3300042005 Bacteria 619
328 Ga0450903_047506 3300042138 Unclassified 631
329 Ga0466965_0370297 3300044683 Bacteria 787
330 Ga0466966_0002668 3300044684 Bacteria 11689
331 Ga0466966_0015061 3300044684 Bacteria 5115
332 Ga0466961_0030556 3300044693 Bacteria 3462
333 Ga0466961_0030653 3300044693 Bacteria 3456
334 Ga0466961_0135844 3300044693 Unclassified 1541
335 Ga0466963_0006240 3300044694 Bacteria 7041
336 Ga0466963_0020167 3300044694 Bacteria 4190
337 Ga0466963_0030010 3300044694 Bacteria 3504
338 Ga0466963_0106986 3300044694 Unclassified 1918
339 Ga0466963_0142245 3300044694 Bacteria 1662
340 Ga0466963_0297469 3300044694 Bacteria 1135
341 Ga0466963_0322824 3300044694 Unclassified 1086
342 Ga0466963_0635487 3300044694 Bacteria 753
343 Ga0466963_0770975 3300044694 Bacteria 678
344 Ga0466964_0000812 3300044706 Bacteria 10208
345 Ga0466964_0004511 3300044706 Bacteria 5142
346 Ga0466964_0026930 3300044706 Bacteria 2253
347 Ga0466964_0451446 3300044706 Bacteria 682
348 Ga0466971_0002342 3300044719 Bacteria 8008
349 Ga0466971_0455906 3300044719 Bacteria 627
350 Ga0466968_0091140 3300044735 Unclassified 1351
351 Ga0466968_0229624 3300044735 Bacteria 876
352 Ga0466970_0011268 3300044765 Bacteria 4556
353 Ga0466970_0050461 3300044765 Unclassified 2219
354 Ga0466957_0003835 3300044842 Bacteria 8311
355 Ga0466957_0163449 3300044842 Bacteria 1447
356 Ga0466957_0220008 3300044842 Unclassified 1253
357 Ga0466957_0272744 3300044842 Bacteria 1130
358 Ga0466957_0421676 3300044842 Unclassified 916
359 Ga0466960_0062863 3300044901 Bacteria 1826
360 Ga0466960_0069951 3300044901 Bacteria 1745
361 Ga0466960_0090955 3300044901 Bacteria 1555
362 Ga0466959_0012278 3300045049 Bacteria 6184
363 Ga0466959_0042887 3300045049 Unclassified 3336
364 Ga0466959_0270321 3300045049 Bacteria 1168
365 Ga0466959_0644189 3300045049 Unclassified 711
366 Ga0451576_0213770 3300045051 Unclassified 2014
367 Ga0466958_0000505 3300045836 Bacteria 16330
368 Ga0466958_0049583 3300045836 Bacteria 2540
369 Ga0466958_0074460 3300045836 Bacteria 2081
370 Ga0466958_0203651 3300045836 Bacteria 1260
371 Ga0466967_0004727 3300045976 Bacteria 9261
372 Ga0466967_0022552 3300045976 Bacteria 5141
373 Ga0466967_0023838 3300045976 Bacteria 5021
374 Ga0466967_0028605 3300045976 Bacteria 4655
375 Ga0466967_0039147 3300045976 Bacteria 4073
376 Ga0466967_0049677 3300045976 Bacteria 3669
377 Ga0466967_0109553 3300045976 Bacteria 2535
378 Ga0466967_0122997 3300045976 Bacteria 2400
379 Ga0466967_0127566 3300045976 Bacteria 2358
380 Ga0466967_0149693 3300045976 Bacteria 2180
381 Ga0466967_0153850 3300045976 Bacteria 2152
382 Ga0466967_0170454 3300045976 Bacteria 2047
383 Ga0466967_0261340 3300045976 Bacteria 1656
384 Ga0466967_0408129 3300045976 Bacteria 1322
385 Ga0466967_0746956 3300045976 Bacteria 970
386 Ga0495592_0071613 3300046454 Bacteria 2523
387 Ga0495592_0384538 3300046454 Bacteria 892
388 Ga0495603_0032555 3300046455 Bacteria 3137
389 Ga0495603_0207860 3300046455 Bacteria 1131
390 Ga0495629_0000593 3300046459 Bacteria 29449
391 Ga0495641_0001017 3300046461 Bacteria 24111
392 Ga0495641_0047274 3300046461 Bacteria 1976
393 Ga0495641_0185182 3300046461 Unclassified 932
394 Ga0495651_0093410 3300046462 Bacteria 2252
395 Ga0495651_0171346 3300046462 Bacteria 1545
396 Ga0495651_0195355 3300046462 Bacteria 1420
397 Ga0495653_0013634 3300046463 Bacteria 6624
398 Ga0495653_0060222 3300046463 Bacteria 2877
399 Ga0495582_0000056 3300046473 Bacteria 57084
400 Ga0495582_0237103 3300046473 Bacteria 1045
401 Ga0495639_0002894 3300046475 Bacteria 7474
402 Ga0495662_0023847 3300046476 Bacteria 2954
403 Ga0495662_0062403 3300046476 Bacteria 1800
404 Ga0495662_0151112 3300046476 Bacteria 1144
405 Ga0495664_0209888 3300046477 Bacteria 1179
406 Ga0495664_0264559 3300046477 Bacteria 1039
407 Ga0495664_0422800 3300046477 Bacteria 799
408 Ga0495594_0141682 3300046499 Bacteria 1364
409 Ga0495608_0007181 3300046511 Bacteria 7876
410 Ga0495608_0013145 3300046511 Bacteria 5745
411 Ga0495608_0034997 3300046511 Bacteria 3389
412 Ga0495618_0008086 3300046514 Bacteria 6369
413 Ga0495628_0018890 3300046516 Bacteria 5705
414 Ga0495628_0075779 3300046516 Bacteria 2619
415 Ga0495630_0008240 3300046517 Bacteria 7486
416 Ga0495630_0125469 3300046517 Bacteria 1948
417 Ga0495630_0433103 3300046517 Bacteria 1007
418 Ga0495666_0049482 3300046526 Bacteria 2021
419 Ga0495652_0049329 3300046529 Bacteria 3605
420 Ga0495652_0196507 3300046529 Bacteria 1535
421 Ga0495665_0000364 3300046531 Bacteria 22881
422 Ga0495640_0005466 3300046533 Bacteria 10109
423 Ga0495640_0025293 3300046533 Bacteria 4308
424 Ga0495640_0056826 3300046533 Bacteria 2672
425 Ga0495586_0244415 3300046535 Unclassified 1023
426 Ga0495586_0467775 3300046535 Unclassified 727
427 Ga0495587_0258991 3300046536 Bacteria 977
428 Ga0495645_0123276 3300046543 Unclassified 1823
429 Ga0495645_0146019 3300046543 Bacteria 1647
430 Ga0495667_0009765 3300046559 Bacteria 6502
431 Ga0495667_0033924 3300046559 Bacteria 3414
432 Ga0495667_0040731 3300046559 Bacteria 3083
433 Ga0495667_0044019 3300046559 Bacteria 2956
434 Ga0495634_0107716 3300046642 Bacteria 1794
435 Ga0495634_0236762 3300046642 Unclassified 1121
436 Ga0495634_0437950 3300046642 Unclassified 772
437 Ga0495635_0038948 3300046663 Bacteria 3291
438 Ga0495635_0059851 3300046663 Bacteria 2619
439 Ga0495635_0201113 3300046663 Bacteria 1351
440 Ga0495588_0524163 3300046674 Unclassified 621
441 Ga0495657_0004160 3300046675 Bacteria 11591
442 Ga0495657_0224763 3300046675 Bacteria 1137
443 Ga0495657_0308966 3300046675 Unclassified 942
444 Ga0495599_0128922 3300046678 Bacteria 1571
445 Ga0495623_0067537 3300046679 Bacteria 2231
446 Ga0495623_0302747 3300046679 Bacteria 883
447 Ga0495623_0374611 3300046679 Bacteria 771
448 Ga0495646_0042147 3300046680 Bacteria 2802
449 Ga0495646_0363052 3300046680 Unclassified 757
450 Ga0495646_0721628 3300046680 Bacteria 500
451 Ga0495647_0035675 3300046681 Bacteria 1868
452 Ga0495658_0000615 3300046683 Bacteria 19383
453 Ga0495658_0262244 3300046683 Bacteria 1088
454 Ga0495613_0000401 3300046689 Bacteria 37127
455 Ga0495613_0213630 3300046689 Bacteria 1356
456 Ga0495613_0388076 3300046689 Bacteria 954
457 Ga0495624_0023782 3300046690 Bacteria 4037
458 Ga0495600_0004803 3300046809 Bacteria 8112
459 Ga0495600_0067588 3300046809 Bacteria 2336
460 Ga0495600_0180707 3300046809 Bacteria 1359
461 Ga0495581_0004589 3300047315 Bacteria 7980
462 Ga0495604_0010914 3300047317 Bacteria 7213
463 Ga0495604_0075468 3300047317 Bacteria 2538
464 Ga0495674_0003725 3300047319 Bacteria 14827
465 Ga0495674_0018307 3300047319 Bacteria 6522
466 Ga0495674_0026429 3300047319 Bacteria 5311
467 Ga0495676_0047160 3300047321 Bacteria 3487
468 Ga0495676_0161950 3300047321 Bacteria 1582
469 Ga0495680_0000973 3300047322 Bacteria 31826
470 Ga0495680_0004249 3300047322 Bacteria 13751
471 Ga0495680_0010742 3300047322 Bacteria 8158
472 Ga0495680_0119639 3300047322 Bacteria 1945
473 Ga0495675_0280187 3300047444 Bacteria 994
474 Ga0495675_0586305 3300047444 Bacteria 633
475 Ga0495684_0010685 3300047471 Bacteria 7097
476 Ga0495684_0011390 3300047471 Bacteria 6867
477 Ga0495684_0048807 3300047471 Bacteria 3236
478 Ga0495593_0001438 3300047673 Bacteria 13969
479 Ga0495602_0082829 3300048088 Bacteria 2690
480 Ga0495602_0488765 3300048088 Bacteria 862
481 Ga0495614_0000769 3300048089 Bacteria 13583
482 Ga0496100_0002119 3300048903 Bacteria 9990
483 Ga0496100_0004895 3300048903 Bacteria 7157
484 Ga0496101_0000652 3300048904 Bacteria 20936
485 Ga0496101_0002648 3300048904 Bacteria 10996
486 Ga0496101_0464991 3300048904 Bacteria 998
487 Ga0496102_0001966 3300048905 Bacteria 17736
488 Ga0496102_0082371 3300048905 Bacteria 2967
489 Ga0496102_0300921 3300048905 Bacteria 1512
490 Ga0496102_1362836 3300048905 Bacteria 628
491 Ga0496103_0133440 3300048906 Bacteria 1586
492 Ga0496103_0301922 3300048906 Bacteria 1030
493 Ga0496104_0113102 3300048907 Bacteria 2603
494 Ga0496104_1665051 3300048907 Unclassified 540
495 Ga0496105_0000642 3300048908 Bacteria 23393
496 Ga0496105_0309519 3300048908 Bacteria 1268
497 Ga0496106_0029427 3300048909 Bacteria 4093
498 Ga0496106_0057208 3300048909 Bacteria 2949
499 Ga0496106_0375804 3300048909 Bacteria 1142
500 Ga0496107_0389539 3300048910 Bacteria 1036
501 Ga0496108_0071996 3300048911 Bacteria 2917
502 Ga0496108_0394499 3300048911 Bacteria 1209
503 Ga0496109_0004096 3300048912 Bacteria 12180
504 Ga0496109_0039391 3300048912 Bacteria 4277
505 Ga0496109_0783273 3300048912 Unclassified 892
506 Ga0496109_1207807 3300048912 Bacteria 693
507 Ga0496110_0063330 3300048913 Bacteria 3267
508 Ga0496110_0748749 3300048913 Bacteria 880
509 Ga0496111_0026556 3300048914 Bacteria 4090
510 Ga0496111_0202191 3300048914 Bacteria 1477
511 Ga0496112_0007203 3300048915 Bacteria 9855
512 Ga0496112_0082443 3300048915 Bacteria 3181
513 Ga0496112_0100213 3300048915 Bacteria 2866
514 Ga0496112_0850981 3300048915 Bacteria 835
515 Ga0496113_0154959 3300048916 Bacteria 1809
516 Ga0496113_0373631 3300048916 Bacteria 1144
517 Ga0496113_0695041 3300048916 Bacteria 812
518 Ga0496113_0829303 3300048916 Bacteria 734
519 Ga0496114_0002803 3300048917 Bacteria 13357
520 Ga0496114_0014099 3300048917 Bacteria 6408
521 Ga0496114_0222407 3300048917 Bacteria 1657
522 Ga0496114_0864752 3300048917 Bacteria 785
523 Ga0496115_0063609 3300048918 Bacteria 2977
524 Ga0496115_0110041 3300048918 Bacteria 2263
525 Ga0496115_0178210 3300048918 Bacteria 1757
526 Ga0496115_0251453 3300048918 Bacteria 1455
527 Ga0496115_0349101 3300048918 Bacteria 1207
528 Ga0496115_0669495 3300048918 Bacteria 819
529 Ga0496115_1108899 3300048918 Unclassified 599
530 Ga0501032_0420893 3300049569 Bacteria 857
531 Ga0501036_1001983 3300049572 Bacteria 684
532 Ga0501047_0140043 3300049581 Bacteria 2298
533 Ga0501067_0015110 3300049583 Bacteria 4272
534 Ga0501068_0361723 3300049584 Unclassified 933
535 Ga0501069_0012758 3300049585 Bacteria 4473
536 Ga0501069_0845924 3300049585 Unclassified 555
537 Ga0501070_0001321 3300049586 Bacteria 22161
538 Ga0501070_1217080 3300049586 Bacteria 577
539 Ga0501074_0100754 3300049590 Bacteria 2067
540 Ga0501074_0950085 3300049590 Unclassified 605
541 Ga0501074_1131532 3300049590 Unclassified 549
542 Ga0501076_0789888 3300049592 Bacteria 783
543 Ga0501080_0049253 3300049742 Bacteria 3922
544 Ga0501080_0211277 3300049742 Bacteria 1778
545 Ga0501080_0258985 3300049742 Bacteria 1585
546 Ga0501080_0964790 3300049742 Bacteria 741
547 Ga0501044_0523892 3300049823 Bacteria 1085
548 Ga0501044_0733644 3300049823 Bacteria 871
549 nmdc:mga05p37_531835_c1 3300050507 Bacteria 1342
550 nmdc:mga05p37_86280_c1 3300050507 Bacteria 3868
551 nmdc:mga0n895_26436_c1 3300050512 Bacteria 5497
552 nmdc:mga0n895_55289_c1 3300050512 Bacteria 3906
553 nmdc:mga0rr50_11001_c1 3300050513 Bacteria 5769
554 nmdc:mga0a205_143479_c2 3300050515 Bacteria 1325
555 nmdc:mga0a205_55705_c1 3300050515 Bacteria 3818
556 Ga0495601_0047404 3300053077 Bacteria 2705
557 Ga0495601_0325640 3300053077 Bacteria 1000
558 Ga0495612_0260752 3300053078 Bacteria 772
559 Ga0495655_0000685 3300053083 Bacteria 5427
560 Ga0495595_0001393 3300053084 Bacteria 9382
561 Ga0495595_0003449 3300053084 Bacteria 6271
562 Ga0495595_0203878 3300053084 Unclassified 985
563 Ga0495619_0000860 3300053085 Bacteria 19904
564 Ga0495619_0011590 3300053085 Bacteria 5555
565 Ga0495619_0068354 3300053085 Bacteria 2373
566 Ga0501084_0279804 3300054114 Bacteria 1409
567 Ga0466962_0003840 3300061719 Bacteria 7179
568 Ga0466962_0014176 3300061719 Bacteria 3840
569 Ga0466962_0036636 3300061719 Bacteria 2348
570 Ga0530510_0487069 3300061734 Bacteria 934
571 Ga0070711_100033575
572 JGI25405J52794_10155949
573 Ga0070658_10001449
574 Ga0070658_10340646
575 Ga0070658_10380540
576 Ga0070658_11490935
577 Ga0070683_100024141
578 Ga0070683_100062448
579 Ga0070683_100091156
580 Ga0070683_100109839
581 Ga0070683_100201571
582 Ga0070683_101471630
583 Ga0070680_100005133
584 Ga0070680_100033903
585 Ga0070680_100078226
586 Ga0070680_100087113
587 Ga0070682_100777299
588 Ga0070682_100945229
589 Ga0070660_100000987
590 Ga0070660_100003524
591 Ga0070660_100114267
592 Ga0070660_100284418
593 Ga0070660_100576707
594 Ga0070660_100753857
595 Ga0070660_100933003
596 Ga0070691_10859107
597 Ga0070661_100012623
598 Ga0070661_100294238
599 Ga0070692_11414713
600 Ga0070659_100445727
601 Ga0070659_101191038
602 Ga0070667_100021689
603 Ga0070709_10220693
604 Ga0070709_10858302
605 Ga0070714_100228397
606 Ga0070714_100841581
607 Ga0070713_100175105
608 Ga0070713_100915389
609 Ga0070713_101982622
610 Ga0070711_100043703
611 Ga0070711_100756266
612 Ga0070711_102065253
613 Ga0070694_100269590
614 Ga0070708_100049681
615 Ga0070663_100415450
616 Ga0070681_10003201
617 Ga0070681_10004684
618 Ga0070681_10019124
619 Ga0070681_10133570
620 Ga0070681_10264839
621 Ga0070681_10310656
622 Ga0070681_10396769
623 Ga0070706_100169905
624 Ga0070706_100848230
625 Ga0070698_100386289
626 Ga0070698_100411237
627 Ga0070679_100001995
628 Ga0070679_100015162
629 Ga0070679_100132429
630 Ga0070679_100335359
631 Ga0070679_100617232
632 Ga0070679_101123969
633 Ga0070679_101583493
634 Ga0070684_100002106
635 Ga0070684_100186520
636 Ga0070684_100299128
637 Ga0070684_100316769
638 Ga0070684_100504803
639 Ga0070684_100535106
640 Ga0068853_100264356
641 Ga0070696_100093087
642 Ga0070696_101292701
643 Ga0070665_100082096
644 Ga0068855_100009118
645 Ga0068855_100014710
646 Ga0068855_100020718
647 Ga0068855_100110948
648 Ga0068855_100208951
649 Ga0068855_100330673
650 Ga0068855_100536054
651 Ga0068855_102292429
652 Ga0068857_100121709
653 Ga0068857_101664263
654 Ga0068854_101104981
655 Ga0068856_100036588
656 Ga0068856_100206811
657 Ga0068856_101430604
658 Ga0070702_100861122
659 Ga0068852_100061117
660 Ga0068852_100500558
661 Ga0068852_100822515
662 Ga0068852_101197737
663 Ga0068851_10126285
664 Ga0081455_10112510
665 Ga0070717_10043876
666 Ga0070716_100379598
667 Ga0070712_100071543
668 Ga0070712_100229493
669 Ga0070712_100382659
670 Ga0097621_100173069
671 Ga0068871_100380079
672 Ga0075428_100911875
673 Ga0075433_10079382
674 Ga0075434_100082418
675 Ga0075434_100469081
676 Ga0075436_101139609
677 Ga0075435_100362723
678 Ga0105240_10044103
679 Ga0105240_10410527
680 Ga0105240_10431317
681 Ga0105240_11152267
682 Ga0105240_11457322
683 Ga0105240_11549704
684 Ga0105245_10260938
685 Ga0105245_10924941
686 Ga0114129_10074307
687 Ga0114129_10649666
688 Ga0105241_10794956
689 Ga0105241_10968419
690 Ga0105242_10693700
691 Ga0105242_11892589
692 Ga0105248_10766734
693 Ga0105237_11464839
694 Ga0105238_10553560
695 Ga0105239_10126011
696 Ga0105239_11753558
697 Ga0157338_1026681
698 Ga0157373_10312011
699 Ga0157371_10306732
700 Ga0157370_10011042
701 Ga0157370_10016302
702 Ga0157370_10064632
703 Ga0157370_10189865
704 Ga0157370_10366013
705 Ga0157369_10008335
706 Ga0157369_10009744
707 Ga0157369_10014825
708 Ga0157369_10094474
709 Ga0157369_10173236
710 Ga0157369_10196521
711 Ga0157369_10895423
712 Ga0157374_10388707
713 Ga0157374_10883511
714 Ga0157378_10273640
715 Ga0157372_10178075
716 Ga0157372_10390622
717 Ga0157372_10729296
718 Ga0157372_11278025
719 Ga0157375_10331121
720 Ga0157375_10714343
721 Ga0182008_10055450
722 Ga0182008_10209013
723 Ga0157376_10142382
724 Ga0157376_10699101
725 Ga0182006_1241420
726 Ga0182007_10095210
727 Ga0182005_1251454
728 Ga0197907_10923657
729 Ga0197907_11480162
730 Ga0206356_10083395
731 Ga0206356_10150529
732 Ga0206356_10471932
733 Ga0206356_10487161
734 Ga0206356_11433091
735 Ga0206356_11437141
736 Ga0206349_1403473
737 Ga0206355_1266765
738 Ga0206350_10155568
739 Ga0206354_10077757
740 Ga0206354_10535991
741 Ga0206354_10749136
742 Ga0206354_11534743
743 Ga0206353_10285970
744 Ga0206353_10688407
745 Ga0206353_10725415
746 Ga0206353_11340468
747 Ga0213873_10216895
748 Ga0213874_10079705
749 Ga0213876_10436084
750 Ga0213876_10797635
751 Ga0207692_10377745
752 Ga0207699_10320702
753 Ga0207699_10505019
754 Ga0207705_10041926
755 Ga0207705_10058898
756 Ga0207705_10367839
757 Ga0207684_10354408
758 Ga0207684_10685533
759 Ga0207654_10644381
760 Ga0207707_10016739
761 Ga0207707_10083988
762 Ga0207707_10349970
763 Ga0207695_10320370
764 Ga0207695_11276292
765 Ga0207671_11224717
766 Ga0207693_10074807
767 Ga0207693_10197300
768 Ga0207693_10201446
769 Ga0207663_10026060
770 Ga0207663_10240498
771 Ga0207663_10758026
772 Ga0207660_10045690
773 Ga0207660_10081042
774 Ga0207660_10221114
775 Ga0207660_10483451
776 Ga0207657_10000046
777 Ga0207657_10024169
778 Ga0207657_10484052
779 Ga0207649_11011513
780 Ga0207652_10031048
781 Ga0207652_10075474
782 Ga0207652_10093410
783 Ga0207652_10211054
784 Ga0207652_11300069
785 Ga0207646_11375008
786 Ga0207694_10265025
787 Ga0207694_10665942
788 Ga0207687_10146630
789 Ga0207700_10282644
790 Ga0207700_11235838
791 Ga0207664_10482069
792 Ga0207664_10668183
793 Ga0207664_10815094
794 Ga0207664_11775617
795 Ga0207644_11871687
796 Ga0207690_10115842
797 Ga0207690_10286186
798 Ga0207665_10315778
799 Ga0207711_10581163
800 Ga0207689_10579906
801 Ga0207661_10074964
802 Ga0207661_10133014
803 Ga0207661_10316423
804 Ga0207661_10522763
805 Ga0207661_10594469
806 Ga0207661_11156181
807 Ga0207679_10953994
808 Ga0207667_10062676
809 Ga0207667_10064407
810 Ga0207667_10184165
811 Ga0207667_10201892
812 Ga0207667_10307208
813 Ga0207667_10340274
814 Ga0207667_10383093
815 Ga0207667_10828900
816 Ga0207651_10974404
817 Ga0207658_10014868
818 Ga0207639_10685063
819 Ga0207639_11524272
820 Ga0207678_10920349
821 Ga0207678_11612253
822 Ga0207702_10187588
823 Ga0207674_10080828
824 Ga0207698_10150953
825 Ga0207698_12451749
826 Ga0268266_10155440
827 Ga0265318_10320562
828 Ga0265338_10008970
829 Ga0265338_10090933
830 Ga0265330_10024688
831 Ga0265320_10057643
832 Ga0265320_10263142
833 Ga0265340_10259305
834 Ga0265339_10049329
835 Ga0265327_10004459
836 Ga0265316_10003711
837 Ga0265313_10015692
838 Ga0265314_10003383
839 Ga0265314_10681446
840 Ga0265342_10025737
841 Ga0307409_100249452
842 Ga0307416_102659985
843 Ga0307415_100511244
844 Ga0373926_0016043
845 Ga0373934_0332888
846 Ga0373944_0029015
847 Ga0373936_0244090
848 Ga0373945_0027190
849 Ga0373953_0018419
850 Ga0373954_0113328
851 Ga0373943_0001192
852 Ga0373943_0002076
853 Ga0373946_0008675
854 Ga0373946_0012412
855 Ga0373942_0103722
856 Ga0373935_0029018
857 Ga0373935_0486496
858 Ga0373933_0556889
859 Ga0373947_0006355
860 Ga0373947_0065448
861 Ga0373947_0674184
862 Ga0373937_0033772
863 Ga0373925_0005621
864 Ga0373925_0005903
865 Ga0395899_0105959
866 Ga0395899_0108061
867 Ga0395899_0236483
868 Ga0395899_0975299
869 Ga0395900_0036672
870 Ga0395900_0095726
871 Ga0395900_0687649
872 Ga0395900_0887791
873 Ga0395898_0007189
874 Ga0395898_0029790
875 Ga0395898_0236587
876 Ga0395898_0459246
877 Ga0395898_0523626
878 Ga0395898_0600839
879 Ga0395898_1005412
880 Ga0395905_0030028
881 Ga0395905_0053635
882 Ga0395905_0096992
883 Ga0395905_0660542
884 Ga0395901_0045312
885 Ga0395901_0084737
886 Ga0395901_0375631
887 Ga0395901_0382959
888 Ga0395901_0641448
889 Ga0436365_0102858
890 Ga0436365_1489176
891 Ga0436365_1507410
892 Ga0436363_0092653
893 Ga0436363_0795855
894 Ga0436362_0999390
895 Ga0451853_0231954
896 Ga0451853_3542244
897 Ga0439448_0255674
898 Ga0450903_047506
899 Ga0466965_0370297
900 Ga0466966_0002668
901 Ga0466966_0015061
902 Ga0466961_0030556
903 Ga0466961_0030653
904 Ga0466961_0135844
905 Ga0466963_0006240
906 Ga0466963_0020167
907 Ga0466963_0030010
908 Ga0466963_0106986
909 Ga0466963_0142245
910 Ga0466963_0297469
911 Ga0466963_0322824
912 Ga0466963_0635487
913 Ga0466963_0770975
914 Ga0466964_0000812
915 Ga0466964_0004511
916 Ga0466964_0026930
917 Ga0466964_0451446
918 Ga0466971_0002342
919 Ga0466971_0455906
920 Ga0466968_0091140
921 Ga0466968_0229624
922 Ga0466970_0011268
923 Ga0466970_0050461
924 Ga0466957_0003835
925 Ga0466957_0163449
926 Ga0466957_0220008
927 Ga0466957_0272744
928 Ga0466957_0421676
929 Ga0466960_0062863
930 Ga0466960_0069951
931 Ga0466960_0090955
932 Ga0466959_0012278
933 Ga0466959_0042887
934 Ga0466959_0270321
935 Ga0466959_0644189
936 Ga0451576_0213770
937 Ga0466958_0000505
938 Ga0466958_0049583
939 Ga0466958_0074460
940 Ga0466958_0203651
941 Ga0466967_0004727
942 Ga0466967_0022552
943 Ga0466967_0023838
944 Ga0466967_0028605
945 Ga0466967_0039147
946 Ga0466967_0049677
947 Ga0466967_0109553
948 Ga0466967_0122997
949 Ga0466967_0127566
950 Ga0466967_0149693
951 Ga0466967_0153850
952 Ga0466967_0170454
953 Ga0466967_0261340
954 Ga0466967_0408129
955 Ga0466967_0746956
956 Ga0495592_0071613
957 Ga0495592_0384538
958 Ga0495603_0032555
959 Ga0495603_0207860
960 Ga0495629_0000593
961 Ga0495641_0001017
962 Ga0495641_0047274
963 Ga0495641_0185182
964 Ga0495651_0093410
965 Ga0495651_0171346
966 Ga0495651_0195355
967 Ga0495653_0013634
968 Ga0495653_0060222
969 Ga0495582_0000056
970 Ga0495582_0237103
971 Ga0495639_0002894
972 Ga0495662_0023847
973 Ga0495662_0062403
974 Ga0495662_0151112
975 Ga0495664_0209888
976 Ga0495664_0264559
977 Ga0495664_0422800
978 Ga0495594_0141682
979 Ga0495608_0007181
980 Ga0495608_0013145
981 Ga0495608_0034997
982 Ga0495618_0008086
983 Ga0495628_0018890
984 Ga0495628_0075779
985 Ga0495630_0008240
986 Ga0495630_0125469
987 Ga0495630_0433103
988 Ga0495666_0049482
989 Ga0495652_0049329
990 Ga0495652_0196507
991 Ga0495665_0000364
992 Ga0495640_0005466
993 Ga0495640_0025293
994 Ga0495640_0056826
995 Ga0495586_0244415
996 Ga0495586_0467775
997 Ga0495587_0258991
998 Ga0495645_0123276
999 Ga0495645_0146019
1000 Ga0495667_0009765
1001 Ga0495667_0033924
1002 Ga0495667_0040731
1003 Ga0495667_0044019
1004 Ga0495634_0107716
1005 Ga0495634_0236762
1006 Ga0495634_0437950
1007 Ga0495635_0038948
1008 Ga0495635_0059851
1009 Ga0495635_0201113
1010 Ga0495588_0524163
1011 Ga0495657_0004160
1012 Ga0495657_0224763
1013 Ga0495657_0308966
1014 Ga0495599_0128922
1015 Ga0495623_0067537
1016 Ga0495623_0302747
1017 Ga0495623_0374611
1018 Ga0495646_0042147
1019 Ga0495646_0363052
1020 Ga0495646_0721628
1021 Ga0495647_0035675
1022 Ga0495658_0000615
1023 Ga0495658_0262244
1024 Ga0495613_0000401
1025 Ga0495613_0213630
1026 Ga0495613_0388076
1027 Ga0495624_0023782
1028 Ga0495600_0004803
1029 Ga0495600_0067588
1030 Ga0495600_0180707
1031 Ga0495581_0004589
1032 Ga0495604_0010914
1033 Ga0495604_0075468
1034 Ga0495674_0003725
1035 Ga0495674_0018307
1036 Ga0495674_0026429
1037 Ga0495676_0047160
1038 Ga0495676_0161950
1039 Ga0495680_0000973
1040 Ga0495680_0004249
1041 Ga0495680_0010742
1042 Ga0495680_0119639
1043 Ga0495675_0280187
1044 Ga0495675_0586305
1045 Ga0495684_0010685
1046 Ga0495684_0011390
1047 Ga0495684_0048807
1048 Ga0495593_0001438
1049 Ga0495602_0082829
1050 Ga0495602_0488765
1051 Ga0495614_0000769
1052 Ga0496100_0002119
1053 Ga0496100_0004895
1054 Ga0496101_0000652
1055 Ga0496101_0002648
1056 Ga0496101_0464991
1057 Ga0496102_0001966
1058 Ga0496102_0082371
1059 Ga0496102_0300921
1060 Ga0496102_1362836
1061 Ga0496103_0133440
1062 Ga0496103_0301922
1063 Ga0496104_0113102
1064 Ga0496104_1665051
1065 Ga0496105_0000642
1066 Ga0496105_0309519
1067 Ga0496106_0029427
1068 Ga0496106_0057208
1069 Ga0496106_0375804
1070 Ga0496107_0389539
1071 Ga0496108_0071996
1072 Ga0496108_0394499
1073 Ga0496109_0004096
1074 Ga0496109_0039391
1075 Ga0496109_0783273
1076 Ga0496109_1207807
1077 Ga0496110_0063330
1078 Ga0496110_0748749
1079 Ga0496111_0026556
1080 Ga0496111_0202191
1081 Ga0496112_0007203
1082 Ga0496112_0082443
1083 Ga0496112_0100213
1084 Ga0496112_0850981
1085 Ga0496113_0154959
1086 Ga0496113_0373631
1087 Ga0496113_0695041
1088 Ga0496113_0829303
1089 Ga0496114_0002803
1090 Ga0496114_0014099
1091 Ga0496114_0222407
1092 Ga0496114_0864752
1093 Ga0496115_0063609
1094 Ga0496115_0110041
1095 Ga0496115_0178210
1096 Ga0496115_0251453
1097 Ga0496115_0349101
1098 Ga0496115_0669495
1099 Ga0496115_1108899
1100 Ga0501032_0420893
1101 Ga0501036_1001983
1102 Ga0501047_0140043
1103 Ga0501067_0015110
1104 Ga0501068_0361723
1105 Ga0501069_0012758
1106 Ga0501069_0845924
1107 Ga0501070_0001321
1108 Ga0501070_1217080
1109 Ga0501074_0100754
1110 Ga0501074_0950085
1111 Ga0501074_1131532
1112 Ga0501076_0789888
1113 Ga0501080_0049253
1114 Ga0501080_0211277
1115 Ga0501080_0258985
1116 Ga0501080_0964790
1117 Ga0501044_0523892
1118 Ga0501044_0733644
1119 nmdc:mga05p37_531835_c1
1120 nmdc:mga05p37_86280_c1
1121 nmdc:mga0n895_26436_c1
1122 nmdc:mga0n895_55289_c1
1123 nmdc:mga0rr50_11001_c1
1124 nmdc:mga0a205_143479_c2
1125 nmdc:mga0a205_55705_c1
1126 Ga0495601_0047404
1127 Ga0495601_0325640
1128 Ga0495612_0260752
1129 Ga0495655_0000685
1130 Ga0495595_0001393
1131 Ga0495595_0003449
1132 Ga0495595_0203878
1133 Ga0495619_0000860
1134 Ga0495619_0011590
1135 Ga0495619_0068354
1136 Ga0501084_0279804
1137 Ga0466962_0003840
1138 Ga0466962_0014176
1139 Ga0466962_0036636
1140 Ga0530510_0487069

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02381

MraZ

MraZ protein, putative antitoxin-like

91

159

0.94

PF02381

MraZ

MraZ protein, putative antitoxin-like

21

90

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.9256 1 133
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.8696 1 133
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.5256 1 115
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.4729 1 115
4a4k-assembly5.cif.gz_I crystal structure of the s. cerevisiae ski2 insertion domain 0.4129 19 43
ID Description Score Start End Superfamily
af_P9WJN9_1_138_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.9576 1 133 3.40.1550.20
af_P22186_1_143_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.9386 1 132 3.40.1550.20
1n0eB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.9247 1 133 3.40.1550.20
af_Q2FZ97_1_142_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.9205 1 142 3.40.1550.20
af_P9WJN9_1_138_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.9176 1 133 3.40.1550.20
ID Description Score Start End GO Terms
AF-A0A521RZG5-F1-model_v4 Transcriptional regulator MraZ 0.9819 2 125 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A1F5EQK4-F1-model_v4 Transcriptional regulator MraZ 0.9805 1 128 GO:0000976
GO:0003700
GO:0005737
GO:0051301
GO:2000143
AF-A0A1F8KPM3-F1-model_v4 Transcriptional regulator MraZ 0.9802 1 127 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A2M6R9Q2-F1-model_v4 Transcriptional regulator MraZ 0.9797 1 126 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-R7K5C9-F1-model_v4 Transcriptional regulator MraZ 0.9791 1 123 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143

Map