F464803
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 570 | 250 | 1140 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100033575|Ga0070711_1000335756 |
| Length | 159 |
| Sequence | VVPGGLQVGESGIKWGAVDPLLGEHEHSLDEKNRLTLPSKQRAAFEDGVFVTRGLDGCLFAYPRPAWEHMAERIQSLDPLSPGSRVMQRHFFAGAAQSDLDKQGRVVIPAGLIEQAGLGREVTVAGVFDHLEIWDRAKWRQQLHEVEGSAEDVAERLAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 72 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 76 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 117 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 118 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 120 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 125 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 126 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 127 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 128 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 131 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 135 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 148 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 149 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 150 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 151 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 152 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 153 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 154 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 155 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 156 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 157 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 158 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 159 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 160 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 163 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 164 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 165 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 250 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.67 |
| Metatranscriptomes | 3.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.42 |
| Rhizosphere | 89.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070711_100033575 | 3300005439 | Unclassified | 3417 |
| 2 | JGI25405J52794_10155949 | 3300003911 | Viruses | 521 |
| 3 | Ga0070658_10001449 | 3300005327 | Bacteria | 20243 |
| 4 | Ga0070658_10340646 | 3300005327 | Bacteria | 1282 |
| 5 | Ga0070658_10380540 | 3300005327 | Unclassified | 1211 |
| 6 | Ga0070658_11490935 | 3300005327 | Bacteria | 586 |
| 7 | Ga0070683_100024141 | 3300005329 | Bacteria | 5442 |
| 8 | Ga0070683_100062448 | 3300005329 | Bacteria | 3464 |
| 9 | Ga0070683_100091156 | 3300005329 | Bacteria | 2862 |
| 10 | Ga0070683_100109839 | 3300005329 | Bacteria | 2601 |
| 11 | Ga0070683_100201571 | 3300005329 | Bacteria | 1889 |
| 12 | Ga0070683_101471630 | 3300005329 | Unclassified | 655 |
| 13 | Ga0070680_100005133 | 3300005336 | Bacteria | 9892 |
| 14 | Ga0070680_100033903 | 3300005336 | Bacteria | 4117 |
| 15 | Ga0070680_100078226 | 3300005336 | Bacteria | 2724 |
| 16 | Ga0070680_100087113 | 3300005336 | Bacteria | 2582 |
| 17 | Ga0070682_100777299 | 3300005337 | Unclassified | 776 |
| 18 | Ga0070682_100945229 | 3300005337 | Bacteria | 711 |
| 19 | Ga0070660_100000987 | 3300005339 | Bacteria | 19063 |
| 20 | Ga0070660_100003524 | 3300005339 | Bacteria | 10789 |
| 21 | Ga0070660_100114267 | 3300005339 | Bacteria | 2150 |
| 22 | Ga0070660_100284418 | 3300005339 | Bacteria | 1353 |
| 23 | Ga0070660_100576707 | 3300005339 | Bacteria | 939 |
| 24 | Ga0070660_100753857 | 3300005339 | Bacteria | 817 |
| 25 | Ga0070660_100933003 | 3300005339 | Bacteria | 732 |
| 26 | Ga0070691_10859107 | 3300005341 | Bacteria | 557 |
| 27 | Ga0070661_100012623 | 3300005344 | Bacteria | 5911 |
| 28 | Ga0070661_100294238 | 3300005344 | Bacteria | 1262 |
| 29 | Ga0070692_11414713 | 3300005345 | Bacteria | 503 |
| 30 | Ga0070659_100445727 | 3300005366 | Bacteria | 1097 |
| 31 | Ga0070659_101191038 | 3300005366 | Bacteria | 673 |
| 32 | Ga0070667_100021689 | 3300005367 | Bacteria | 5330 |
| 33 | Ga0070709_10220693 | 3300005434 | Bacteria | 1352 |
| 34 | Ga0070709_10858302 | 3300005434 | Bacteria | 716 |
| 35 | Ga0070714_100228397 | 3300005435 | Bacteria | 1714 |
| 36 | Ga0070714_100841581 | 3300005435 | Bacteria | 889 |
| 37 | Ga0070713_100175105 | 3300005436 | Bacteria | 1925 |
| 38 | Ga0070713_100915389 | 3300005436 | Bacteria | 844 |
| 39 | Ga0070713_101982622 | 3300005436 | Bacteria | 565 |
| 40 | Ga0070711_100043703 | 3300005439 | Bacteria | 3036 |
| 41 | Ga0070711_100756266 | 3300005439 | Unclassified | 822 |
| 42 | Ga0070711_102065253 | 3300005439 | Bacteria | 502 |
| 43 | Ga0070694_100269590 | 3300005444 | Bacteria | 1294 |
| 44 | Ga0070708_100049681 | 3300005445 | Bacteria | 3711 |
| 45 | Ga0070663_100415450 | 3300005455 | Bacteria | 1102 |
| 46 | Ga0070681_10003201 | 3300005458 | Bacteria | 15251 |
| 47 | Ga0070681_10004684 | 3300005458 | Bacteria | 13081 |
| 48 | Ga0070681_10019124 | 3300005458 | Bacteria | 6855 |
| 49 | Ga0070681_10133570 | 3300005458 | Bacteria | 2413 |
| 50 | Ga0070681_10264839 | 3300005458 | Bacteria | 1630 |
| 51 | Ga0070681_10310656 | 3300005458 | Bacteria | 1486 |
| 52 | Ga0070681_10396769 | 3300005458 | Bacteria | 1291 |
| 53 | Ga0070706_100169905 | 3300005467 | Bacteria | 2036 |
| 54 | Ga0070706_100848230 | 3300005467 | Bacteria | 845 |
| 55 | Ga0070698_100386289 | 3300005471 | Bacteria | 1333 |
| 56 | Ga0070698_100411237 | 3300005471 | Bacteria | 1287 |
| 57 | Ga0070679_100001995 | 3300005530 | Bacteria | 18331 |
| 58 | Ga0070679_100015162 | 3300005530 | Bacteria | 7406 |
| 59 | Ga0070679_100132429 | 3300005530 | Bacteria | 2474 |
| 60 | Ga0070679_100335359 | 3300005530 | Bacteria | 1460 |
| 61 | Ga0070679_100617232 | 3300005530 | Bacteria | 1027 |
| 62 | Ga0070679_101123969 | 3300005530 | Bacteria | 730 |
| 63 | Ga0070679_101583493 | 3300005530 | Unclassified | 603 |
| 64 | Ga0070684_100002106 | 3300005535 | Bacteria | 14655 |
| 65 | Ga0070684_100186520 | 3300005535 | Bacteria | 1886 |
| 66 | Ga0070684_100299128 | 3300005535 | Bacteria | 1476 |
| 67 | Ga0070684_100316769 | 3300005535 | Bacteria | 1432 |
| 68 | Ga0070684_100504803 | 3300005535 | Bacteria | 1120 |
| 69 | Ga0070684_100535106 | 3300005535 | Bacteria | 1086 |
| 70 | Ga0068853_100264356 | 3300005539 | Bacteria | 1583 |
| 71 | Ga0070696_100093087 | 3300005546 | Bacteria | 2149 |
| 72 | Ga0070696_101292701 | 3300005546 | Bacteria | 619 |
| 73 | Ga0070665_100082096 | 3300005548 | Bacteria | 3228 |
| 74 | Ga0068855_100009118 | 3300005563 | Bacteria | 11985 |
| 75 | Ga0068855_100014710 | 3300005563 | Bacteria | 9428 |
| 76 | Ga0068855_100020718 | 3300005563 | Bacteria | 7886 |
| 77 | Ga0068855_100110948 | 3300005563 | Bacteria | 3148 |
| 78 | Ga0068855_100208951 | 3300005563 | Bacteria | 2194 |
| 79 | Ga0068855_100330673 | 3300005563 | Bacteria | 1682 |
| 80 | Ga0068855_100536054 | 3300005563 | Bacteria | 1268 |
| 81 | Ga0068855_102292429 | 3300005563 | Bacteria | 540 |
| 82 | Ga0068857_100121709 | 3300005577 | Unclassified | 2350 |
| 83 | Ga0068857_101664263 | 3300005577 | Unclassified | 623 |
| 84 | Ga0068854_101104981 | 3300005578 | Bacteria | 706 |
| 85 | Ga0068856_100036588 | 3300005614 | Bacteria | 4813 |
| 86 | Ga0068856_100206811 | 3300005614 | Bacteria | 1977 |
| 87 | Ga0068856_101430604 | 3300005614 | Unclassified | 705 |
| 88 | Ga0070702_100861122 | 3300005615 | Unclassified | 706 |
| 89 | Ga0068852_100061117 | 3300005616 | Bacteria | 3273 |
| 90 | Ga0068852_100500558 | 3300005616 | Bacteria | 1210 |
| 91 | Ga0068852_100822515 | 3300005616 | Bacteria | 944 |
| 92 | Ga0068852_101197737 | 3300005616 | Bacteria | 780 |
| 93 | Ga0068851_10126285 | 3300005834 | Bacteria | 1379 |
| 94 | Ga0081455_10112510 | 3300005937 | Bacteria | 2161 |
| 95 | Ga0070717_10043876 | 3300006028 | Bacteria | 3651 |
| 96 | Ga0070716_100379598 | 3300006173 | Bacteria | 1010 |
| 97 | Ga0070712_100071543 | 3300006175 | Bacteria | 2482 |
| 98 | Ga0070712_100229493 | 3300006175 | Bacteria | 1474 |
| 99 | Ga0070712_100382659 | 3300006175 | Bacteria | 1159 |
| 100 | Ga0097621_100173069 | 3300006237 | Bacteria | 1862 |
| 101 | Ga0068871_100380079 | 3300006358 | Bacteria | 1254 |
| 102 | Ga0075428_100911875 | 3300006844 | Unclassified | 932 |
| 103 | Ga0075433_10079382 | 3300006852 | Bacteria | 2892 |
| 104 | Ga0075434_100082418 | 3300006871 | Bacteria | 3214 |
| 105 | Ga0075434_100469081 | 3300006871 | Bacteria | 1280 |
| 106 | Ga0075436_101139609 | 3300006914 | Bacteria | 588 |
| 107 | Ga0075435_100362723 | 3300007076 | Bacteria | 1243 |
| 108 | Ga0105240_10044103 | 3300009093 | Bacteria | 5670 |
| 109 | Ga0105240_10410527 | 3300009093 | Bacteria | 1523 |
| 110 | Ga0105240_10431317 | 3300009093 | Bacteria | 1479 |
| 111 | Ga0105240_11152267 | 3300009093 | Bacteria | 823 |
| 112 | Ga0105240_11457322 | 3300009093 | Bacteria | 719 |
| 113 | Ga0105240_11549704 | 3300009093 | Bacteria | 694 |
| 114 | Ga0105245_10260938 | 3300009098 | Bacteria | 1686 |
| 115 | Ga0105245_10924941 | 3300009098 | Bacteria | 914 |
| 116 | Ga0114129_10074307 | 3300009147 | Bacteria | 4735 |
| 117 | Ga0114129_10649666 | 3300009147 | Bacteria | 1362 |
| 118 | Ga0105241_10794956 | 3300009174 | Bacteria | 871 |
| 119 | Ga0105241_10968419 | 3300009174 | Unclassified | 794 |
| 120 | Ga0105242_10693700 | 3300009176 | Unclassified | 995 |
| 121 | Ga0105242_11892589 | 3300009176 | Unclassified | 637 |
| 122 | Ga0105248_10766734 | 3300009177 | Bacteria | 1089 |
| 123 | Ga0105237_11464839 | 3300009545 | Unclassified | 689 |
| 124 | Ga0105238_10553560 | 3300009551 | Bacteria | 1155 |
| 125 | Ga0105239_10126011 | 3300010375 | Bacteria | 2846 |
| 126 | Ga0105239_11753558 | 3300010375 | Bacteria | 719 |
| 127 | Ga0157338_1026681 | 3300012515 | Unclassified | 711 |
| 128 | Ga0157373_10312011 | 3300013100 | Bacteria | 1118 |
| 129 | Ga0157371_10306732 | 3300013102 | Bacteria | 1150 |
| 130 | Ga0157370_10011042 | 3300013104 | Bacteria | 9471 |
| 131 | Ga0157370_10016302 | 3300013104 | Bacteria | 7528 |
| 132 | Ga0157370_10064632 | 3300013104 | Bacteria | 3463 |
| 133 | Ga0157370_10189865 | 3300013104 | Bacteria | 1907 |
| 134 | Ga0157370_10366013 | 3300013104 | Bacteria | 1329 |
| 135 | Ga0157369_10008335 | 3300013105 | Bacteria | 11881 |
| 136 | Ga0157369_10009744 | 3300013105 | Bacteria | 10986 |
| 137 | Ga0157369_10014825 | 3300013105 | Bacteria | 8795 |
| 138 | Ga0157369_10094474 | 3300013105 | Bacteria | 3192 |
| 139 | Ga0157369_10173236 | 3300013105 | Bacteria | 2273 |
| 140 | Ga0157369_10196521 | 3300013105 | Bacteria | 2118 |
| 141 | Ga0157369_10895423 | 3300013105 | Unclassified | 910 |
| 142 | Ga0157374_10388707 | 3300013296 | Bacteria | 1390 |
| 143 | Ga0157374_10883511 | 3300013296 | Unclassified | 911 |
| 144 | Ga0157378_10273640 | 3300013297 | Bacteria | 1625 |
| 145 | Ga0157372_10178075 | 3300013307 | Bacteria | 2461 |
| 146 | Ga0157372_10390622 | 3300013307 | Bacteria | 1621 |
| 147 | Ga0157372_10729296 | 3300013307 | Unclassified | 1153 |
| 148 | Ga0157372_11278025 | 3300013307 | Unclassified | 847 |
| 149 | Ga0157375_10331121 | 3300013308 | Bacteria | 1688 |
| 150 | Ga0157375_10714343 | 3300013308 | Bacteria | 1155 |
| 151 | Ga0182008_10055450 | 3300014497 | Bacteria | 1960 |
| 152 | Ga0182008_10209013 | 3300014497 | Bacteria | 995 |
| 153 | Ga0157376_10142382 | 3300014969 | Bacteria | 2153 |
| 154 | Ga0157376_10699101 | 3300014969 | Bacteria | 1019 |
| 155 | Ga0182006_1241420 | 3300015261 | Bacteria | 594 |
| 156 | Ga0182007_10095210 | 3300015262 | Bacteria | 982 |
| 157 | Ga0182005_1251454 | 3300015265 | Unclassified | 547 |
| 158 | Ga0197907_10923657 | 3300020069 | Bacteria | 827 |
| 159 | Ga0197907_11480162 | 3300020069 | Bacteria | 2548 |
| 160 | Ga0206356_10083395 | 3300020070 | Bacteria | 1198 |
| 161 | Ga0206356_10150529 | 3300020070 | Unclassified | 1583 |
| 162 | Ga0206356_10471932 | 3300020070 | Unclassified | 630 |
| 163 | Ga0206356_10487161 | 3300020070 | Unclassified | 1603 |
| 164 | Ga0206356_11433091 | 3300020070 | Bacteria | 1430 |
| 165 | Ga0206356_11437141 | 3300020070 | Bacteria | 1560 |
| 166 | Ga0206349_1403473 | 3300020075 | Unclassified | 682 |
| 167 | Ga0206355_1266765 | 3300020076 | Bacteria | 954 |
| 168 | Ga0206350_10155568 | 3300020080 | Unclassified | 512 |
| 169 | Ga0206354_10077757 | 3300020081 | Bacteria | 1054 |
| 170 | Ga0206354_10535991 | 3300020081 | Unclassified | 643 |
| 171 | Ga0206354_10749136 | 3300020081 | Bacteria | 1129 |
| 172 | Ga0206354_11534743 | 3300020081 | Bacteria | 4768 |
| 173 | Ga0206353_10285970 | 3300020082 | Bacteria | 8659 |
| 174 | Ga0206353_10688407 | 3300020082 | Bacteria | 6713 |
| 175 | Ga0206353_10725415 | 3300020082 | Bacteria | 3196 |
| 176 | Ga0206353_11340468 | 3300020082 | Bacteria | 911 |
| 177 | Ga0213873_10216895 | 3300021358 | Unclassified | 598 |
| 178 | Ga0213874_10079705 | 3300021377 | Bacteria | 1059 |
| 179 | Ga0213876_10436084 | 3300021384 | Bacteria | 697 |
| 180 | Ga0213876_10797635 | 3300021384 | Unclassified | 503 |
| 181 | Ga0207692_10377745 | 3300025898 | Bacteria | 879 |
| 182 | Ga0207699_10320702 | 3300025906 | Bacteria | 1087 |
| 183 | Ga0207699_10505019 | 3300025906 | Unclassified | 873 |
| 184 | Ga0207705_10041926 | 3300025909 | Bacteria | 3284 |
| 185 | Ga0207705_10058898 | 3300025909 | Bacteria | 2771 |
| 186 | Ga0207705_10367839 | 3300025909 | Bacteria | 1109 |
| 187 | Ga0207684_10354408 | 3300025910 | Bacteria | 1263 |
| 188 | Ga0207684_10685533 | 3300025910 | Bacteria | 872 |
| 189 | Ga0207654_10644381 | 3300025911 | Unclassified | 758 |
| 190 | Ga0207707_10016739 | 3300025912 | Bacteria | 6389 |
| 191 | Ga0207707_10083988 | 3300025912 | Bacteria | 2780 |
| 192 | Ga0207707_10349970 | 3300025912 | Unclassified | 1273 |
| 193 | Ga0207695_10320370 | 3300025913 | Bacteria | 1440 |
| 194 | Ga0207695_11276292 | 3300025913 | Bacteria | 615 |
| 195 | Ga0207671_11224717 | 3300025914 | Bacteria | 587 |
| 196 | Ga0207693_10074807 | 3300025915 | Bacteria | 2652 |
| 197 | Ga0207693_10197300 | 3300025915 | Bacteria | 1583 |
| 198 | Ga0207693_10201446 | 3300025915 | Bacteria | 1565 |
| 199 | Ga0207663_10026060 | 3300025916 | Bacteria | 3389 |
| 200 | Ga0207663_10240498 | 3300025916 | Bacteria | 1328 |
| 201 | Ga0207663_10758026 | 3300025916 | Bacteria | 771 |
| 202 | Ga0207660_10045690 | 3300025917 | Bacteria | 3086 |
| 203 | Ga0207660_10081042 | 3300025917 | Bacteria | 2384 |
| 204 | Ga0207660_10221114 | 3300025917 | Bacteria | 1486 |
| 205 | Ga0207660_10483451 | 3300025917 | Bacteria | 1004 |
| 206 | Ga0207657_10000046 | 3300025919 | Bacteria | 113887 |
| 207 | Ga0207657_10024169 | 3300025919 | Bacteria | 5639 |
| 208 | Ga0207657_10484052 | 3300025919 | Bacteria | 970 |
| 209 | Ga0207649_11011513 | 3300025920 | Unclassified | 654 |
| 210 | Ga0207652_10031048 | 3300025921 | Bacteria | 4483 |
| 211 | Ga0207652_10075474 | 3300025921 | Bacteria | 2938 |
| 212 | Ga0207652_10093410 | 3300025921 | Bacteria | 2647 |
| 213 | Ga0207652_10211054 | 3300025921 | Bacteria | 1748 |
| 214 | Ga0207652_11300069 | 3300025921 | Unclassified | 630 |
| 215 | Ga0207646_11375008 | 3300025922 | Unclassified | 615 |
| 216 | Ga0207694_10265025 | 3300025924 | Bacteria | 1408 |
| 217 | Ga0207694_10665942 | 3300025924 | Bacteria | 877 |
| 218 | Ga0207687_10146630 | 3300025927 | Bacteria | 1796 |
| 219 | Ga0207700_10282644 | 3300025928 | Unclassified | 1428 |
| 220 | Ga0207700_11235838 | 3300025928 | Unclassified | 666 |
| 221 | Ga0207664_10482069 | 3300025929 | Bacteria | 1109 |
| 222 | Ga0207664_10668183 | 3300025929 | Bacteria | 934 |
| 223 | Ga0207664_10815094 | 3300025929 | Unclassified | 839 |
| 224 | Ga0207664_11775617 | 3300025929 | Bacteria | 539 |
| 225 | Ga0207644_11871687 | 3300025931 | Unclassified | 502 |
| 226 | Ga0207690_10115842 | 3300025932 | Bacteria | 1937 |
| 227 | Ga0207690_10286186 | 3300025932 | Bacteria | 1285 |
| 228 | Ga0207665_10315778 | 3300025939 | Bacteria | 1171 |
| 229 | Ga0207711_10581163 | 3300025941 | Bacteria | 1045 |
| 230 | Ga0207689_10579906 | 3300025942 | Bacteria | 943 |
| 231 | Ga0207661_10074964 | 3300025944 | Bacteria | 2775 |
| 232 | Ga0207661_10133014 | 3300025944 | Bacteria | 2133 |
| 233 | Ga0207661_10316423 | 3300025944 | Bacteria | 1402 |
| 234 | Ga0207661_10522763 | 3300025944 | Bacteria | 1085 |
| 235 | Ga0207661_10594469 | 3300025944 | Bacteria | 1015 |
| 236 | Ga0207661_11156181 | 3300025944 | Unclassified | 712 |
| 237 | Ga0207679_10953994 | 3300025945 | Bacteria | 786 |
| 238 | Ga0207667_10062676 | 3300025949 | Bacteria | 3887 |
| 239 | Ga0207667_10064407 | 3300025949 | Bacteria | 3827 |
| 240 | Ga0207667_10184165 | 3300025949 | Bacteria | 2144 |
| 241 | Ga0207667_10201892 | 3300025949 | Bacteria | 2039 |
| 242 | Ga0207667_10307208 | 3300025949 | Bacteria | 1620 |
| 243 | Ga0207667_10340274 | 3300025949 | Bacteria | 1531 |
| 244 | Ga0207667_10383093 | 3300025949 | Bacteria | 1433 |
| 245 | Ga0207667_10828900 | 3300025949 | Bacteria | 920 |
| 246 | Ga0207651_10974404 | 3300025960 | Bacteria | 757 |
| 247 | Ga0207658_10014868 | 3300025986 | Bacteria | 5333 |
| 248 | Ga0207639_10685063 | 3300026041 | Bacteria | 950 |
| 249 | Ga0207639_11524272 | 3300026041 | Bacteria | 627 |
| 250 | Ga0207678_10920349 | 3300026067 | Bacteria | 773 |
| 251 | Ga0207678_11612253 | 3300026067 | Unclassified | 571 |
| 252 | Ga0207702_10187588 | 3300026078 | Bacteria | 1908 |
| 253 | Ga0207674_10080828 | 3300026116 | Bacteria | 3253 |
| 254 | Ga0207698_10150953 | 3300026142 | Bacteria | 2016 |
| 255 | Ga0207698_12451749 | 3300026142 | Unclassified | 532 |
| 256 | Ga0268266_10155440 | 3300028379 | Bacteria | 2065 |
| 257 | Ga0265318_10320562 | 3300028577 | Unclassified | 566 |
| 258 | Ga0265338_10008970 | 3300028800 | Bacteria | 12029 |
| 259 | Ga0265338_10090933 | 3300028800 | Bacteria | 2524 |
| 260 | Ga0265330_10024688 | 3300031235 | Bacteria | 2726 |
| 261 | Ga0265320_10057643 | 3300031240 | Bacteria | 1863 |
| 262 | Ga0265320_10263142 | 3300031240 | Bacteria | 764 |
| 263 | Ga0265340_10259305 | 3300031247 | Bacteria | 774 |
| 264 | Ga0265339_10049329 | 3300031249 | Bacteria | 2306 |
| 265 | Ga0265327_10004459 | 3300031251 | Bacteria | 12377 |
| 266 | Ga0265316_10003711 | 3300031344 | Bacteria | 15368 |
| 267 | Ga0265313_10015692 | 3300031595 | Bacteria | 4393 |
| 268 | Ga0265314_10003383 | 3300031711 | Bacteria | 15460 |
| 269 | Ga0265314_10681446 | 3300031711 | Bacteria | 521 |
| 270 | Ga0265342_10025737 | 3300031712 | Bacteria | 3694 |
| 271 | Ga0307409_100249452 | 3300031995 | Bacteria | 1622 |
| 272 | Ga0307416_102659985 | 3300032002 | Bacteria | 597 |
| 273 | Ga0307415_100511244 | 3300032126 | Bacteria | 1052 |
| 274 | Ga0373926_0016043 | 3300035083 | Bacteria | 2559 |
| 275 | Ga0373934_0332888 | 3300035086 | Unclassified | 631 |
| 276 | Ga0373944_0029015 | 3300035089 | Bacteria | 1651 |
| 277 | Ga0373936_0244090 | 3300035113 | Bacteria | 801 |
| 278 | Ga0373945_0027190 | 3300035116 | Bacteria | 1997 |
| 279 | Ga0373953_0018419 | 3300035117 | Bacteria | 2584 |
| 280 | Ga0373954_0113328 | 3300035118 | Bacteria | 1313 |
| 281 | Ga0373943_0001192 | 3300035170 | Bacteria | 11613 |
| 282 | Ga0373943_0002076 | 3300035170 | Bacteria | 9095 |
| 283 | Ga0373946_0008675 | 3300035171 | Bacteria | 3733 |
| 284 | Ga0373946_0012412 | 3300035171 | Unclassified | 3189 |
| 285 | Ga0373942_0103722 | 3300035207 | Bacteria | 872 |
| 286 | Ga0373935_0029018 | 3300035692 | Bacteria | 3422 |
| 287 | Ga0373935_0486496 | 3300035692 | Bacteria | 895 |
| 288 | Ga0373933_0556889 | 3300035724 | Unclassified | 752 |
| 289 | Ga0373947_0006355 | 3300035725 | Bacteria | 6865 |
| 290 | Ga0373947_0065448 | 3300035725 | Bacteria | 2217 |
| 291 | Ga0373947_0674184 | 3300035725 | Bacteria | 705 |
| 292 | Ga0373937_0033772 | 3300036401 | Bacteria | 4649 |
| 293 | Ga0373925_0005621 | 3300037068 | Bacteria | 9327 |
| 294 | Ga0373925_0005903 | 3300037068 | Bacteria | 9082 |
| 295 | Ga0395899_0105959 | 3300037312 | Bacteria | 2024 |
| 296 | Ga0395899_0108061 | 3300037312 | Bacteria | 2002 |
| 297 | Ga0395899_0236483 | 3300037312 | Bacteria | 1259 |
| 298 | Ga0395899_0975299 | 3300037312 | Bacteria | 512 |
| 299 | Ga0395900_0036672 | 3300037418 | Bacteria | 5055 |
| 300 | Ga0395900_0095726 | 3300037418 | Bacteria | 3050 |
| 301 | Ga0395900_0687649 | 3300037418 | Bacteria | 957 |
| 302 | Ga0395900_0887791 | 3300037418 | Bacteria | 815 |
| 303 | Ga0395898_0007189 | 3300037466 | Bacteria | 11818 |
| 304 | Ga0395898_0029790 | 3300037466 | Bacteria | 5463 |
| 305 | Ga0395898_0236587 | 3300037466 | Bacteria | 1742 |
| 306 | Ga0395898_0459246 | 3300037466 | Bacteria | 1212 |
| 307 | Ga0395898_0523626 | 3300037466 | Bacteria | 1127 |
| 308 | Ga0395898_0600839 | 3300037466 | Bacteria | 1043 |
| 309 | Ga0395898_1005412 | 3300037466 | Bacteria | 770 |
| 310 | Ga0395905_0030028 | 3300037471 | Bacteria | 5123 |
| 311 | Ga0395905_0053635 | 3300037471 | Bacteria | 3773 |
| 312 | Ga0395905_0096992 | 3300037471 | Bacteria | 2768 |
| 313 | Ga0395905_0660542 | 3300037471 | Bacteria | 947 |
| 314 | Ga0395901_0045312 | 3300038443 | Bacteria | 4563 |
| 315 | Ga0395901_0084737 | 3300038443 | Unclassified | 3312 |
| 316 | Ga0395901_0375631 | 3300038443 | Bacteria | 1464 |
| 317 | Ga0395901_0382959 | 3300038443 | Bacteria | 1447 |
| 318 | Ga0395901_0641448 | 3300038443 | Unclassified | 1066 |
| 319 | Ga0436365_0102858 | 3300039437 | Bacteria | 2559 |
| 320 | Ga0436365_1489176 | 3300039437 | Bacteria | 895 |
| 321 | Ga0436365_1507410 | 3300039437 | Unclassified | 917 |
| 322 | Ga0436363_0092653 | 3300039450 | Bacteria | 1258 |
| 323 | Ga0436363_0795855 | 3300039450 | Bacteria | 578 |
| 324 | Ga0436362_0999390 | 3300039453 | Bacteria | 1374 |
| 325 | Ga0451853_0231954 | 3300041512 | Bacteria | 1262 |
| 326 | Ga0451853_3542244 | 3300041512 | Bacteria | 1258 |
| 327 | Ga0439448_0255674 | 3300042005 | Bacteria | 619 |
| 328 | Ga0450903_047506 | 3300042138 | Unclassified | 631 |
| 329 | Ga0466965_0370297 | 3300044683 | Bacteria | 787 |
| 330 | Ga0466966_0002668 | 3300044684 | Bacteria | 11689 |
| 331 | Ga0466966_0015061 | 3300044684 | Bacteria | 5115 |
| 332 | Ga0466961_0030556 | 3300044693 | Bacteria | 3462 |
| 333 | Ga0466961_0030653 | 3300044693 | Bacteria | 3456 |
| 334 | Ga0466961_0135844 | 3300044693 | Unclassified | 1541 |
| 335 | Ga0466963_0006240 | 3300044694 | Bacteria | 7041 |
| 336 | Ga0466963_0020167 | 3300044694 | Bacteria | 4190 |
| 337 | Ga0466963_0030010 | 3300044694 | Bacteria | 3504 |
| 338 | Ga0466963_0106986 | 3300044694 | Unclassified | 1918 |
| 339 | Ga0466963_0142245 | 3300044694 | Bacteria | 1662 |
| 340 | Ga0466963_0297469 | 3300044694 | Bacteria | 1135 |
| 341 | Ga0466963_0322824 | 3300044694 | Unclassified | 1086 |
| 342 | Ga0466963_0635487 | 3300044694 | Bacteria | 753 |
| 343 | Ga0466963_0770975 | 3300044694 | Bacteria | 678 |
| 344 | Ga0466964_0000812 | 3300044706 | Bacteria | 10208 |
| 345 | Ga0466964_0004511 | 3300044706 | Bacteria | 5142 |
| 346 | Ga0466964_0026930 | 3300044706 | Bacteria | 2253 |
| 347 | Ga0466964_0451446 | 3300044706 | Bacteria | 682 |
| 348 | Ga0466971_0002342 | 3300044719 | Bacteria | 8008 |
| 349 | Ga0466971_0455906 | 3300044719 | Bacteria | 627 |
| 350 | Ga0466968_0091140 | 3300044735 | Unclassified | 1351 |
| 351 | Ga0466968_0229624 | 3300044735 | Bacteria | 876 |
| 352 | Ga0466970_0011268 | 3300044765 | Bacteria | 4556 |
| 353 | Ga0466970_0050461 | 3300044765 | Unclassified | 2219 |
| 354 | Ga0466957_0003835 | 3300044842 | Bacteria | 8311 |
| 355 | Ga0466957_0163449 | 3300044842 | Bacteria | 1447 |
| 356 | Ga0466957_0220008 | 3300044842 | Unclassified | 1253 |
| 357 | Ga0466957_0272744 | 3300044842 | Bacteria | 1130 |
| 358 | Ga0466957_0421676 | 3300044842 | Unclassified | 916 |
| 359 | Ga0466960_0062863 | 3300044901 | Bacteria | 1826 |
| 360 | Ga0466960_0069951 | 3300044901 | Bacteria | 1745 |
| 361 | Ga0466960_0090955 | 3300044901 | Bacteria | 1555 |
| 362 | Ga0466959_0012278 | 3300045049 | Bacteria | 6184 |
| 363 | Ga0466959_0042887 | 3300045049 | Unclassified | 3336 |
| 364 | Ga0466959_0270321 | 3300045049 | Bacteria | 1168 |
| 365 | Ga0466959_0644189 | 3300045049 | Unclassified | 711 |
| 366 | Ga0451576_0213770 | 3300045051 | Unclassified | 2014 |
| 367 | Ga0466958_0000505 | 3300045836 | Bacteria | 16330 |
| 368 | Ga0466958_0049583 | 3300045836 | Bacteria | 2540 |
| 369 | Ga0466958_0074460 | 3300045836 | Bacteria | 2081 |
| 370 | Ga0466958_0203651 | 3300045836 | Bacteria | 1260 |
| 371 | Ga0466967_0004727 | 3300045976 | Bacteria | 9261 |
| 372 | Ga0466967_0022552 | 3300045976 | Bacteria | 5141 |
| 373 | Ga0466967_0023838 | 3300045976 | Bacteria | 5021 |
| 374 | Ga0466967_0028605 | 3300045976 | Bacteria | 4655 |
| 375 | Ga0466967_0039147 | 3300045976 | Bacteria | 4073 |
| 376 | Ga0466967_0049677 | 3300045976 | Bacteria | 3669 |
| 377 | Ga0466967_0109553 | 3300045976 | Bacteria | 2535 |
| 378 | Ga0466967_0122997 | 3300045976 | Bacteria | 2400 |
| 379 | Ga0466967_0127566 | 3300045976 | Bacteria | 2358 |
| 380 | Ga0466967_0149693 | 3300045976 | Bacteria | 2180 |
| 381 | Ga0466967_0153850 | 3300045976 | Bacteria | 2152 |
| 382 | Ga0466967_0170454 | 3300045976 | Bacteria | 2047 |
| 383 | Ga0466967_0261340 | 3300045976 | Bacteria | 1656 |
| 384 | Ga0466967_0408129 | 3300045976 | Bacteria | 1322 |
| 385 | Ga0466967_0746956 | 3300045976 | Bacteria | 970 |
| 386 | Ga0495592_0071613 | 3300046454 | Bacteria | 2523 |
| 387 | Ga0495592_0384538 | 3300046454 | Bacteria | 892 |
| 388 | Ga0495603_0032555 | 3300046455 | Bacteria | 3137 |
| 389 | Ga0495603_0207860 | 3300046455 | Bacteria | 1131 |
| 390 | Ga0495629_0000593 | 3300046459 | Bacteria | 29449 |
| 391 | Ga0495641_0001017 | 3300046461 | Bacteria | 24111 |
| 392 | Ga0495641_0047274 | 3300046461 | Bacteria | 1976 |
| 393 | Ga0495641_0185182 | 3300046461 | Unclassified | 932 |
| 394 | Ga0495651_0093410 | 3300046462 | Bacteria | 2252 |
| 395 | Ga0495651_0171346 | 3300046462 | Bacteria | 1545 |
| 396 | Ga0495651_0195355 | 3300046462 | Bacteria | 1420 |
| 397 | Ga0495653_0013634 | 3300046463 | Bacteria | 6624 |
| 398 | Ga0495653_0060222 | 3300046463 | Bacteria | 2877 |
| 399 | Ga0495582_0000056 | 3300046473 | Bacteria | 57084 |
| 400 | Ga0495582_0237103 | 3300046473 | Bacteria | 1045 |
| 401 | Ga0495639_0002894 | 3300046475 | Bacteria | 7474 |
| 402 | Ga0495662_0023847 | 3300046476 | Bacteria | 2954 |
| 403 | Ga0495662_0062403 | 3300046476 | Bacteria | 1800 |
| 404 | Ga0495662_0151112 | 3300046476 | Bacteria | 1144 |
| 405 | Ga0495664_0209888 | 3300046477 | Bacteria | 1179 |
| 406 | Ga0495664_0264559 | 3300046477 | Bacteria | 1039 |
| 407 | Ga0495664_0422800 | 3300046477 | Bacteria | 799 |
| 408 | Ga0495594_0141682 | 3300046499 | Bacteria | 1364 |
| 409 | Ga0495608_0007181 | 3300046511 | Bacteria | 7876 |
| 410 | Ga0495608_0013145 | 3300046511 | Bacteria | 5745 |
| 411 | Ga0495608_0034997 | 3300046511 | Bacteria | 3389 |
| 412 | Ga0495618_0008086 | 3300046514 | Bacteria | 6369 |
| 413 | Ga0495628_0018890 | 3300046516 | Bacteria | 5705 |
| 414 | Ga0495628_0075779 | 3300046516 | Bacteria | 2619 |
| 415 | Ga0495630_0008240 | 3300046517 | Bacteria | 7486 |
| 416 | Ga0495630_0125469 | 3300046517 | Bacteria | 1948 |
| 417 | Ga0495630_0433103 | 3300046517 | Bacteria | 1007 |
| 418 | Ga0495666_0049482 | 3300046526 | Bacteria | 2021 |
| 419 | Ga0495652_0049329 | 3300046529 | Bacteria | 3605 |
| 420 | Ga0495652_0196507 | 3300046529 | Bacteria | 1535 |
| 421 | Ga0495665_0000364 | 3300046531 | Bacteria | 22881 |
| 422 | Ga0495640_0005466 | 3300046533 | Bacteria | 10109 |
| 423 | Ga0495640_0025293 | 3300046533 | Bacteria | 4308 |
| 424 | Ga0495640_0056826 | 3300046533 | Bacteria | 2672 |
| 425 | Ga0495586_0244415 | 3300046535 | Unclassified | 1023 |
| 426 | Ga0495586_0467775 | 3300046535 | Unclassified | 727 |
| 427 | Ga0495587_0258991 | 3300046536 | Bacteria | 977 |
| 428 | Ga0495645_0123276 | 3300046543 | Unclassified | 1823 |
| 429 | Ga0495645_0146019 | 3300046543 | Bacteria | 1647 |
| 430 | Ga0495667_0009765 | 3300046559 | Bacteria | 6502 |
| 431 | Ga0495667_0033924 | 3300046559 | Bacteria | 3414 |
| 432 | Ga0495667_0040731 | 3300046559 | Bacteria | 3083 |
| 433 | Ga0495667_0044019 | 3300046559 | Bacteria | 2956 |
| 434 | Ga0495634_0107716 | 3300046642 | Bacteria | 1794 |
| 435 | Ga0495634_0236762 | 3300046642 | Unclassified | 1121 |
| 436 | Ga0495634_0437950 | 3300046642 | Unclassified | 772 |
| 437 | Ga0495635_0038948 | 3300046663 | Bacteria | 3291 |
| 438 | Ga0495635_0059851 | 3300046663 | Bacteria | 2619 |
| 439 | Ga0495635_0201113 | 3300046663 | Bacteria | 1351 |
| 440 | Ga0495588_0524163 | 3300046674 | Unclassified | 621 |
| 441 | Ga0495657_0004160 | 3300046675 | Bacteria | 11591 |
| 442 | Ga0495657_0224763 | 3300046675 | Bacteria | 1137 |
| 443 | Ga0495657_0308966 | 3300046675 | Unclassified | 942 |
| 444 | Ga0495599_0128922 | 3300046678 | Bacteria | 1571 |
| 445 | Ga0495623_0067537 | 3300046679 | Bacteria | 2231 |
| 446 | Ga0495623_0302747 | 3300046679 | Bacteria | 883 |
| 447 | Ga0495623_0374611 | 3300046679 | Bacteria | 771 |
| 448 | Ga0495646_0042147 | 3300046680 | Bacteria | 2802 |
| 449 | Ga0495646_0363052 | 3300046680 | Unclassified | 757 |
| 450 | Ga0495646_0721628 | 3300046680 | Bacteria | 500 |
| 451 | Ga0495647_0035675 | 3300046681 | Bacteria | 1868 |
| 452 | Ga0495658_0000615 | 3300046683 | Bacteria | 19383 |
| 453 | Ga0495658_0262244 | 3300046683 | Bacteria | 1088 |
| 454 | Ga0495613_0000401 | 3300046689 | Bacteria | 37127 |
| 455 | Ga0495613_0213630 | 3300046689 | Bacteria | 1356 |
| 456 | Ga0495613_0388076 | 3300046689 | Bacteria | 954 |
| 457 | Ga0495624_0023782 | 3300046690 | Bacteria | 4037 |
| 458 | Ga0495600_0004803 | 3300046809 | Bacteria | 8112 |
| 459 | Ga0495600_0067588 | 3300046809 | Bacteria | 2336 |
| 460 | Ga0495600_0180707 | 3300046809 | Bacteria | 1359 |
| 461 | Ga0495581_0004589 | 3300047315 | Bacteria | 7980 |
| 462 | Ga0495604_0010914 | 3300047317 | Bacteria | 7213 |
| 463 | Ga0495604_0075468 | 3300047317 | Bacteria | 2538 |
| 464 | Ga0495674_0003725 | 3300047319 | Bacteria | 14827 |
| 465 | Ga0495674_0018307 | 3300047319 | Bacteria | 6522 |
| 466 | Ga0495674_0026429 | 3300047319 | Bacteria | 5311 |
| 467 | Ga0495676_0047160 | 3300047321 | Bacteria | 3487 |
| 468 | Ga0495676_0161950 | 3300047321 | Bacteria | 1582 |
| 469 | Ga0495680_0000973 | 3300047322 | Bacteria | 31826 |
| 470 | Ga0495680_0004249 | 3300047322 | Bacteria | 13751 |
| 471 | Ga0495680_0010742 | 3300047322 | Bacteria | 8158 |
| 472 | Ga0495680_0119639 | 3300047322 | Bacteria | 1945 |
| 473 | Ga0495675_0280187 | 3300047444 | Bacteria | 994 |
| 474 | Ga0495675_0586305 | 3300047444 | Bacteria | 633 |
| 475 | Ga0495684_0010685 | 3300047471 | Bacteria | 7097 |
| 476 | Ga0495684_0011390 | 3300047471 | Bacteria | 6867 |
| 477 | Ga0495684_0048807 | 3300047471 | Bacteria | 3236 |
| 478 | Ga0495593_0001438 | 3300047673 | Bacteria | 13969 |
| 479 | Ga0495602_0082829 | 3300048088 | Bacteria | 2690 |
| 480 | Ga0495602_0488765 | 3300048088 | Bacteria | 862 |
| 481 | Ga0495614_0000769 | 3300048089 | Bacteria | 13583 |
| 482 | Ga0496100_0002119 | 3300048903 | Bacteria | 9990 |
| 483 | Ga0496100_0004895 | 3300048903 | Bacteria | 7157 |
| 484 | Ga0496101_0000652 | 3300048904 | Bacteria | 20936 |
| 485 | Ga0496101_0002648 | 3300048904 | Bacteria | 10996 |
| 486 | Ga0496101_0464991 | 3300048904 | Bacteria | 998 |
| 487 | Ga0496102_0001966 | 3300048905 | Bacteria | 17736 |
| 488 | Ga0496102_0082371 | 3300048905 | Bacteria | 2967 |
| 489 | Ga0496102_0300921 | 3300048905 | Bacteria | 1512 |
| 490 | Ga0496102_1362836 | 3300048905 | Bacteria | 628 |
| 491 | Ga0496103_0133440 | 3300048906 | Bacteria | 1586 |
| 492 | Ga0496103_0301922 | 3300048906 | Bacteria | 1030 |
| 493 | Ga0496104_0113102 | 3300048907 | Bacteria | 2603 |
| 494 | Ga0496104_1665051 | 3300048907 | Unclassified | 540 |
| 495 | Ga0496105_0000642 | 3300048908 | Bacteria | 23393 |
| 496 | Ga0496105_0309519 | 3300048908 | Bacteria | 1268 |
| 497 | Ga0496106_0029427 | 3300048909 | Bacteria | 4093 |
| 498 | Ga0496106_0057208 | 3300048909 | Bacteria | 2949 |
| 499 | Ga0496106_0375804 | 3300048909 | Bacteria | 1142 |
| 500 | Ga0496107_0389539 | 3300048910 | Bacteria | 1036 |
| 501 | Ga0496108_0071996 | 3300048911 | Bacteria | 2917 |
| 502 | Ga0496108_0394499 | 3300048911 | Bacteria | 1209 |
| 503 | Ga0496109_0004096 | 3300048912 | Bacteria | 12180 |
| 504 | Ga0496109_0039391 | 3300048912 | Bacteria | 4277 |
| 505 | Ga0496109_0783273 | 3300048912 | Unclassified | 892 |
| 506 | Ga0496109_1207807 | 3300048912 | Bacteria | 693 |
| 507 | Ga0496110_0063330 | 3300048913 | Bacteria | 3267 |
| 508 | Ga0496110_0748749 | 3300048913 | Bacteria | 880 |
| 509 | Ga0496111_0026556 | 3300048914 | Bacteria | 4090 |
| 510 | Ga0496111_0202191 | 3300048914 | Bacteria | 1477 |
| 511 | Ga0496112_0007203 | 3300048915 | Bacteria | 9855 |
| 512 | Ga0496112_0082443 | 3300048915 | Bacteria | 3181 |
| 513 | Ga0496112_0100213 | 3300048915 | Bacteria | 2866 |
| 514 | Ga0496112_0850981 | 3300048915 | Bacteria | 835 |
| 515 | Ga0496113_0154959 | 3300048916 | Bacteria | 1809 |
| 516 | Ga0496113_0373631 | 3300048916 | Bacteria | 1144 |
| 517 | Ga0496113_0695041 | 3300048916 | Bacteria | 812 |
| 518 | Ga0496113_0829303 | 3300048916 | Bacteria | 734 |
| 519 | Ga0496114_0002803 | 3300048917 | Bacteria | 13357 |
| 520 | Ga0496114_0014099 | 3300048917 | Bacteria | 6408 |
| 521 | Ga0496114_0222407 | 3300048917 | Bacteria | 1657 |
| 522 | Ga0496114_0864752 | 3300048917 | Bacteria | 785 |
| 523 | Ga0496115_0063609 | 3300048918 | Bacteria | 2977 |
| 524 | Ga0496115_0110041 | 3300048918 | Bacteria | 2263 |
| 525 | Ga0496115_0178210 | 3300048918 | Bacteria | 1757 |
| 526 | Ga0496115_0251453 | 3300048918 | Bacteria | 1455 |
| 527 | Ga0496115_0349101 | 3300048918 | Bacteria | 1207 |
| 528 | Ga0496115_0669495 | 3300048918 | Bacteria | 819 |
| 529 | Ga0496115_1108899 | 3300048918 | Unclassified | 599 |
| 530 | Ga0501032_0420893 | 3300049569 | Bacteria | 857 |
| 531 | Ga0501036_1001983 | 3300049572 | Bacteria | 684 |
| 532 | Ga0501047_0140043 | 3300049581 | Bacteria | 2298 |
| 533 | Ga0501067_0015110 | 3300049583 | Bacteria | 4272 |
| 534 | Ga0501068_0361723 | 3300049584 | Unclassified | 933 |
| 535 | Ga0501069_0012758 | 3300049585 | Bacteria | 4473 |
| 536 | Ga0501069_0845924 | 3300049585 | Unclassified | 555 |
| 537 | Ga0501070_0001321 | 3300049586 | Bacteria | 22161 |
| 538 | Ga0501070_1217080 | 3300049586 | Bacteria | 577 |
| 539 | Ga0501074_0100754 | 3300049590 | Bacteria | 2067 |
| 540 | Ga0501074_0950085 | 3300049590 | Unclassified | 605 |
| 541 | Ga0501074_1131532 | 3300049590 | Unclassified | 549 |
| 542 | Ga0501076_0789888 | 3300049592 | Bacteria | 783 |
| 543 | Ga0501080_0049253 | 3300049742 | Bacteria | 3922 |
| 544 | Ga0501080_0211277 | 3300049742 | Bacteria | 1778 |
| 545 | Ga0501080_0258985 | 3300049742 | Bacteria | 1585 |
| 546 | Ga0501080_0964790 | 3300049742 | Bacteria | 741 |
| 547 | Ga0501044_0523892 | 3300049823 | Bacteria | 1085 |
| 548 | Ga0501044_0733644 | 3300049823 | Bacteria | 871 |
| 549 | nmdc:mga05p37_531835_c1 | 3300050507 | Bacteria | 1342 |
| 550 | nmdc:mga05p37_86280_c1 | 3300050507 | Bacteria | 3868 |
| 551 | nmdc:mga0n895_26436_c1 | 3300050512 | Bacteria | 5497 |
| 552 | nmdc:mga0n895_55289_c1 | 3300050512 | Bacteria | 3906 |
| 553 | nmdc:mga0rr50_11001_c1 | 3300050513 | Bacteria | 5769 |
| 554 | nmdc:mga0a205_143479_c2 | 3300050515 | Bacteria | 1325 |
| 555 | nmdc:mga0a205_55705_c1 | 3300050515 | Bacteria | 3818 |
| 556 | Ga0495601_0047404 | 3300053077 | Bacteria | 2705 |
| 557 | Ga0495601_0325640 | 3300053077 | Bacteria | 1000 |
| 558 | Ga0495612_0260752 | 3300053078 | Bacteria | 772 |
| 559 | Ga0495655_0000685 | 3300053083 | Bacteria | 5427 |
| 560 | Ga0495595_0001393 | 3300053084 | Bacteria | 9382 |
| 561 | Ga0495595_0003449 | 3300053084 | Bacteria | 6271 |
| 562 | Ga0495595_0203878 | 3300053084 | Unclassified | 985 |
| 563 | Ga0495619_0000860 | 3300053085 | Bacteria | 19904 |
| 564 | Ga0495619_0011590 | 3300053085 | Bacteria | 5555 |
| 565 | Ga0495619_0068354 | 3300053085 | Bacteria | 2373 |
| 566 | Ga0501084_0279804 | 3300054114 | Bacteria | 1409 |
| 567 | Ga0466962_0003840 | 3300061719 | Bacteria | 7179 |
| 568 | Ga0466962_0014176 | 3300061719 | Bacteria | 3840 |
| 569 | Ga0466962_0036636 | 3300061719 | Bacteria | 2348 |
| 570 | Ga0530510_0487069 | 3300061734 | Bacteria | 934 |
| 571 | Ga0070711_100033575 | |||
| 572 | JGI25405J52794_10155949 | |||
| 573 | Ga0070658_10001449 | |||
| 574 | Ga0070658_10340646 | |||
| 575 | Ga0070658_10380540 | |||
| 576 | Ga0070658_11490935 | |||
| 577 | Ga0070683_100024141 | |||
| 578 | Ga0070683_100062448 | |||
| 579 | Ga0070683_100091156 | |||
| 580 | Ga0070683_100109839 | |||
| 581 | Ga0070683_100201571 | |||
| 582 | Ga0070683_101471630 | |||
| 583 | Ga0070680_100005133 | |||
| 584 | Ga0070680_100033903 | |||
| 585 | Ga0070680_100078226 | |||
| 586 | Ga0070680_100087113 | |||
| 587 | Ga0070682_100777299 | |||
| 588 | Ga0070682_100945229 | |||
| 589 | Ga0070660_100000987 | |||
| 590 | Ga0070660_100003524 | |||
| 591 | Ga0070660_100114267 | |||
| 592 | Ga0070660_100284418 | |||
| 593 | Ga0070660_100576707 | |||
| 594 | Ga0070660_100753857 | |||
| 595 | Ga0070660_100933003 | |||
| 596 | Ga0070691_10859107 | |||
| 597 | Ga0070661_100012623 | |||
| 598 | Ga0070661_100294238 | |||
| 599 | Ga0070692_11414713 | |||
| 600 | Ga0070659_100445727 | |||
| 601 | Ga0070659_101191038 | |||
| 602 | Ga0070667_100021689 | |||
| 603 | Ga0070709_10220693 | |||
| 604 | Ga0070709_10858302 | |||
| 605 | Ga0070714_100228397 | |||
| 606 | Ga0070714_100841581 | |||
| 607 | Ga0070713_100175105 | |||
| 608 | Ga0070713_100915389 | |||
| 609 | Ga0070713_101982622 | |||
| 610 | Ga0070711_100043703 | |||
| 611 | Ga0070711_100756266 | |||
| 612 | Ga0070711_102065253 | |||
| 613 | Ga0070694_100269590 | |||
| 614 | Ga0070708_100049681 | |||
| 615 | Ga0070663_100415450 | |||
| 616 | Ga0070681_10003201 | |||
| 617 | Ga0070681_10004684 | |||
| 618 | Ga0070681_10019124 | |||
| 619 | Ga0070681_10133570 | |||
| 620 | Ga0070681_10264839 | |||
| 621 | Ga0070681_10310656 | |||
| 622 | Ga0070681_10396769 | |||
| 623 | Ga0070706_100169905 | |||
| 624 | Ga0070706_100848230 | |||
| 625 | Ga0070698_100386289 | |||
| 626 | Ga0070698_100411237 | |||
| 627 | Ga0070679_100001995 | |||
| 628 | Ga0070679_100015162 | |||
| 629 | Ga0070679_100132429 | |||
| 630 | Ga0070679_100335359 | |||
| 631 | Ga0070679_100617232 | |||
| 632 | Ga0070679_101123969 | |||
| 633 | Ga0070679_101583493 | |||
| 634 | Ga0070684_100002106 | |||
| 635 | Ga0070684_100186520 | |||
| 636 | Ga0070684_100299128 | |||
| 637 | Ga0070684_100316769 | |||
| 638 | Ga0070684_100504803 | |||
| 639 | Ga0070684_100535106 | |||
| 640 | Ga0068853_100264356 | |||
| 641 | Ga0070696_100093087 | |||
| 642 | Ga0070696_101292701 | |||
| 643 | Ga0070665_100082096 | |||
| 644 | Ga0068855_100009118 | |||
| 645 | Ga0068855_100014710 | |||
| 646 | Ga0068855_100020718 | |||
| 647 | Ga0068855_100110948 | |||
| 648 | Ga0068855_100208951 | |||
| 649 | Ga0068855_100330673 | |||
| 650 | Ga0068855_100536054 | |||
| 651 | Ga0068855_102292429 | |||
| 652 | Ga0068857_100121709 | |||
| 653 | Ga0068857_101664263 | |||
| 654 | Ga0068854_101104981 | |||
| 655 | Ga0068856_100036588 | |||
| 656 | Ga0068856_100206811 | |||
| 657 | Ga0068856_101430604 | |||
| 658 | Ga0070702_100861122 | |||
| 659 | Ga0068852_100061117 | |||
| 660 | Ga0068852_100500558 | |||
| 661 | Ga0068852_100822515 | |||
| 662 | Ga0068852_101197737 | |||
| 663 | Ga0068851_10126285 | |||
| 664 | Ga0081455_10112510 | |||
| 665 | Ga0070717_10043876 | |||
| 666 | Ga0070716_100379598 | |||
| 667 | Ga0070712_100071543 | |||
| 668 | Ga0070712_100229493 | |||
| 669 | Ga0070712_100382659 | |||
| 670 | Ga0097621_100173069 | |||
| 671 | Ga0068871_100380079 | |||
| 672 | Ga0075428_100911875 | |||
| 673 | Ga0075433_10079382 | |||
| 674 | Ga0075434_100082418 | |||
| 675 | Ga0075434_100469081 | |||
| 676 | Ga0075436_101139609 | |||
| 677 | Ga0075435_100362723 | |||
| 678 | Ga0105240_10044103 | |||
| 679 | Ga0105240_10410527 | |||
| 680 | Ga0105240_10431317 | |||
| 681 | Ga0105240_11152267 | |||
| 682 | Ga0105240_11457322 | |||
| 683 | Ga0105240_11549704 | |||
| 684 | Ga0105245_10260938 | |||
| 685 | Ga0105245_10924941 | |||
| 686 | Ga0114129_10074307 | |||
| 687 | Ga0114129_10649666 | |||
| 688 | Ga0105241_10794956 | |||
| 689 | Ga0105241_10968419 | |||
| 690 | Ga0105242_10693700 | |||
| 691 | Ga0105242_11892589 | |||
| 692 | Ga0105248_10766734 | |||
| 693 | Ga0105237_11464839 | |||
| 694 | Ga0105238_10553560 | |||
| 695 | Ga0105239_10126011 | |||
| 696 | Ga0105239_11753558 | |||
| 697 | Ga0157338_1026681 | |||
| 698 | Ga0157373_10312011 | |||
| 699 | Ga0157371_10306732 | |||
| 700 | Ga0157370_10011042 | |||
| 701 | Ga0157370_10016302 | |||
| 702 | Ga0157370_10064632 | |||
| 703 | Ga0157370_10189865 | |||
| 704 | Ga0157370_10366013 | |||
| 705 | Ga0157369_10008335 | |||
| 706 | Ga0157369_10009744 | |||
| 707 | Ga0157369_10014825 | |||
| 708 | Ga0157369_10094474 | |||
| 709 | Ga0157369_10173236 | |||
| 710 | Ga0157369_10196521 | |||
| 711 | Ga0157369_10895423 | |||
| 712 | Ga0157374_10388707 | |||
| 713 | Ga0157374_10883511 | |||
| 714 | Ga0157378_10273640 | |||
| 715 | Ga0157372_10178075 | |||
| 716 | Ga0157372_10390622 | |||
| 717 | Ga0157372_10729296 | |||
| 718 | Ga0157372_11278025 | |||
| 719 | Ga0157375_10331121 | |||
| 720 | Ga0157375_10714343 | |||
| 721 | Ga0182008_10055450 | |||
| 722 | Ga0182008_10209013 | |||
| 723 | Ga0157376_10142382 | |||
| 724 | Ga0157376_10699101 | |||
| 725 | Ga0182006_1241420 | |||
| 726 | Ga0182007_10095210 | |||
| 727 | Ga0182005_1251454 | |||
| 728 | Ga0197907_10923657 | |||
| 729 | Ga0197907_11480162 | |||
| 730 | Ga0206356_10083395 | |||
| 731 | Ga0206356_10150529 | |||
| 732 | Ga0206356_10471932 | |||
| 733 | Ga0206356_10487161 | |||
| 734 | Ga0206356_11433091 | |||
| 735 | Ga0206356_11437141 | |||
| 736 | Ga0206349_1403473 | |||
| 737 | Ga0206355_1266765 | |||
| 738 | Ga0206350_10155568 | |||
| 739 | Ga0206354_10077757 | |||
| 740 | Ga0206354_10535991 | |||
| 741 | Ga0206354_10749136 | |||
| 742 | Ga0206354_11534743 | |||
| 743 | Ga0206353_10285970 | |||
| 744 | Ga0206353_10688407 | |||
| 745 | Ga0206353_10725415 | |||
| 746 | Ga0206353_11340468 | |||
| 747 | Ga0213873_10216895 | |||
| 748 | Ga0213874_10079705 | |||
| 749 | Ga0213876_10436084 | |||
| 750 | Ga0213876_10797635 | |||
| 751 | Ga0207692_10377745 | |||
| 752 | Ga0207699_10320702 | |||
| 753 | Ga0207699_10505019 | |||
| 754 | Ga0207705_10041926 | |||
| 755 | Ga0207705_10058898 | |||
| 756 | Ga0207705_10367839 | |||
| 757 | Ga0207684_10354408 | |||
| 758 | Ga0207684_10685533 | |||
| 759 | Ga0207654_10644381 | |||
| 760 | Ga0207707_10016739 | |||
| 761 | Ga0207707_10083988 | |||
| 762 | Ga0207707_10349970 | |||
| 763 | Ga0207695_10320370 | |||
| 764 | Ga0207695_11276292 | |||
| 765 | Ga0207671_11224717 | |||
| 766 | Ga0207693_10074807 | |||
| 767 | Ga0207693_10197300 | |||
| 768 | Ga0207693_10201446 | |||
| 769 | Ga0207663_10026060 | |||
| 770 | Ga0207663_10240498 | |||
| 771 | Ga0207663_10758026 | |||
| 772 | Ga0207660_10045690 | |||
| 773 | Ga0207660_10081042 | |||
| 774 | Ga0207660_10221114 | |||
| 775 | Ga0207660_10483451 | |||
| 776 | Ga0207657_10000046 | |||
| 777 | Ga0207657_10024169 | |||
| 778 | Ga0207657_10484052 | |||
| 779 | Ga0207649_11011513 | |||
| 780 | Ga0207652_10031048 | |||
| 781 | Ga0207652_10075474 | |||
| 782 | Ga0207652_10093410 | |||
| 783 | Ga0207652_10211054 | |||
| 784 | Ga0207652_11300069 | |||
| 785 | Ga0207646_11375008 | |||
| 786 | Ga0207694_10265025 | |||
| 787 | Ga0207694_10665942 | |||
| 788 | Ga0207687_10146630 | |||
| 789 | Ga0207700_10282644 | |||
| 790 | Ga0207700_11235838 | |||
| 791 | Ga0207664_10482069 | |||
| 792 | Ga0207664_10668183 | |||
| 793 | Ga0207664_10815094 | |||
| 794 | Ga0207664_11775617 | |||
| 795 | Ga0207644_11871687 | |||
| 796 | Ga0207690_10115842 | |||
| 797 | Ga0207690_10286186 | |||
| 798 | Ga0207665_10315778 | |||
| 799 | Ga0207711_10581163 | |||
| 800 | Ga0207689_10579906 | |||
| 801 | Ga0207661_10074964 | |||
| 802 | Ga0207661_10133014 | |||
| 803 | Ga0207661_10316423 | |||
| 804 | Ga0207661_10522763 | |||
| 805 | Ga0207661_10594469 | |||
| 806 | Ga0207661_11156181 | |||
| 807 | Ga0207679_10953994 | |||
| 808 | Ga0207667_10062676 | |||
| 809 | Ga0207667_10064407 | |||
| 810 | Ga0207667_10184165 | |||
| 811 | Ga0207667_10201892 | |||
| 812 | Ga0207667_10307208 | |||
| 813 | Ga0207667_10340274 | |||
| 814 | Ga0207667_10383093 | |||
| 815 | Ga0207667_10828900 | |||
| 816 | Ga0207651_10974404 | |||
| 817 | Ga0207658_10014868 | |||
| 818 | Ga0207639_10685063 | |||
| 819 | Ga0207639_11524272 | |||
| 820 | Ga0207678_10920349 | |||
| 821 | Ga0207678_11612253 | |||
| 822 | Ga0207702_10187588 | |||
| 823 | Ga0207674_10080828 | |||
| 824 | Ga0207698_10150953 | |||
| 825 | Ga0207698_12451749 | |||
| 826 | Ga0268266_10155440 | |||
| 827 | Ga0265318_10320562 | |||
| 828 | Ga0265338_10008970 | |||
| 829 | Ga0265338_10090933 | |||
| 830 | Ga0265330_10024688 | |||
| 831 | Ga0265320_10057643 | |||
| 832 | Ga0265320_10263142 | |||
| 833 | Ga0265340_10259305 | |||
| 834 | Ga0265339_10049329 | |||
| 835 | Ga0265327_10004459 | |||
| 836 | Ga0265316_10003711 | |||
| 837 | Ga0265313_10015692 | |||
| 838 | Ga0265314_10003383 | |||
| 839 | Ga0265314_10681446 | |||
| 840 | Ga0265342_10025737 | |||
| 841 | Ga0307409_100249452 | |||
| 842 | Ga0307416_102659985 | |||
| 843 | Ga0307415_100511244 | |||
| 844 | Ga0373926_0016043 | |||
| 845 | Ga0373934_0332888 | |||
| 846 | Ga0373944_0029015 | |||
| 847 | Ga0373936_0244090 | |||
| 848 | Ga0373945_0027190 | |||
| 849 | Ga0373953_0018419 | |||
| 850 | Ga0373954_0113328 | |||
| 851 | Ga0373943_0001192 | |||
| 852 | Ga0373943_0002076 | |||
| 853 | Ga0373946_0008675 | |||
| 854 | Ga0373946_0012412 | |||
| 855 | Ga0373942_0103722 | |||
| 856 | Ga0373935_0029018 | |||
| 857 | Ga0373935_0486496 | |||
| 858 | Ga0373933_0556889 | |||
| 859 | Ga0373947_0006355 | |||
| 860 | Ga0373947_0065448 | |||
| 861 | Ga0373947_0674184 | |||
| 862 | Ga0373937_0033772 | |||
| 863 | Ga0373925_0005621 | |||
| 864 | Ga0373925_0005903 | |||
| 865 | Ga0395899_0105959 | |||
| 866 | Ga0395899_0108061 | |||
| 867 | Ga0395899_0236483 | |||
| 868 | Ga0395899_0975299 | |||
| 869 | Ga0395900_0036672 | |||
| 870 | Ga0395900_0095726 | |||
| 871 | Ga0395900_0687649 | |||
| 872 | Ga0395900_0887791 | |||
| 873 | Ga0395898_0007189 | |||
| 874 | Ga0395898_0029790 | |||
| 875 | Ga0395898_0236587 | |||
| 876 | Ga0395898_0459246 | |||
| 877 | Ga0395898_0523626 | |||
| 878 | Ga0395898_0600839 | |||
| 879 | Ga0395898_1005412 | |||
| 880 | Ga0395905_0030028 | |||
| 881 | Ga0395905_0053635 | |||
| 882 | Ga0395905_0096992 | |||
| 883 | Ga0395905_0660542 | |||
| 884 | Ga0395901_0045312 | |||
| 885 | Ga0395901_0084737 | |||
| 886 | Ga0395901_0375631 | |||
| 887 | Ga0395901_0382959 | |||
| 888 | Ga0395901_0641448 | |||
| 889 | Ga0436365_0102858 | |||
| 890 | Ga0436365_1489176 | |||
| 891 | Ga0436365_1507410 | |||
| 892 | Ga0436363_0092653 | |||
| 893 | Ga0436363_0795855 | |||
| 894 | Ga0436362_0999390 | |||
| 895 | Ga0451853_0231954 | |||
| 896 | Ga0451853_3542244 | |||
| 897 | Ga0439448_0255674 | |||
| 898 | Ga0450903_047506 | |||
| 899 | Ga0466965_0370297 | |||
| 900 | Ga0466966_0002668 | |||
| 901 | Ga0466966_0015061 | |||
| 902 | Ga0466961_0030556 | |||
| 903 | Ga0466961_0030653 | |||
| 904 | Ga0466961_0135844 | |||
| 905 | Ga0466963_0006240 | |||
| 906 | Ga0466963_0020167 | |||
| 907 | Ga0466963_0030010 | |||
| 908 | Ga0466963_0106986 | |||
| 909 | Ga0466963_0142245 | |||
| 910 | Ga0466963_0297469 | |||
| 911 | Ga0466963_0322824 | |||
| 912 | Ga0466963_0635487 | |||
| 913 | Ga0466963_0770975 | |||
| 914 | Ga0466964_0000812 | |||
| 915 | Ga0466964_0004511 | |||
| 916 | Ga0466964_0026930 | |||
| 917 | Ga0466964_0451446 | |||
| 918 | Ga0466971_0002342 | |||
| 919 | Ga0466971_0455906 | |||
| 920 | Ga0466968_0091140 | |||
| 921 | Ga0466968_0229624 | |||
| 922 | Ga0466970_0011268 | |||
| 923 | Ga0466970_0050461 | |||
| 924 | Ga0466957_0003835 | |||
| 925 | Ga0466957_0163449 | |||
| 926 | Ga0466957_0220008 | |||
| 927 | Ga0466957_0272744 | |||
| 928 | Ga0466957_0421676 | |||
| 929 | Ga0466960_0062863 | |||
| 930 | Ga0466960_0069951 | |||
| 931 | Ga0466960_0090955 | |||
| 932 | Ga0466959_0012278 | |||
| 933 | Ga0466959_0042887 | |||
| 934 | Ga0466959_0270321 | |||
| 935 | Ga0466959_0644189 | |||
| 936 | Ga0451576_0213770 | |||
| 937 | Ga0466958_0000505 | |||
| 938 | Ga0466958_0049583 | |||
| 939 | Ga0466958_0074460 | |||
| 940 | Ga0466958_0203651 | |||
| 941 | Ga0466967_0004727 | |||
| 942 | Ga0466967_0022552 | |||
| 943 | Ga0466967_0023838 | |||
| 944 | Ga0466967_0028605 | |||
| 945 | Ga0466967_0039147 | |||
| 946 | Ga0466967_0049677 | |||
| 947 | Ga0466967_0109553 | |||
| 948 | Ga0466967_0122997 | |||
| 949 | Ga0466967_0127566 | |||
| 950 | Ga0466967_0149693 | |||
| 951 | Ga0466967_0153850 | |||
| 952 | Ga0466967_0170454 | |||
| 953 | Ga0466967_0261340 | |||
| 954 | Ga0466967_0408129 | |||
| 955 | Ga0466967_0746956 | |||
| 956 | Ga0495592_0071613 | |||
| 957 | Ga0495592_0384538 | |||
| 958 | Ga0495603_0032555 | |||
| 959 | Ga0495603_0207860 | |||
| 960 | Ga0495629_0000593 | |||
| 961 | Ga0495641_0001017 | |||
| 962 | Ga0495641_0047274 | |||
| 963 | Ga0495641_0185182 | |||
| 964 | Ga0495651_0093410 | |||
| 965 | Ga0495651_0171346 | |||
| 966 | Ga0495651_0195355 | |||
| 967 | Ga0495653_0013634 | |||
| 968 | Ga0495653_0060222 | |||
| 969 | Ga0495582_0000056 | |||
| 970 | Ga0495582_0237103 | |||
| 971 | Ga0495639_0002894 | |||
| 972 | Ga0495662_0023847 | |||
| 973 | Ga0495662_0062403 | |||
| 974 | Ga0495662_0151112 | |||
| 975 | Ga0495664_0209888 | |||
| 976 | Ga0495664_0264559 | |||
| 977 | Ga0495664_0422800 | |||
| 978 | Ga0495594_0141682 | |||
| 979 | Ga0495608_0007181 | |||
| 980 | Ga0495608_0013145 | |||
| 981 | Ga0495608_0034997 | |||
| 982 | Ga0495618_0008086 | |||
| 983 | Ga0495628_0018890 | |||
| 984 | Ga0495628_0075779 | |||
| 985 | Ga0495630_0008240 | |||
| 986 | Ga0495630_0125469 | |||
| 987 | Ga0495630_0433103 | |||
| 988 | Ga0495666_0049482 | |||
| 989 | Ga0495652_0049329 | |||
| 990 | Ga0495652_0196507 | |||
| 991 | Ga0495665_0000364 | |||
| 992 | Ga0495640_0005466 | |||
| 993 | Ga0495640_0025293 | |||
| 994 | Ga0495640_0056826 | |||
| 995 | Ga0495586_0244415 | |||
| 996 | Ga0495586_0467775 | |||
| 997 | Ga0495587_0258991 | |||
| 998 | Ga0495645_0123276 | |||
| 999 | Ga0495645_0146019 | |||
| 1000 | Ga0495667_0009765 | |||
| 1001 | Ga0495667_0033924 | |||
| 1002 | Ga0495667_0040731 | |||
| 1003 | Ga0495667_0044019 | |||
| 1004 | Ga0495634_0107716 | |||
| 1005 | Ga0495634_0236762 | |||
| 1006 | Ga0495634_0437950 | |||
| 1007 | Ga0495635_0038948 | |||
| 1008 | Ga0495635_0059851 | |||
| 1009 | Ga0495635_0201113 | |||
| 1010 | Ga0495588_0524163 | |||
| 1011 | Ga0495657_0004160 | |||
| 1012 | Ga0495657_0224763 | |||
| 1013 | Ga0495657_0308966 | |||
| 1014 | Ga0495599_0128922 | |||
| 1015 | Ga0495623_0067537 | |||
| 1016 | Ga0495623_0302747 | |||
| 1017 | Ga0495623_0374611 | |||
| 1018 | Ga0495646_0042147 | |||
| 1019 | Ga0495646_0363052 | |||
| 1020 | Ga0495646_0721628 | |||
| 1021 | Ga0495647_0035675 | |||
| 1022 | Ga0495658_0000615 | |||
| 1023 | Ga0495658_0262244 | |||
| 1024 | Ga0495613_0000401 | |||
| 1025 | Ga0495613_0213630 | |||
| 1026 | Ga0495613_0388076 | |||
| 1027 | Ga0495624_0023782 | |||
| 1028 | Ga0495600_0004803 | |||
| 1029 | Ga0495600_0067588 | |||
| 1030 | Ga0495600_0180707 | |||
| 1031 | Ga0495581_0004589 | |||
| 1032 | Ga0495604_0010914 | |||
| 1033 | Ga0495604_0075468 | |||
| 1034 | Ga0495674_0003725 | |||
| 1035 | Ga0495674_0018307 | |||
| 1036 | Ga0495674_0026429 | |||
| 1037 | Ga0495676_0047160 | |||
| 1038 | Ga0495676_0161950 | |||
| 1039 | Ga0495680_0000973 | |||
| 1040 | Ga0495680_0004249 | |||
| 1041 | Ga0495680_0010742 | |||
| 1042 | Ga0495680_0119639 | |||
| 1043 | Ga0495675_0280187 | |||
| 1044 | Ga0495675_0586305 | |||
| 1045 | Ga0495684_0010685 | |||
| 1046 | Ga0495684_0011390 | |||
| 1047 | Ga0495684_0048807 | |||
| 1048 | Ga0495593_0001438 | |||
| 1049 | Ga0495602_0082829 | |||
| 1050 | Ga0495602_0488765 | |||
| 1051 | Ga0495614_0000769 | |||
| 1052 | Ga0496100_0002119 | |||
| 1053 | Ga0496100_0004895 | |||
| 1054 | Ga0496101_0000652 | |||
| 1055 | Ga0496101_0002648 | |||
| 1056 | Ga0496101_0464991 | |||
| 1057 | Ga0496102_0001966 | |||
| 1058 | Ga0496102_0082371 | |||
| 1059 | Ga0496102_0300921 | |||
| 1060 | Ga0496102_1362836 | |||
| 1061 | Ga0496103_0133440 | |||
| 1062 | Ga0496103_0301922 | |||
| 1063 | Ga0496104_0113102 | |||
| 1064 | Ga0496104_1665051 | |||
| 1065 | Ga0496105_0000642 | |||
| 1066 | Ga0496105_0309519 | |||
| 1067 | Ga0496106_0029427 | |||
| 1068 | Ga0496106_0057208 | |||
| 1069 | Ga0496106_0375804 | |||
| 1070 | Ga0496107_0389539 | |||
| 1071 | Ga0496108_0071996 | |||
| 1072 | Ga0496108_0394499 | |||
| 1073 | Ga0496109_0004096 | |||
| 1074 | Ga0496109_0039391 | |||
| 1075 | Ga0496109_0783273 | |||
| 1076 | Ga0496109_1207807 | |||
| 1077 | Ga0496110_0063330 | |||
| 1078 | Ga0496110_0748749 | |||
| 1079 | Ga0496111_0026556 | |||
| 1080 | Ga0496111_0202191 | |||
| 1081 | Ga0496112_0007203 | |||
| 1082 | Ga0496112_0082443 | |||
| 1083 | Ga0496112_0100213 | |||
| 1084 | Ga0496112_0850981 | |||
| 1085 | Ga0496113_0154959 | |||
| 1086 | Ga0496113_0373631 | |||
| 1087 | Ga0496113_0695041 | |||
| 1088 | Ga0496113_0829303 | |||
| 1089 | Ga0496114_0002803 | |||
| 1090 | Ga0496114_0014099 | |||
| 1091 | Ga0496114_0222407 | |||
| 1092 | Ga0496114_0864752 | |||
| 1093 | Ga0496115_0063609 | |||
| 1094 | Ga0496115_0110041 | |||
| 1095 | Ga0496115_0178210 | |||
| 1096 | Ga0496115_0251453 | |||
| 1097 | Ga0496115_0349101 | |||
| 1098 | Ga0496115_0669495 | |||
| 1099 | Ga0496115_1108899 | |||
| 1100 | Ga0501032_0420893 | |||
| 1101 | Ga0501036_1001983 | |||
| 1102 | Ga0501047_0140043 | |||
| 1103 | Ga0501067_0015110 | |||
| 1104 | Ga0501068_0361723 | |||
| 1105 | Ga0501069_0012758 | |||
| 1106 | Ga0501069_0845924 | |||
| 1107 | Ga0501070_0001321 | |||
| 1108 | Ga0501070_1217080 | |||
| 1109 | Ga0501074_0100754 | |||
| 1110 | Ga0501074_0950085 | |||
| 1111 | Ga0501074_1131532 | |||
| 1112 | Ga0501076_0789888 | |||
| 1113 | Ga0501080_0049253 | |||
| 1114 | Ga0501080_0211277 | |||
| 1115 | Ga0501080_0258985 | |||
| 1116 | Ga0501080_0964790 | |||
| 1117 | Ga0501044_0523892 | |||
| 1118 | Ga0501044_0733644 | |||
| 1119 | nmdc:mga05p37_531835_c1 | |||
| 1120 | nmdc:mga05p37_86280_c1 | |||
| 1121 | nmdc:mga0n895_26436_c1 | |||
| 1122 | nmdc:mga0n895_55289_c1 | |||
| 1123 | nmdc:mga0rr50_11001_c1 | |||
| 1124 | nmdc:mga0a205_143479_c2 | |||
| 1125 | nmdc:mga0a205_55705_c1 | |||
| 1126 | Ga0495601_0047404 | |||
| 1127 | Ga0495601_0325640 | |||
| 1128 | Ga0495612_0260752 | |||
| 1129 | Ga0495655_0000685 | |||
| 1130 | Ga0495595_0001393 | |||
| 1131 | Ga0495595_0003449 | |||
| 1132 | Ga0495595_0203878 | |||
| 1133 | Ga0495619_0000860 | |||
| 1134 | Ga0495619_0011590 | |||
| 1135 | Ga0495619_0068354 | |||
| 1136 | Ga0501084_0279804 | |||
| 1137 | Ga0466962_0003840 | |||
| 1138 | Ga0466962_0014176 | |||
| 1139 | Ga0466962_0036636 | |||
| 1140 | Ga0530510_0487069 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1n0g-assembly1.cif.gz_A | crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif | 0.9256 | 1 | 133 |
| 1n0g-assembly1.cif.gz_A | crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif | 0.8696 | 1 | 133 |
| 2glw-assembly1.cif.gz_A | the solution structure of phs018 from pyrococcus horikoshii | 0.5256 | 1 | 115 |
| 2glw-assembly1.cif.gz_A | the solution structure of phs018 from pyrococcus horikoshii | 0.4729 | 1 | 115 |
| 4a4k-assembly5.cif.gz_I | crystal structure of the s. cerevisiae ski2 insertion domain | 0.4129 | 19 | 43 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJN9_1_138_3.40.1550.20 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain | 0.9576 | 1 | 133 | 3.40.1550.20 |
| af_P22186_1_143_3.40.1550.20 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain | 0.9386 | 1 | 132 | 3.40.1550.20 |
| 1n0eB00 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain | 0.9247 | 1 | 133 | 3.40.1550.20 |
| af_Q2FZ97_1_142_3.40.1550.20 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain | 0.9205 | 1 | 142 | 3.40.1550.20 |
| af_P9WJN9_1_138_3.40.1550.20 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain | 0.9176 | 1 | 133 | 3.40.1550.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521RZG5-F1-model_v4 | Transcriptional regulator MraZ | 0.9819 | 2 | 125 |
GO:0000976
GO:0003700 GO:0005737 GO:0009295 GO:2000143 |
| AF-A0A1F5EQK4-F1-model_v4 | Transcriptional regulator MraZ | 0.9805 | 1 | 128 |
GO:0000976
GO:0003700 GO:0005737 GO:0051301 GO:2000143 |
| AF-A0A1F8KPM3-F1-model_v4 | Transcriptional regulator MraZ | 0.9802 | 1 | 127 |
GO:0000976
GO:0003700 GO:0005737 GO:0009295 GO:2000143 |
| AF-A0A2M6R9Q2-F1-model_v4 | Transcriptional regulator MraZ | 0.9797 | 1 | 126 |
GO:0000976
GO:0003700 GO:0005737 GO:0009295 GO:2000143 |
| AF-R7K5C9-F1-model_v4 | Transcriptional regulator MraZ | 0.9791 | 1 | 123 |
GO:0000976
GO:0003700 GO:0005737 GO:0009295 GO:2000143 |