F464796

General Info

Members Datasets Scaffolds Average Seq Length
570 315 1140 154

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10103937|Ga0070691_101039372
Length 188
Sequence MSIVGPRVKSAPAETGAIATVYDAGRVRRPRTEFLMHAFARAVAILALVAGFGVAVEAAAIAPAAAQTAGKKIMTTASGLKYTDETVGTGPSPKPGQTAVVHYTGWLYVNGVKGAKFDSSVDRNEPFSFPVGKGRVIKGWDEGVATMKVGGKRTLIIPPALGYGASGAGGVIPPNATLMFDVELLAVK

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
63 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
64 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
92 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
93 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
151 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
152 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
153 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
154 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
193 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
194 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
195 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
307 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
308 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
309 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
310 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
311 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
312 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
315 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.18
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.63
Nodule 2.81
Rhizoplane 10.7
Rhizosphere 70.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10103937 3300005341 Bacteria 1414
2 JGI24751J29686_10104580 3300002459 Bacteria 592
3 JGI25153J46596_10000560 3300003215 Bacteria 23047
4 JGI25160J50197_1003827 3300003354 Bacteria 6610
5 Ga0055531_10003731 3300003794 Bacteria 9573
6 Ga0065165_1004598 3300005262 Bacteria 8400
7 Ga0065165_1060899 3300005262 Bacteria 1035
8 Ga0070658_10196990 3300005327 Bacteria 1699
9 Ga0070670_100202787 3300005331 Bacteria 1724
10 Ga0070670_100337358 3300005331 Bacteria 1323
11 Ga0070680_100024919 3300005336 Bacteria 4782
12 Ga0070680_100214640 3300005336 Bacteria 1624
13 Ga0070680_100412164 3300005336 Bacteria 1152
14 Ga0070682_100678550 3300005337 Bacteria 824
15 Ga0070660_100228074 3300005339 Bacteria 1515
16 Ga0070660_100421867 3300005339 Bacteria 1105
17 Ga0070689_100311399 3300005340 Bacteria 1313
18 Ga0070668_100047473 3300005347 Bacteria 3301
19 Ga0070668_101536339 3300005347 Bacteria 609
20 Ga0070669_101145280 3300005353 Bacteria 671
21 Ga0070675_100172821 3300005354 Bacteria 1864
22 Ga0070675_101424738 3300005354 Bacteria 639
23 Ga0070671_101593269 3300005355 Bacteria 579
24 Ga0070674_100074026 3300005356 Bacteria 2416
25 Ga0070673_100100290 3300005364 Bacteria 2383
26 Ga0070673_101049537 3300005364 Bacteria 760
27 Ga0070688_100041703 3300005365 Bacteria 2819
28 Ga0070659_100213216 3300005366 Bacteria 1592
29 Ga0070667_100279544 3300005367 Bacteria 1499
30 Ga0070709_10000261 3300005434 Bacteria 33691
31 Ga0070709_10347673 3300005434 Bacteria 1095
32 Ga0070714_100037946 3300005435 Bacteria 4051
33 Ga0070714_100153262 3300005435 Bacteria 2078
34 Ga0070714_100325728 3300005435 Bacteria 1438
35 Ga0070713_100040271 3300005436 Bacteria 3798
36 Ga0070710_10000210 3300005437 Bacteria 27444
37 Ga0070710_10046737 3300005437 Bacteria 2412
38 Ga0070711_100025996 3300005439 Bacteria 3833
39 Ga0070711_100216032 3300005439 Bacteria 1488
40 Ga0070663_100013561 3300005455 Bacteria 5202
41 Ga0070663_100109563 3300005455 Bacteria 2073
42 Ga0070663_100273483 3300005455 Bacteria 1344
43 Ga0070678_100076771 3300005456 Bacteria 2518
44 Ga0070678_100227867 3300005456 Bacteria 1552
45 Ga0070662_100268101 3300005457 Bacteria 1378
46 Ga0070662_100368843 3300005457 Bacteria 1179
47 Ga0070681_10048935 3300005458 Bacteria 4223
48 Ga0070681_10071418 3300005458 Bacteria 3436
49 Ga0070681_10115574 3300005458 Bacteria 2621
50 Ga0070681_10134729 3300005458 Bacteria 2401
51 Ga0070681_10368028 3300005458 Bacteria 1348
52 Ga0070679_100165885 3300005530 Bacteria 2182
53 Ga0070679_100387164 3300005530 Bacteria 1345
54 Ga0070679_100794068 3300005530 Bacteria 890
55 Ga0070679_101485394 3300005530 Bacteria 624
56 Ga0070697_101715629 3300005536 Bacteria 562
57 Ga0068853_100526611 3300005539 Bacteria 1118
58 Ga0068853_101500504 3300005539 Bacteria 653
59 Ga0070672_100054030 3300005543 Bacteria 3143
60 Ga0070686_100753878 3300005544 Bacteria 781
61 Ga0070665_100053032 3300005548 Bacteria 4067
62 Ga0070665_100224569 3300005548 Bacteria 1878
63 Ga0070665_100244008 3300005548 Bacteria 1797
64 Ga0068855_100108082 3300005563 Bacteria 3195
65 Ga0068855_100734852 3300005563 Bacteria 1054
66 Ga0070664_101282821 3300005564 Bacteria 692
67 Ga0068857_100088811 3300005577 Bacteria 2765
68 Ga0068857_101082360 3300005577 Bacteria 774
69 Ga0068857_101556984 3300005577 Bacteria 645
70 Ga0068854_100152560 3300005578 Bacteria 1783
71 Ga0068854_100270209 3300005578 Bacteria 1365
72 Ga0068852_100215450 3300005616 Bacteria 1824
73 Ga0068859_100100443 3300005617 Bacteria 2949
74 Ga0068859_100588792 3300005617 Bacteria 1206
75 Ga0068861_100652511 3300005719 Bacteria 972
76 Ga0068863_100085365 3300005841 Bacteria 2991
77 Ga0068858_100843865 3300005842 Bacteria 895
78 Ga0068860_101322273 3300005843 Bacteria 742
79 Ga0070717_10087927 3300006028 Bacteria 2618
80 Ga0070717_10947980 3300006028 Bacteria 784
81 Ga0070717_11318472 3300006028 Bacteria 656
82 Ga0075365_10034633 3300006038 Bacteria 3262
83 Ga0075365_10047090 3300006038 Bacteria 2833
84 Ga0075365_10051895 3300006038 Bacteria 2710
85 Ga0075365_10142828 3300006038 Bacteria 1662
86 Ga0075368_10017272 3300006042 Bacteria 2699
87 Ga0075368_10035322 3300006042 Bacteria 1950
88 Ga0075368_10074422 3300006042 Bacteria 1376
89 Ga0075363_100017468 3300006048 Bacteria 3558
90 Ga0075363_100287963 3300006048 Bacteria 951
91 Ga0075364_10148960 3300006051 Bacteria 1576
92 Ga0075364_10461733 3300006051 Bacteria 868
93 Ga0070715_10419022 3300006163 Bacteria 749
94 Ga0070715_10489777 3300006163 Bacteria 702
95 Ga0070716_100030058 3300006173 Bacteria 2943
96 Ga0070712_100024163 3300006175 Bacteria 4023
97 Ga0070712_100096022 3300006175 Bacteria 2182
98 Ga0070712_100277452 3300006175 Bacteria 1349
99 Ga0070712_100403527 3300006175 Bacteria 1129
100 Ga0075362_10058713 3300006177 Bacteria 1736
101 Ga0075362_10529034 3300006177 Bacteria 605
102 Ga0075367_10089319 3300006178 Bacteria 1873
103 Ga0075367_10116979 3300006178 Bacteria 1640
104 Ga0075367_10298117 3300006178 Bacteria 1015
105 Ga0075367_10447294 3300006178 Bacteria 819
106 Ga0075366_10104244 3300006195 Bacteria 1704
107 Ga0075366_10137737 3300006195 Bacteria 1475
108 Ga0075366_10475472 3300006195 Bacteria 772
109 Ga0097621_100728402 3300006237 Bacteria 915
110 Ga0075370_10054875 3300006353 Bacteria 2263
111 Ga0068871_101026812 3300006358 Bacteria 769
112 Ga0097620_100100448 3300006931 Bacteria 2949
113 Ga0097620_100588787 3300006931 Bacteria 1206
114 Ga0099825_1037919 3300006941 Bacteria 1565
115 Ga0099824_1036906 3300006942 Bacteria 1389
116 Ga0099823_1015403 3300006944 Bacteria 7581
117 Ga0075435_101297309 3300007076 Bacteria 638
118 Ga0099795_10168293 3300007788 Bacteria 909
119 Ga0105240_10023872 3300009093 Bacteria 8077
120 Ga0105240_10111074 3300009093 Bacteria 3317
121 Ga0105245_10282164 3300009098 Bacteria 1624
122 Ga0105247_10075595 3300009101 Bacteria 2114
123 Ga0105243_10020564 3300009148 Bacteria 5004
124 Ga0105243_10740964 3300009148 Bacteria 962
125 Ga0105241_10059790 3300009174 Bacteria 2931
126 Ga0105241_11513428 3300009174 Bacteria 646
127 Ga0105242_10063591 3300009176 Bacteria 3039
128 Ga0105248_10038686 3300009177 Bacteria 5339
129 Ga0105237_10381640 3300009545 Bacteria 1414
130 Ga0105237_10867833 3300009545 Bacteria 909
131 Ga0105238_10000577 3300009551 Bacteria 38524
132 Ga0105238_10033988 3300009551 Bacteria 5188
133 Ga0105238_11772453 3300009551 Bacteria 649
134 Ga0105249_12170438 3300009553 Bacteria 628
135 Ga0105249_12456027 3300009553 Bacteria 594
136 Ga0105239_10002730 3300010375 Bacteria 22163
137 Ga0105239_10006321 3300010375 Bacteria 13782
138 Ga0105239_10052776 3300010375 Bacteria 4459
139 Ga0105239_10430323 3300010375 Bacteria 1496
140 Ga0105246_10044664 3300011119 Bacteria 3012
141 Ga0157371_10064895 3300013102 Bacteria 2586
142 Ga0157370_10131437 3300013104 Bacteria 2335
143 Ga0157370_10373388 3300013104 Bacteria 1314
144 Ga0157370_10468207 3300013104 Bacteria 1158
145 Ga0157369_10008567 3300013105 Bacteria 11731
146 Ga0157369_10596161 3300013105 Bacteria 1141
147 Ga0157374_10095353 3300013296 Bacteria 2845
148 Ga0157374_10513393 3300013296 Bacteria 1204
149 Ga0157374_10751862 3300013296 Bacteria 989
150 Ga0163162_10155605 3300013306 Bacteria 2406
151 Ga0163163_10313012 3300014325 Bacteria 1623
152 Ga0163163_10650854 3300014325 Bacteria 1117
153 Ga0163163_10803370 3300014325 Bacteria 1004
154 Ga0157380_10046758 3300014326 Bacteria 3401
155 Ga0157380_10564542 3300014326 Bacteria 1119
156 Ga0157377_10404261 3300014745 Bacteria 931
157 Ga0157377_10914538 3300014745 Bacteria 657
158 Ga0157379_10606306 3300014968 Bacteria 1022
159 Ga0157379_10759465 3300014968 Bacteria 913
160 Ga0157376_10298847 3300014969 Bacteria 1523
161 Ga0182005_1212271 3300015265 Bacteria 586
162 Ga0206353_10149552 3300020082 Bacteria 1929
163 Ga0214542_1000058 3300021321 Bacteria 133923
164 Ga0214542_1025427 3300021321 Bacteria 3092
165 Ga0214545_1000026 3300021324 Bacteria 133811
166 Ga0214545_1016362 3300021324 Bacteria 7682
167 Ga0214543_1002325 3300021327 Bacteria 37311
168 Ga0214543_1031379 3300021327 Bacteria 2123
169 Ga0228598_1001342 3300024227 Bacteria 5411
170 Ga0207425_1042066 3300025245 Bacteria 866
171 Ga0209129_1051943 3300025258 Bacteria 624
172 Ga0209564_1004700 3300025295 Bacteria 8186
173 Ga0209564_1005701 3300025295 Bacteria 6979
174 Ga0209758_1000011 3300025297 Bacteria 1049685
175 Ga0209758_1000940 3300025297 Bacteria 39289
176 Ga0209758_1001336 3300025297 Bacteria 29877
177 Ga0209256_1025400 3300025299 Bacteria 1725
178 Ga0207426_1004163 3300025302 Bacteria 7231
179 Ga0209257_1000158 3300025304 Bacteria 180079
180 Ga0209257_1014253 3300025304 Bacteria 3432
181 Ga0209257_1025655 3300025304 Bacteria 2008
182 Ga0209257_1093316 3300025304 Bacteria 747
183 Ga0207710_10112344 3300025900 Bacteria 1294
184 Ga0207688_10108686 3300025901 Bacteria 1608
185 Ga0207680_10406771 3300025903 Bacteria 962
186 Ga0207680_10422890 3300025903 Bacteria 944
187 Ga0207647_10002857 3300025904 Bacteria 13013
188 Ga0207647_10325881 3300025904 Bacteria 872
189 Ga0207699_10001210 3300025906 Bacteria 12240
190 Ga0207705_10200663 3300025909 Bacteria 1511
191 Ga0207705_10788485 3300025909 Bacteria 738
192 Ga0207707_10034632 3300025912 Bacteria 4418
193 Ga0207707_10079987 3300025912 Bacteria 2854
194 Ga0207707_10119943 3300025912 Bacteria 2299
195 Ga0207707_10222453 3300025912 Bacteria 1643
196 Ga0207707_10573617 3300025912 Bacteria 957
197 Ga0207707_10726693 3300025912 Bacteria 832
198 Ga0207695_10022692 3300025913 Bacteria 7113
199 Ga0207695_10091336 3300025913 Bacteria 3059
200 Ga0207695_10323027 3300025913 Bacteria 1433
201 Ga0207671_10049790 3300025914 Bacteria 3102
202 Ga0207671_10941489 3300025914 Bacteria 682
203 Ga0207693_10069824 3300025915 Bacteria 2749
204 Ga0207693_10312774 3300025915 Bacteria 1230
205 Ga0207663_10257083 3300025916 Bacteria 1288
206 Ga0207660_10014919 3300025917 Bacteria 5122
207 Ga0207660_10054432 3300025917 Bacteria 2856
208 Ga0207660_10118064 3300025917 Bacteria 2006
209 Ga0207660_10293694 3300025917 Bacteria 1293
210 Ga0207662_10743115 3300025918 Bacteria 689
211 Ga0207657_10711598 3300025919 Bacteria 780
212 Ga0207657_10943293 3300025919 Bacteria 664
213 Ga0207649_10622862 3300025920 Bacteria 832
214 Ga0207652_10178507 3300025921 Bacteria 1907
215 Ga0207652_10587906 3300025921 Bacteria 999
216 Ga0207652_11356633 3300025921 Bacteria 614
217 Ga0207681_10564332 3300025923 Bacteria 938
218 Ga0207694_10000273 3300025924 Bacteria 49024
219 Ga0207694_10725040 3300025924 Bacteria 839
220 Ga0207650_10366702 3300025925 Bacteria 1187
221 Ga0207659_10324274 3300025926 Bacteria 1271
222 Ga0207687_10516293 3300025927 Bacteria 999
223 Ga0207700_10045098 3300025928 Bacteria 3251
224 Ga0207700_10074350 3300025928 Bacteria 2628
225 Ga0207664_10014428 3300025929 Bacteria 5705
226 Ga0207664_10031561 3300025929 Bacteria 4054
227 Ga0207664_10289400 3300025929 Bacteria 1439
228 Ga0207664_10324633 3300025929 Bacteria 1358
229 Ga0207644_10287027 3300025931 Bacteria 1322
230 Ga0207690_10415108 3300025932 Bacteria 1076
231 Ga0207690_10792413 3300025932 Bacteria 783
232 Ga0207706_10121113 3300025933 Bacteria 2301
233 Ga0207706_10504587 3300025933 Bacteria 1044
234 Ga0207709_10048060 3300025935 Bacteria 2598
235 Ga0207709_11206876 3300025935 Bacteria 623
236 Ga0207709_11409646 3300025935 Bacteria 577
237 Ga0207670_10355276 3300025936 Bacteria 1161
238 Ga0207669_10195511 3300025937 Bacteria 1463
239 Ga0207665_10041535 3300025939 Bacteria 3072
240 Ga0207691_10080020 3300025940 Bacteria 2940
241 Ga0207691_10573623 3300025940 Bacteria 956
242 Ga0207691_10780630 3300025940 Bacteria 803
243 Ga0207711_10136789 3300025941 Bacteria 2201
244 Ga0207711_10289924 3300025941 Bacteria 1508
245 Ga0207661_10659873 3300025944 Bacteria 961
246 Ga0207679_10764354 3300025945 Bacteria 879
247 Ga0207667_10120365 3300025949 Bacteria 2705
248 Ga0207712_10804055 3300025961 Bacteria 827
249 Ga0207668_10129544 3300025972 Bacteria 1924
250 Ga0207668_10253038 3300025972 Bacteria 1432
251 Ga0207668_10330719 3300025972 Bacteria 1268
252 Ga0207668_11626059 3300025972 Bacteria 583
253 Ga0207640_10024770 3300025981 Bacteria 3625
254 Ga0207640_10265321 3300025981 Bacteria 1340
255 Ga0207640_10294831 3300025981 Bacteria 1280
256 Ga0207703_10151346 3300026035 Bacteria 2024
257 Ga0207639_10293963 3300026041 Bacteria 1433
258 Ga0207639_11366888 3300026041 Bacteria 665
259 Ga0207678_10066235 3300026067 Bacteria 3102
260 Ga0207678_10092129 3300026067 Bacteria 2590
261 Ga0207678_10147831 3300026067 Bacteria 2006
262 Ga0207678_10766338 3300026067 Bacteria 851
263 Ga0207641_11286072 3300026088 Bacteria 732
264 Ga0207648_11016817 3300026089 Bacteria 776
265 Ga0207676_10391316 3300026095 Bacteria 1297
266 Ga0207674_10075312 3300026116 Bacteria 3385
267 Ga0207674_10155357 3300026116 Bacteria 2243
268 Ga0207675_100555059 3300026118 Bacteria 1148
269 Ga0207675_100989443 3300026118 Bacteria 859
270 Ga0207683_10307996 3300026121 Bacteria 1449
271 Ga0207683_10786849 3300026121 Bacteria 883
272 Ga0207683_10802805 3300026121 Bacteria 873
273 Ga0207698_10226336 3300026142 Bacteria 1694
274 Ga0207698_10541709 3300026142 Bacteria 1139
275 Ga0207698_11186375 3300026142 Bacteria 777
276 Ga0209389_1000073 3300027296 Bacteria 94298
277 Ga0209389_1000160 3300027296 Bacteria 56126
278 Ga0209589_1000484 3300027357 Bacteria 56126
279 Ga0209489_100917 3300027361 Bacteria 58978
280 Ga0209489_100982 3300027361 Bacteria 57399
281 Ga0209700_100067 3300027363 Bacteria 144074
282 Ga0209179_1025995 3300027512 Bacteria 1172
283 Ga0209813_10161992 3300027866 Bacteria 808
284 Ga0209813_10225101 3300027866 Bacteria 704
285 Ga0268266_10021997 3300028379 Bacteria 5435
286 Ga0268266_10082247 3300028379 Bacteria 2809
287 Ga0268266_10114683 3300028379 Bacteria 2391
288 Ga0268264_12637567 3300028381 Bacteria 507
289 Ga0265338_10024838 3300028800 Bacteria 6106
290 Ga0265330_10009652 3300031235 Bacteria 4576
291 Ga0265325_10010920 3300031241 Bacteria 5232
292 Ga0265340_10018433 3300031247 Bacteria 3600
293 Ga0265331_10081675 3300031250 Bacteria 1500
294 Ga0265327_10135276 3300031251 Bacteria 1156
295 Ga0265316_10151065 3300031344 Bacteria 1740
296 Ga0307408_100599776 3300031548 Bacteria 978
297 Ga0265313_10018461 3300031595 Bacteria 3913
298 Ga0307508_10000008 3300031616 Bacteria 265023
299 Ga0265314_10020265 3300031711 Bacteria 5135
300 Ga0265342_10011898 3300031712 Bacteria 5920
301 Ga0265342_10049095 3300031712 Bacteria 2527
302 Ga0307409_101579308 3300031995 Bacteria 684
303 Ga0307416_100520317 3300032002 Bacteria 1258
304 Ga0307411_10903524 3300032005 Bacteria 785
305 Ga0373934_0332307 3300035086 Bacteria 632
306 Ga0373923_0011100 3300035111 Bacteria 3296
307 Ga0373939_0168874 3300035114 Bacteria 808
308 Ga0373953_0021843 3300035117 Bacteria 2406
309 Ga0373954_0005019 3300035118 Bacteria 5712
310 Ga0373954_0064007 3300035118 Bacteria 1738
311 Ga0373954_0318239 3300035118 Bacteria 768
312 Ga0373956_0019909 3300035119 Bacteria 2850
313 Ga0373956_0095221 3300035119 Bacteria 1377
314 Ga0373956_0186124 3300035119 Bacteria 982
315 Ga0373957_0095771 3300035120 Bacteria 1184
316 Ga0373955_0051660 3300035172 Bacteria 2239
317 Ga0373955_0190686 3300035172 Bacteria 1218
318 Ga0373961_0059894 3300035241 Bacteria 1152
319 Ga0373962_0026296 3300035242 Bacteria 1568
320 Ga0373924_0103180 3300035410 Bacteria 1228
321 Ga0373931_0004059 3300035691 Bacteria 6635
322 Ga0373935_0160484 3300035692 Bacteria 1532
323 Ga0373935_0238931 3300035692 Bacteria 1268
324 Ga0373933_0014929 3300035724 Bacteria 4325
325 Ga0373933_0060893 3300035724 Bacteria 2276
326 Ga0373933_0071348 3300035724 Bacteria 2114
327 Ga0373937_0014381 3300036401 Bacteria 6987
328 Ga0373937_0016707 3300036401 Bacteria 6521
329 Ga0373937_0102273 3300036401 Bacteria 2660
330 Ga0373937_1084377 3300036401 Bacteria 749
331 Ga0373937_1979711 3300036401 Bacteria 529
332 Ga0395900_0317933 3300037418 Bacteria 1538
333 Ga0395898_1295562 3300037466 Bacteria 658
334 Ga0395901_0267384 3300038443 Bacteria 1779
335 Ga0436362_0505536 3300039453 Bacteria 1004
336 Ga0439453_0055680 3300041408 Bacteria 808
337 Ga0451843_0662871 3300041509 Bacteria 1808
338 Ga0439455_0082568 3300042012 Bacteria 875
339 Ga0439456_005631 3300042013 Bacteria 2545
340 Ga0466972_0143869 3300044658 Bacteria 1122
341 Ga0466972_0239876 3300044658 Bacteria 848
342 Ga0453683_0121072 3300044673 Bacteria 1647
343 Ga0466965_0029688 3300044683 Bacteria 2661
344 Ga0466965_0278880 3300044683 Bacteria 902
345 Ga0466963_0024458 3300044694 Bacteria 3846
346 Ga0466963_0187759 3300044694 Bacteria 1444
347 Ga0466963_0213303 3300044694 Bacteria 1351
348 Ga0466960_0788855 3300044901 Bacteria 574
349 Ga0451576_0010701 3300045051 Bacteria 10504
350 Ga0466967_0430878 3300045976 Bacteria 1286
351 Ga0495592_0039033 3300046454 Bacteria 3569
352 Ga0495592_0191798 3300046454 Bacteria 1384
353 Ga0495590_0109117 3300046457 Bacteria 987
354 Ga0495629_0042353 3300046459 Bacteria 3200
355 Ga0495629_0424726 3300046459 Bacteria 902
356 Ga0495651_0024676 3300046462 Bacteria 4677
357 Ga0495651_0120000 3300046462 Bacteria 1933
358 Ga0495651_0376206 3300046462 Bacteria 932
359 Ga0495653_0088251 3300046463 Bacteria 2275
360 Ga0495653_0107431 3300046463 Bacteria 2011
361 Ga0495662_0226533 3300046476 Bacteria 922
362 Ga0495664_0042411 3300046477 Bacteria 2695
363 Ga0495585_0156756 3300046492 Bacteria 1184
364 Ga0495594_0123990 3300046499 Bacteria 1461
365 Ga0495607_0238425 3300046501 Bacteria 881
366 Ga0495583_0099738 3300046506 Bacteria 1241
367 Ga0495610_0183335 3300046512 Bacteria 869
368 Ga0495616_0015442 3300046513 Bacteria 4248
369 Ga0495618_0118927 3300046514 Bacteria 1692
370 Ga0495618_0685713 3300046514 Bacteria 603
371 Ga0495628_0069415 3300046516 Bacteria 2748
372 Ga0495628_0108289 3300046516 Bacteria 2139
373 Ga0495630_0515959 3300046517 Bacteria 916
374 Ga0495644_0197177 3300046523 Bacteria 776
375 Ga0495652_0022074 3300046529 Bacteria 5652
376 Ga0495652_0673223 3300046529 Bacteria 699
377 Ga0495652_0786196 3300046529 Bacteria 634
378 Ga0495640_0042612 3300046533 Bacteria 3165
379 Ga0495640_0105062 3300046533 Bacteria 1850
380 Ga0495640_0170787 3300046533 Bacteria 1389
381 Ga0495587_0010933 3300046536 Bacteria 5758
382 Ga0495587_0165902 3300046536 Bacteria 1255
383 Ga0495597_0023924 3300046542 Bacteria 2823
384 Ga0495645_0106584 3300046543 Bacteria 1987
385 Ga0495667_0045953 3300046559 Bacteria 2888
386 Ga0495667_0116418 3300046559 Bacteria 1726
387 Ga0495667_0178462 3300046559 Bacteria 1364
388 Ga0495656_0707089 3300046615 Bacteria 542
389 Ga0495668_0028092 3300046616 Bacteria 3183
390 Ga0495634_0048984 3300046642 Bacteria 2842
391 Ga0495634_0187689 3300046642 Bacteria 1291
392 Ga0495625_0457460 3300046660 Bacteria 787
393 Ga0495635_0045516 3300046663 Bacteria 3028
394 Ga0495635_0631943 3300046663 Bacteria 697
395 Ga0495657_0372748 3300046675 Bacteria 842
396 Ga0495599_0026974 3300046678 Bacteria 3599
397 Ga0495623_0000341 3300046679 Bacteria 30684
398 Ga0495646_0285246 3300046680 Bacteria 876
399 Ga0495658_0068452 3300046683 Bacteria 2056
400 Ga0495669_0349370 3300046684 Bacteria 715
401 Ga0495613_0324368 3300046689 Bacteria 1062
402 Ga0495624_0434352 3300046690 Bacteria 787
403 Ga0495600_0004899 3300046809 Bacteria 8041
404 Ga0495600_0089630 3300046809 Bacteria 2006
405 Ga0495600_0178910 3300046809 Bacteria 1367
406 Ga0495581_0064444 3300047315 Bacteria 2117
407 Ga0495604_0107051 3300047317 Bacteria 2044
408 Ga0495604_0195533 3300047317 Bacteria 1406
409 Ga0495674_0194142 3300047319 Bacteria 1686
410 Ga0495680_0070998 3300047322 Bacteria 2652
411 Ga0495680_0234886 3300047322 Bacteria 1304
412 Ga0495680_0397848 3300047322 Bacteria 951
413 Ga0495680_0414872 3300047322 Bacteria 927
414 Ga0495683_0061528 3300047323 Bacteria 1859
415 Ga0495687_012034 3300047443 Bacteria 4602
416 Ga0495675_0165001 3300047444 Bacteria 1362
417 Ga0495677_0204527 3300047445 Bacteria 768
418 Ga0495684_0006898 3300047471 Bacteria 8816
419 Ga0495684_0198669 3300047471 Bacteria 1479
420 Ga0495593_0055198 3300047673 Bacteria 2091
421 Ga0495593_0236323 3300047673 Bacteria 916
422 Ga0495602_0050066 3300048088 Bacteria 3736
423 Ga0495602_0093108 3300048088 Bacteria 2494
424 Ga0495602_0685029 3300048088 Bacteria 697
425 Ga0496100_0073278 3300048903 Bacteria 2291
426 Ga0496100_0141071 3300048903 Bacteria 1708
427 Ga0496100_0170164 3300048903 Bacteria 1568
428 Ga0496100_0440341 3300048903 Bacteria 998
429 Ga0496100_0444289 3300048903 Bacteria 993
430 Ga0496100_0452993 3300048903 Bacteria 984
431 Ga0496101_0111646 3300048904 Bacteria 2058
432 Ga0496101_1148515 3300048904 Bacteria 609
433 Ga0496101_1301156 3300048904 Bacteria 568
434 Ga0496102_0052448 3300048905 Bacteria 3716
435 Ga0496102_0053235 3300048905 Bacteria 3689
436 Ga0496102_0188945 3300048905 Bacteria 1941
437 Ga0496102_0461272 3300048905 Bacteria 1191
438 Ga0496103_0010003 3300048906 Bacteria 5610
439 Ga0496103_0020039 3300048906 Bacteria 4016
440 Ga0496103_0414236 3300048906 Bacteria 865
441 Ga0496104_0006100 3300048907 Bacteria 10578
442 Ga0496104_0149697 3300048907 Bacteria 2241
443 Ga0496104_0250767 3300048907 Bacteria 1683
444 Ga0496104_0252097 3300048907 Bacteria 1678
445 Ga0496104_0990835 3300048907 Bacteria 744
446 Ga0496105_0018424 3300048908 Bacteria 5611
447 Ga0496105_0084393 3300048908 Bacteria 2624
448 Ga0496105_0291140 3300048908 Bacteria 1314
449 Ga0496106_0008322 3300048909 Bacteria 7676
450 Ga0496106_0078331 3300048909 Bacteria 2536
451 Ga0496106_0080504 3300048909 Bacteria 2501
452 Ga0496106_0736498 3300048909 Bacteria 784
453 Ga0496107_0011233 3300048910 Bacteria 6232
454 Ga0496107_0014344 3300048910 Bacteria 5548
455 Ga0496107_0699170 3300048910 Bacteria 746
456 Ga0496108_0000884 3300048911 Bacteria 23347
457 Ga0496108_0178539 3300048911 Bacteria 1838
458 Ga0496108_0589067 3300048911 Bacteria 969
459 Ga0496109_0000680 3300048912 Bacteria 28264
460 Ga0496109_0024895 3300048912 Bacteria 5328
461 Ga0496109_0086022 3300048912 Bacteria 2903
462 Ga0496109_0251551 3300048912 Bacteria 1664
463 Ga0496110_0011875 3300048913 Bacteria 7153
464 Ga0496110_0025539 3300048913 Bacteria 5049
465 Ga0496110_0802640 3300048913 Bacteria 845
466 Ga0496111_0015146 3300048914 Bacteria 5285
467 Ga0496111_0120136 3300048914 Bacteria 1941
468 Ga0496111_0136596 3300048914 Bacteria 1816
469 Ga0496112_0012627 3300048915 Bacteria 7765
470 Ga0496112_0169525 3300048915 Bacteria 2148
471 Ga0496112_0727352 3300048915 Bacteria 919
472 Ga0496112_0935360 3300048915 Bacteria 788
473 Ga0496112_1290578 3300048915 Bacteria 646
474 Ga0496113_0004759 3300048916 Bacteria 8382
475 Ga0496113_0010432 3300048916 Bacteria 6144
476 Ga0496113_0047490 3300048916 Bacteria 3190
477 Ga0496113_0635305 3300048916 Bacteria 854
478 Ga0496114_0031891 3300048917 Bacteria 4334
479 Ga0496114_0096668 3300048917 Bacteria 2515
480 Ga0496115_0022612 3300048918 Bacteria 4874
481 Ga0496115_0097185 3300048918 Bacteria 2412
482 Ga0496115_0152657 3300048918 Bacteria 1907
483 Ga0496115_0176283 3300048918 Bacteria 1768
484 Ga0496115_0248151 3300048918 Bacteria 1466
485 Ga0496115_0855456 3300048918 Bacteria 704
486 Ga0496116_0288610 3300048919 Bacteria 789
487 Ga0496118_0087768 3300048921 Bacteria 2155
488 Ga0496119_0085667 3300048922 Bacteria 1803
489 Ga0496119_0264831 3300048922 Bacteria 861
490 Ga0496120_0236471 3300048923 Bacteria 865
491 Ga0496121_0089542 3300048924 Bacteria 2409
492 Ga0496122_0030192 3300048925 Bacteria 4551
493 Ga0496123_0030511 3300048926 Bacteria 3945
494 Ga0496124_0054449 3300048927 Bacteria 3386
495 Ga0496124_0248331 3300048927 Bacteria 1318
496 Ga0496124_0311801 3300048927 Bacteria 1131
497 Ga0496125_0581198 3300048928 Bacteria 615
498 Ga0496126_0047239 3300048929 Bacteria 3942
499 Ga0496126_0323982 3300048929 Bacteria 1266
500 Ga0496126_1140048 3300048929 Bacteria 577
501 Ga0501034_0023099 3300049571 Bacteria 6337
502 Ga0501036_0039523 3300049572 Bacteria 3992
503 Ga0501036_0316531 3300049572 Bacteria 1304
504 Ga0501036_0463401 3300049572 Bacteria 1055
505 Ga0501036_0606801 3300049572 Bacteria 907
506 Ga0501038_0008832 3300049574 Bacteria 9243
507 Ga0501038_0036774 3300049574 Bacteria 4296
508 Ga0501038_0104900 3300049574 Bacteria 2348
509 Ga0501039_0954829 3300049575 Bacteria 667
510 Ga0501043_0045910 3300049579 Bacteria 3434
511 Ga0501046_0144378 3300049580 Bacteria 1798
512 Ga0501047_0054296 3300049581 Bacteria 3875
513 Ga0501047_0062754 3300049581 Bacteria 3584
514 Ga0501047_0333100 3300049581 Bacteria 1356
515 Ga0501048_0568307 3300049582 Bacteria 814
516 Ga0501048_1062450 3300049582 Bacteria 582
517 Ga0501069_0056137 3300049585 Bacteria 2193
518 Ga0501070_0024235 3300049586 Bacteria 5088
519 Ga0501070_0204870 3300049586 Bacteria 1620
520 Ga0501071_0024104 3300049587 Bacteria 4253
521 Ga0501072_0934317 3300049588 Bacteria 677
522 Ga0501074_0068432 3300049590 Bacteria 2552
523 Ga0501080_0103000 3300049742 Bacteria 2647
524 Ga0501080_0378141 3300049742 Bacteria 1276
525 Ga0501035_0010160 3300049822 Bacteria 8736
526 Ga0501035_0178906 3300049822 Bacteria 1828
527 Ga0501035_0243547 3300049822 Bacteria 1529
528 Ga0501044_0116009 3300049823 Bacteria 2683
529 Ga0501044_0116324 3300049823 Bacteria 2679
530 nmdc:mga03683_94282_c1 3300050489 Bacteria 1308
531 nmdc:mga03n38_124071_c1 3300050490 Bacteria 1273
532 nmdc:mga03n38_195692_c1 3300050490 Bacteria 1044
533 nmdc:mga0yw44_174299_c1 3300050492 Bacteria 1413
534 nmdc:mga0yw44_367669_c1 3300050492 Bacteria 970
535 nmdc:mga0yw44_62046_c1 3300050492 Bacteria 2295
536 nmdc:mga0yw44_7789_c1 3300050492 Bacteria 5296
537 nmdc:mga0yw44_984002_c1 3300050492 Bacteria 571
538 nmdc:mga0k408_107167_c1 3300050493 Bacteria 1651
539 nmdc:mga0k408_138269_c1 3300050493 Bacteria 1448
540 nmdc:mga0k408_212620_c1 3300050493 Bacteria 1155
541 nmdc:mga06z11_26111_c1 3300050494 Bacteria 2776
542 nmdc:mga06z11_30363_c1 3300050494 Bacteria 1563
543 nmdc:mga06z11_955657_c1 3300050494 Bacteria 522
544 nmdc:mga04h51_157738_c1 3300050495 Bacteria 871
545 nmdc:mga04h51_362125_c1 3300050495 Bacteria 601
546 nmdc:mga04h51_42895_c1 3300050495 Bacteria 1486
547 nmdc:mga07m45_32276_c1 3300050496 Bacteria 2904
548 nmdc:mga0n895_778385_c1 3300050512 Bacteria 948
549 nmdc:mga08x19_167424_c1 3300050514 Bacteria 1495
550 nmdc:mga0sz30_122956_c1 3300050516 Bacteria 1141
551 nmdc:mga0sz30_78966_c1 3300050516 Bacteria 1423
552 Ga0495601_0170045 3300053077 Bacteria 1425
553 Ga0495595_0008422 3300053084 Bacteria 4231
554 Ga0495595_0012617 3300053084 Bacteria 3555
555 Ga0495619_0009683 3300053085 Bacteria 6075
556 Ga0495619_0089093 3300053085 Bacteria 2087
557 Ga0495619_0135907 3300053085 Bacteria 1691
558 Ga0495619_0393371 3300053085 Bacteria 957
559 Ga0500578_0064541 3300053086 Bacteria 2335
560 Ga0500644_0000753 3300053088 Bacteria 11169
561 Ga0500646_0084450 3300053090 Bacteria 974
562 Ga0500651_0011520 3300053093 Bacteria 5336
563 Ga0500652_001919 3300053131 Bacteria 6255
564 Ga0500658_0011848 3300053134 Bacteria 3215
565 Ga0500577_0248427 3300053142 Bacteria 773
566 Ga0500616_0000002 3300053153 Bacteria 1611257
567 Ga0500616_0005915 3300053153 Bacteria 8176
568 Ga0500645_000252 3300053730 Bacteria 39375
569 Ga0500645_040976 3300053730 Bacteria 1368
570 8019660584 8019659431 Bacteria 8577854
571 Ga0070691_10103937
572 JGI24751J29686_10104580
573 JGI25153J46596_10000560
574 JGI25160J50197_1003827
575 Ga0055531_10003731
576 Ga0065165_1004598
577 Ga0065165_1060899
578 Ga0070658_10196990
579 Ga0070670_100202787
580 Ga0070670_100337358
581 Ga0070680_100024919
582 Ga0070680_100214640
583 Ga0070680_100412164
584 Ga0070682_100678550
585 Ga0070660_100228074
586 Ga0070660_100421867
587 Ga0070689_100311399
588 Ga0070668_100047473
589 Ga0070668_101536339
590 Ga0070669_101145280
591 Ga0070675_100172821
592 Ga0070675_101424738
593 Ga0070671_101593269
594 Ga0070674_100074026
595 Ga0070673_100100290
596 Ga0070673_101049537
597 Ga0070688_100041703
598 Ga0070659_100213216
599 Ga0070667_100279544
600 Ga0070709_10000261
601 Ga0070709_10347673
602 Ga0070714_100037946
603 Ga0070714_100153262
604 Ga0070714_100325728
605 Ga0070713_100040271
606 Ga0070710_10000210
607 Ga0070710_10046737
608 Ga0070711_100025996
609 Ga0070711_100216032
610 Ga0070663_100013561
611 Ga0070663_100109563
612 Ga0070663_100273483
613 Ga0070678_100076771
614 Ga0070678_100227867
615 Ga0070662_100268101
616 Ga0070662_100368843
617 Ga0070681_10048935
618 Ga0070681_10071418
619 Ga0070681_10115574
620 Ga0070681_10134729
621 Ga0070681_10368028
622 Ga0070679_100165885
623 Ga0070679_100387164
624 Ga0070679_100794068
625 Ga0070679_101485394
626 Ga0070697_101715629
627 Ga0068853_100526611
628 Ga0068853_101500504
629 Ga0070672_100054030
630 Ga0070686_100753878
631 Ga0070665_100053032
632 Ga0070665_100224569
633 Ga0070665_100244008
634 Ga0068855_100108082
635 Ga0068855_100734852
636 Ga0070664_101282821
637 Ga0068857_100088811
638 Ga0068857_101082360
639 Ga0068857_101556984
640 Ga0068854_100152560
641 Ga0068854_100270209
642 Ga0068852_100215450
643 Ga0068859_100100443
644 Ga0068859_100588792
645 Ga0068861_100652511
646 Ga0068863_100085365
647 Ga0068858_100843865
648 Ga0068860_101322273
649 Ga0070717_10087927
650 Ga0070717_10947980
651 Ga0070717_11318472
652 Ga0075365_10034633
653 Ga0075365_10047090
654 Ga0075365_10051895
655 Ga0075365_10142828
656 Ga0075368_10017272
657 Ga0075368_10035322
658 Ga0075368_10074422
659 Ga0075363_100017468
660 Ga0075363_100287963
661 Ga0075364_10148960
662 Ga0075364_10461733
663 Ga0070715_10419022
664 Ga0070715_10489777
665 Ga0070716_100030058
666 Ga0070712_100024163
667 Ga0070712_100096022
668 Ga0070712_100277452
669 Ga0070712_100403527
670 Ga0075362_10058713
671 Ga0075362_10529034
672 Ga0075367_10089319
673 Ga0075367_10116979
674 Ga0075367_10298117
675 Ga0075367_10447294
676 Ga0075366_10104244
677 Ga0075366_10137737
678 Ga0075366_10475472
679 Ga0097621_100728402
680 Ga0075370_10054875
681 Ga0068871_101026812
682 Ga0097620_100100448
683 Ga0097620_100588787
684 Ga0099825_1037919
685 Ga0099824_1036906
686 Ga0099823_1015403
687 Ga0075435_101297309
688 Ga0099795_10168293
689 Ga0105240_10023872
690 Ga0105240_10111074
691 Ga0105245_10282164
692 Ga0105247_10075595
693 Ga0105243_10020564
694 Ga0105243_10740964
695 Ga0105241_10059790
696 Ga0105241_11513428
697 Ga0105242_10063591
698 Ga0105248_10038686
699 Ga0105237_10381640
700 Ga0105237_10867833
701 Ga0105238_10000577
702 Ga0105238_10033988
703 Ga0105238_11772453
704 Ga0105249_12170438
705 Ga0105249_12456027
706 Ga0105239_10002730
707 Ga0105239_10006321
708 Ga0105239_10052776
709 Ga0105239_10430323
710 Ga0105246_10044664
711 Ga0157371_10064895
712 Ga0157370_10131437
713 Ga0157370_10373388
714 Ga0157370_10468207
715 Ga0157369_10008567
716 Ga0157369_10596161
717 Ga0157374_10095353
718 Ga0157374_10513393
719 Ga0157374_10751862
720 Ga0163162_10155605
721 Ga0163163_10313012
722 Ga0163163_10650854
723 Ga0163163_10803370
724 Ga0157380_10046758
725 Ga0157380_10564542
726 Ga0157377_10404261
727 Ga0157377_10914538
728 Ga0157379_10606306
729 Ga0157379_10759465
730 Ga0157376_10298847
731 Ga0182005_1212271
732 Ga0206353_10149552
733 Ga0214542_1000058
734 Ga0214542_1025427
735 Ga0214545_1000026
736 Ga0214545_1016362
737 Ga0214543_1002325
738 Ga0214543_1031379
739 Ga0228598_1001342
740 Ga0207425_1042066
741 Ga0209129_1051943
742 Ga0209564_1004700
743 Ga0209564_1005701
744 Ga0209758_1000011
745 Ga0209758_1000940
746 Ga0209758_1001336
747 Ga0209256_1025400
748 Ga0207426_1004163
749 Ga0209257_1000158
750 Ga0209257_1014253
751 Ga0209257_1025655
752 Ga0209257_1093316
753 Ga0207710_10112344
754 Ga0207688_10108686
755 Ga0207680_10406771
756 Ga0207680_10422890
757 Ga0207647_10002857
758 Ga0207647_10325881
759 Ga0207699_10001210
760 Ga0207705_10200663
761 Ga0207705_10788485
762 Ga0207707_10034632
763 Ga0207707_10079987
764 Ga0207707_10119943
765 Ga0207707_10222453
766 Ga0207707_10573617
767 Ga0207707_10726693
768 Ga0207695_10022692
769 Ga0207695_10091336
770 Ga0207695_10323027
771 Ga0207671_10049790
772 Ga0207671_10941489
773 Ga0207693_10069824
774 Ga0207693_10312774
775 Ga0207663_10257083
776 Ga0207660_10014919
777 Ga0207660_10054432
778 Ga0207660_10118064
779 Ga0207660_10293694
780 Ga0207662_10743115
781 Ga0207657_10711598
782 Ga0207657_10943293
783 Ga0207649_10622862
784 Ga0207652_10178507
785 Ga0207652_10587906
786 Ga0207652_11356633
787 Ga0207681_10564332
788 Ga0207694_10000273
789 Ga0207694_10725040
790 Ga0207650_10366702
791 Ga0207659_10324274
792 Ga0207687_10516293
793 Ga0207700_10045098
794 Ga0207700_10074350
795 Ga0207664_10014428
796 Ga0207664_10031561
797 Ga0207664_10289400
798 Ga0207664_10324633
799 Ga0207644_10287027
800 Ga0207690_10415108
801 Ga0207690_10792413
802 Ga0207706_10121113
803 Ga0207706_10504587
804 Ga0207709_10048060
805 Ga0207709_11206876
806 Ga0207709_11409646
807 Ga0207670_10355276
808 Ga0207669_10195511
809 Ga0207665_10041535
810 Ga0207691_10080020
811 Ga0207691_10573623
812 Ga0207691_10780630
813 Ga0207711_10136789
814 Ga0207711_10289924
815 Ga0207661_10659873
816 Ga0207679_10764354
817 Ga0207667_10120365
818 Ga0207712_10804055
819 Ga0207668_10129544
820 Ga0207668_10253038
821 Ga0207668_10330719
822 Ga0207668_11626059
823 Ga0207640_10024770
824 Ga0207640_10265321
825 Ga0207640_10294831
826 Ga0207703_10151346
827 Ga0207639_10293963
828 Ga0207639_11366888
829 Ga0207678_10066235
830 Ga0207678_10092129
831 Ga0207678_10147831
832 Ga0207678_10766338
833 Ga0207641_11286072
834 Ga0207648_11016817
835 Ga0207676_10391316
836 Ga0207674_10075312
837 Ga0207674_10155357
838 Ga0207675_100555059
839 Ga0207675_100989443
840 Ga0207683_10307996
841 Ga0207683_10786849
842 Ga0207683_10802805
843 Ga0207698_10226336
844 Ga0207698_10541709
845 Ga0207698_11186375
846 Ga0209389_1000073
847 Ga0209389_1000160
848 Ga0209589_1000484
849 Ga0209489_100917
850 Ga0209489_100982
851 Ga0209700_100067
852 Ga0209179_1025995
853 Ga0209813_10161992
854 Ga0209813_10225101
855 Ga0268266_10021997
856 Ga0268266_10082247
857 Ga0268266_10114683
858 Ga0268264_12637567
859 Ga0265338_10024838
860 Ga0265330_10009652
861 Ga0265325_10010920
862 Ga0265340_10018433
863 Ga0265331_10081675
864 Ga0265327_10135276
865 Ga0265316_10151065
866 Ga0307408_100599776
867 Ga0265313_10018461
868 Ga0307508_10000008
869 Ga0265314_10020265
870 Ga0265342_10011898
871 Ga0265342_10049095
872 Ga0307409_101579308
873 Ga0307416_100520317
874 Ga0307411_10903524
875 Ga0373934_0332307
876 Ga0373923_0011100
877 Ga0373939_0168874
878 Ga0373953_0021843
879 Ga0373954_0005019
880 Ga0373954_0064007
881 Ga0373954_0318239
882 Ga0373956_0019909
883 Ga0373956_0095221
884 Ga0373956_0186124
885 Ga0373957_0095771
886 Ga0373955_0051660
887 Ga0373955_0190686
888 Ga0373961_0059894
889 Ga0373962_0026296
890 Ga0373924_0103180
891 Ga0373931_0004059
892 Ga0373935_0160484
893 Ga0373935_0238931
894 Ga0373933_0014929
895 Ga0373933_0060893
896 Ga0373933_0071348
897 Ga0373937_0014381
898 Ga0373937_0016707
899 Ga0373937_0102273
900 Ga0373937_1084377
901 Ga0373937_1979711
902 Ga0395900_0317933
903 Ga0395898_1295562
904 Ga0395901_0267384
905 Ga0436362_0505536
906 Ga0439453_0055680
907 Ga0451843_0662871
908 Ga0439455_0082568
909 Ga0439456_005631
910 Ga0466972_0143869
911 Ga0466972_0239876
912 Ga0453683_0121072
913 Ga0466965_0029688
914 Ga0466965_0278880
915 Ga0466963_0024458
916 Ga0466963_0187759
917 Ga0466963_0213303
918 Ga0466960_0788855
919 Ga0451576_0010701
920 Ga0466967_0430878
921 Ga0495592_0039033
922 Ga0495592_0191798
923 Ga0495590_0109117
924 Ga0495629_0042353
925 Ga0495629_0424726
926 Ga0495651_0024676
927 Ga0495651_0120000
928 Ga0495651_0376206
929 Ga0495653_0088251
930 Ga0495653_0107431
931 Ga0495662_0226533
932 Ga0495664_0042411
933 Ga0495585_0156756
934 Ga0495594_0123990
935 Ga0495607_0238425
936 Ga0495583_0099738
937 Ga0495610_0183335
938 Ga0495616_0015442
939 Ga0495618_0118927
940 Ga0495618_0685713
941 Ga0495628_0069415
942 Ga0495628_0108289
943 Ga0495630_0515959
944 Ga0495644_0197177
945 Ga0495652_0022074
946 Ga0495652_0673223
947 Ga0495652_0786196
948 Ga0495640_0042612
949 Ga0495640_0105062
950 Ga0495640_0170787
951 Ga0495587_0010933
952 Ga0495587_0165902
953 Ga0495597_0023924
954 Ga0495645_0106584
955 Ga0495667_0045953
956 Ga0495667_0116418
957 Ga0495667_0178462
958 Ga0495656_0707089
959 Ga0495668_0028092
960 Ga0495634_0048984
961 Ga0495634_0187689
962 Ga0495625_0457460
963 Ga0495635_0045516
964 Ga0495635_0631943
965 Ga0495657_0372748
966 Ga0495599_0026974
967 Ga0495623_0000341
968 Ga0495646_0285246
969 Ga0495658_0068452
970 Ga0495669_0349370
971 Ga0495613_0324368
972 Ga0495624_0434352
973 Ga0495600_0004899
974 Ga0495600_0089630
975 Ga0495600_0178910
976 Ga0495581_0064444
977 Ga0495604_0107051
978 Ga0495604_0195533
979 Ga0495674_0194142
980 Ga0495680_0070998
981 Ga0495680_0234886
982 Ga0495680_0397848
983 Ga0495680_0414872
984 Ga0495683_0061528
985 Ga0495687_012034
986 Ga0495675_0165001
987 Ga0495677_0204527
988 Ga0495684_0006898
989 Ga0495684_0198669
990 Ga0495593_0055198
991 Ga0495593_0236323
992 Ga0495602_0050066
993 Ga0495602_0093108
994 Ga0495602_0685029
995 Ga0496100_0073278
996 Ga0496100_0141071
997 Ga0496100_0170164
998 Ga0496100_0440341
999 Ga0496100_0444289
1000 Ga0496100_0452993
1001 Ga0496101_0111646
1002 Ga0496101_1148515
1003 Ga0496101_1301156
1004 Ga0496102_0052448
1005 Ga0496102_0053235
1006 Ga0496102_0188945
1007 Ga0496102_0461272
1008 Ga0496103_0010003
1009 Ga0496103_0020039
1010 Ga0496103_0414236
1011 Ga0496104_0006100
1012 Ga0496104_0149697
1013 Ga0496104_0250767
1014 Ga0496104_0252097
1015 Ga0496104_0990835
1016 Ga0496105_0018424
1017 Ga0496105_0084393
1018 Ga0496105_0291140
1019 Ga0496106_0008322
1020 Ga0496106_0078331
1021 Ga0496106_0080504
1022 Ga0496106_0736498
1023 Ga0496107_0011233
1024 Ga0496107_0014344
1025 Ga0496107_0699170
1026 Ga0496108_0000884
1027 Ga0496108_0178539
1028 Ga0496108_0589067
1029 Ga0496109_0000680
1030 Ga0496109_0024895
1031 Ga0496109_0086022
1032 Ga0496109_0251551
1033 Ga0496110_0011875
1034 Ga0496110_0025539
1035 Ga0496110_0802640
1036 Ga0496111_0015146
1037 Ga0496111_0120136
1038 Ga0496111_0136596
1039 Ga0496112_0012627
1040 Ga0496112_0169525
1041 Ga0496112_0727352
1042 Ga0496112_0935360
1043 Ga0496112_1290578
1044 Ga0496113_0004759
1045 Ga0496113_0010432
1046 Ga0496113_0047490
1047 Ga0496113_0635305
1048 Ga0496114_0031891
1049 Ga0496114_0096668
1050 Ga0496115_0022612
1051 Ga0496115_0097185
1052 Ga0496115_0152657
1053 Ga0496115_0176283
1054 Ga0496115_0248151
1055 Ga0496115_0855456
1056 Ga0496116_0288610
1057 Ga0496118_0087768
1058 Ga0496119_0085667
1059 Ga0496119_0264831
1060 Ga0496120_0236471
1061 Ga0496121_0089542
1062 Ga0496122_0030192
1063 Ga0496123_0030511
1064 Ga0496124_0054449
1065 Ga0496124_0248331
1066 Ga0496124_0311801
1067 Ga0496125_0581198
1068 Ga0496126_0047239
1069 Ga0496126_0323982
1070 Ga0496126_1140048
1071 Ga0501034_0023099
1072 Ga0501036_0039523
1073 Ga0501036_0316531
1074 Ga0501036_0463401
1075 Ga0501036_0606801
1076 Ga0501038_0008832
1077 Ga0501038_0036774
1078 Ga0501038_0104900
1079 Ga0501039_0954829
1080 Ga0501043_0045910
1081 Ga0501046_0144378
1082 Ga0501047_0054296
1083 Ga0501047_0062754
1084 Ga0501047_0333100
1085 Ga0501048_0568307
1086 Ga0501048_1062450
1087 Ga0501069_0056137
1088 Ga0501070_0024235
1089 Ga0501070_0204870
1090 Ga0501071_0024104
1091 Ga0501072_0934317
1092 Ga0501074_0068432
1093 Ga0501080_0103000
1094 Ga0501080_0378141
1095 Ga0501035_0010160
1096 Ga0501035_0178906
1097 Ga0501035_0243547
1098 Ga0501044_0116009
1099 Ga0501044_0116324
1100 nmdc:mga03683_94282_c1
1101 nmdc:mga03n38_124071_c1
1102 nmdc:mga03n38_195692_c1
1103 nmdc:mga0yw44_174299_c1
1104 nmdc:mga0yw44_367669_c1
1105 nmdc:mga0yw44_62046_c1
1106 nmdc:mga0yw44_7789_c1
1107 nmdc:mga0yw44_984002_c1
1108 nmdc:mga0k408_107167_c1
1109 nmdc:mga0k408_138269_c1
1110 nmdc:mga0k408_212620_c1
1111 nmdc:mga06z11_26111_c1
1112 nmdc:mga06z11_30363_c1
1113 nmdc:mga06z11_955657_c1
1114 nmdc:mga04h51_157738_c1
1115 nmdc:mga04h51_362125_c1
1116 nmdc:mga04h51_42895_c1
1117 nmdc:mga07m45_32276_c1
1118 nmdc:mga0n895_778385_c1
1119 nmdc:mga08x19_167424_c1
1120 nmdc:mga0sz30_122956_c1
1121 nmdc:mga0sz30_78966_c1
1122 Ga0495601_0170045
1123 Ga0495595_0008422
1124 Ga0495595_0012617
1125 Ga0495619_0009683
1126 Ga0495619_0089093
1127 Ga0495619_0135907
1128 Ga0495619_0393371
1129 Ga0500578_0064541
1130 Ga0500644_0000753
1131 Ga0500646_0084450
1132 Ga0500651_0011520
1133 Ga0500652_001919
1134 Ga0500658_0011848
1135 Ga0500577_0248427
1136 Ga0500616_0000002
1137 Ga0500616_0005915
1138 Ga0500645_000252
1139 Ga0500645_040976
1140 8019660584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00254

FKBP_C

FKBP-type peptidyl-prolyl cis-trans isomerase

90

185

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m4w-assembly1.cif.gz_D crystal structure of mbp fused split fkbp-frb t2098l mutant in complex with rapamycin 0.988 79 153
6m4v-assembly2.cif.gz_D crystal structure of mbp fused split fkbp in complex with rapamycin 0.9846 79 153
2y78-assembly1.cif.gz_A-2 crystal structure of bpss1823, a mip-like chaperone from burkholderia pseudomallei 0.9791 38 150
4ggq-assembly4.cif.gz_D crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cj40 0.9765 37 150
4dz2-assembly1.cif.gz_A crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation r92g from burkholderia pseudomallei complexed with fk506 0.9755 37 150
ID Description Score Start End Superfamily
1n1aB00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9648 45 153 3.10.50.40
af_B0G119_2_111_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.961 44 153 3.10.50.40
6b4pB00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9587 45 153 3.10.50.40
5b8iC00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9531 44 153 3.10.50.40
1jvwA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9506 38 152 3.10.50.40
ID Description Score Start End GO Terms
AF-A0A4Q7G8R6-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9998 39 153 GO:0006457
GO:0140839
GO:0140840
AF-A0A7V7JLY4-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9978 36 153 GO:0003677
GO:0003755
GO:0006457
GO:0030527
AF-A0A3N5GY91-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9976 39 153 GO:0006457
GO:0140839
GO:0140840
AF-A0A321LIW6-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9951 38 153 GO:0016020
GO:0140839
GO:0140840
AF-A0A257PMH8-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9942 38 153 GO:0006457
GO:0140839
GO:0140840

Map