F464767

General Info

Members Datasets Scaffolds Average Seq Length
569 413 1136 318

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0000215|Ga0496122_0000215_127719_128780
Length 353
Sequence VEGGAQLTLSADNYRPERGGSGKPKEEEIMKFAKTLGLAFGLALAATTLHAQQITLRSADIHPDGYPTVEAVKYMGDLVKERTGGRIAIQVMNNSVLGGEKDTIEQTRFGVIDMNRVNAAPFNNLVPETVVLGLPFLFRSTDHMHKVVDGPIGDEILKAFEPHGLIGLAYYDSGARSFYTTKKPITKLADLKGVKIRVQQSDLWIAMMQAFGANPTPMPMGEVYSSLETGVVDGAENNWPSYESARHYEVAKNYTLTQHSMNPEILVMSKVSWDKLTPDDQKIIRQAAKDSVVKMRELWSAREKASEEKVRAAGVNVISVNKDEFSAAMKPVYDRFVTDAKMKDLLKQIQDVQ

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
150 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
245 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
263 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
266 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
267 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
268 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
269 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
270 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
271 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
272 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
273 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
281 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
282 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
283 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
284 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
285 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
287 2508501050 Microvirga lupini Lut6 Isolate Nodule
288 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
289 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
290 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
291 2547132374 Acidovorax radicis N35 Isolate Unclassified
292 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
293 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
294 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
295 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
296 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
297 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
298 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
299 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
300 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
301 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
302 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
303 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
304 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
305 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
306 2643221558 Rhizobium sp. Root149 Isolate Unclassified
307 2643221570 Acidovorax sp. Root568 Isolate Unclassified
308 2643221609 Acidovorax sp. Root217 Isolate Unclassified
309 2643221611 Acidovorax sp. Root219 Isolate Unclassified
310 2643221618 Ensifer sp. Root231 Isolate Unclassified
311 2643221626 Ensifer sp. Root31 Isolate Unclassified
312 2643221652 Acidovorax sp. Root402 Isolate Unclassified
313 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
314 2643221655 Ensifer sp. Root1252 Isolate Unclassified
315 2643221659 Ensifer sp. Root127 Isolate Unclassified
316 2643221672 Variovorax sp. Root434 Isolate Unclassified
317 2643221683 Variovorax sp. Root473 Isolate Unclassified
318 2643221693 Rhizobium sp. Root491 Isolate Unclassified
319 2643221698 Ensifer sp. Root142 Isolate Unclassified
320 2643221712 Ensifer sp. Root258 Isolate Unclassified
321 2643221717 Acidovorax sp. Root267 Isolate Unclassified
322 2738541277 Variovorax sp. GV051 Isolate Unclassified
323 2738541307 Variovorax sp. GV008 Isolate Unclassified
324 2738543012 Acidovorax sp. CF301 Isolate Unclassified
325 2738543013 Variovorax sp. BT01 Isolate Unclassified
326 2738543019 Variovorax sp. GV040 Isolate Unclassified
327 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
328 2773857925 Microvirga vignae BR3299 Isolate Unclassified
329 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
330 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
331 2816332133 Acidovorax radicis 2721A Isolate Unclassified
332 2818991436 Collimonas arenae 515 Isolate Unclassified
333 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
334 2818991446 Variovorax sp. 1180 Isolate Unclassified
335 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
336 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
337 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
338 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
339 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
340 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
341 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
342 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
343 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
344 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
345 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
346 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
347 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
348 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
349 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
350 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
351 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
352 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
353 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
354 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
355 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
356 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
357 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
358 2842733646 Variovorax sp. R-72446 Isolate Unclassified
359 2842747753 Variovorax sp. R-72060 Isolate Unclassified
360 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
361 2844163670 Ensifer sp. 1H6 Isolate Unclassified
362 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
363 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
364 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
365 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
366 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
367 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
368 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
369 2885198086 Variovorax sp. 679 Isolate Unclassified
370 2885211737 Variovorax sp. 553 Isolate Unclassified
371 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
372 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
373 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
374 2899924645 Variovorax sp. 369 Isolate Unclassified
375 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
376 2904456579 Variovorax sp. 2002 Isolate Unclassified
377 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
378 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
379 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
380 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
381 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
382 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
383 2928037797 Variovorax sp. 1126 Isolate Unclassified
384 2928044640 Variovorax sp. 1128 Isolate Unclassified
385 2928051484 Variovorax sp. 1133 Isolate Unclassified
386 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
387 2928070936 Variovorax gossypii 1167 Isolate Unclassified
388 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
389 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
390 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
391 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
392 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
393 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
394 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
395 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
396 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
397 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
398 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
399 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
400 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
401 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
402 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
403 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
404 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
405 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
406 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
407 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
408 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
409 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
410 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
411 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
412 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
413 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 77.68
Metatranscriptomes 0
Isolates 22.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.7
Bulb 0
Endosphere 28.12
Nodule 5.1
Rhizoplane 4.04
Rhizosphere 43.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0000215 3300048925 Bacteria 128810
2 JGI24739J22299_10052550 3300001989 Bacteria 1310
3 JGI25162J39368_1000061 3300002737 Bacteria 136847
4 JGI25152J39213_1009790 3300002773 Bacteria 2246
5 JGI25159J45721_1010657 3300002987 Bacteria 2321
6 JGI25151J46595_10000056 3300003187 Bacteria 151555
7 JGI25151J46595_10000549 3300003187 Bacteria 34311
8 JGI25151J46595_10002420 3300003187 Bacteria 11250
9 JGI25406J46586_10000219 3300003203 Bacteria 25317
10 JGI25165J46597_1000117 3300003214 Bacteria 137891
11 JGI25153J46596_10011428 3300003215 Bacteria 3925
12 JGI25153J46596_10047422 3300003215 Bacteria 1264
13 rootH1_10013620 3300003316 Bacteria 2677
14 JGI25160J50197_1016382 3300003354 Bacteria 2390
15 Ga0055538_1000046 3300003751 Bacteria 137891
16 Ga0055539_1000065 3300003752 Bacteria 136847
17 Ga0055533_1000075 3300003756 Bacteria 137891
18 Ga0055525_1000095 3300003759 Bacteria 137891
19 Ga0055535_1000084 3300003761 Bacteria 104652
20 Ga0055542_1000033 3300003762 Bacteria 233997
21 Ga0055524_1000202 3300003775 Bacteria 64794
22 Ga0055536_1004023 3300003781 Bacteria 7669
23 Ga0055536_1004772 3300003781 Bacteria 6801
24 Ga0055536_1023941 3300003781 Bacteria 1782
25 Ga0055534_1007751 3300003784 Bacteria 2514
26 Ga0055530_10003203 3300003791 Bacteria 9593
27 Ga0055540_1002570 3300003792 Bacteria 9465
28 Ga0055531_10002976 3300003794 Bacteria 11011
29 Ga0055541_1000047 3300003841 Bacteria 136847
30 Ga0058692_1001187 3300003856 Bacteria 9990
31 Ga0065165_1007646 3300005262 Bacteria 5254
32 Ga0065714_10020118 3300005288 Bacteria 1574
33 Ga0065714_10085205 3300005288 Bacteria 2149
34 Ga0065704_10097093 3300005289 Bacteria 2391
35 Ga0070677_10116141 3300005333 Bacteria 1202
36 Ga0070689_100146383 3300005340 Bacteria 1903
37 Ga0070669_100014537 3300005353 Bacteria 5599
38 Ga0070669_100104130 3300005353 Bacteria 2145
39 Ga0070675_100188751 3300005354 Bacteria 1785
40 Ga0070671_100066892 3300005355 Bacteria 2995
41 Ga0070673_100230995 3300005364 Bacteria 1605
42 Ga0070667_100061492 3300005367 Bacteria 3180
43 Ga0070667_100135311 3300005367 Bacteria 2154
44 Ga0070667_100234088 3300005367 Bacteria 1638
45 Ga0070709_10136205 3300005434 Bacteria 1682
46 Ga0070663_100392081 3300005455 Bacteria 1133
47 Ga0070678_100019941 3300005456 Bacteria 4387
48 Ga0070662_100110836 3300005457 Bacteria 2090
49 Ga0070662_100234784 3300005457 Bacteria 1468
50 Ga0070706_100091100 3300005467 Bacteria 2828
51 Ga0070672_100051192 3300005543 Bacteria 3219
52 Ga0070672_100070229 3300005543 Bacteria 2783
53 Ga0070693_100146272 3300005547 Bacteria 1493
54 Ga0070665_100096760 3300005548 Bacteria 2957
55 Ga0070664_100407839 3300005564 Bacteria 1243
56 Ga0068854_100095840 3300005578 Bacteria 2216
57 Ga0068856_100208414 3300005614 Bacteria 1969
58 Ga0068852_100293036 3300005616 Bacteria 1573
59 Ga0068859_100233809 3300005617 Bacteria 1926
60 Ga0068870_10016501 3300005840 Bacteria 3530
61 Ga0068863_100184293 3300005841 Bacteria 2004
62 Ga0068863_100361062 3300005841 Bacteria 1416
63 Ga0068858_100035096 3300005842 Bacteria 4651
64 Ga0081539_10000207 3300005985 Bacteria 136970
65 Ga0075365_10011394 3300006038 Bacteria 5227
66 Ga0075365_10162535 3300006038 Bacteria 1556
67 Ga0075365_10237956 3300006038 Bacteria 1279
68 Ga0075368_10009553 3300006042 Bacteria 3487
69 Ga0075363_100078075 3300006048 Bacteria 1807
70 Ga0075364_10006182 3300006051 Bacteria 7016
71 Ga0075364_10019864 3300006051 Bacteria 4223
72 Ga0075364_10069035 3300006051 Bacteria 2325
73 Ga0075362_10002916 3300006177 Bacteria 5862
74 Ga0075362_10012147 3300006177 Bacteria 3413
75 Ga0075367_10034692 3300006178 Bacteria 2916
76 Ga0075367_10098708 3300006178 Bacteria 1783
77 Ga0075369_10028655 3300006186 Bacteria 2335
78 Ga0075366_10001569 3300006195 Bacteria 11425
79 Ga0075366_10021735 3300006195 Bacteria 3730
80 Ga0075366_10022494 3300006195 Bacteria 3668
81 Ga0075370_10025870 3300006353 Bacteria 3248
82 Ga0075370_10030136 3300006353 Bacteria 3026
83 Ga0075370_10052481 3300006353 Bacteria 2313
84 Ga0075370_10063398 3300006353 Bacteria 2107
85 Ga0075430_100050751 3300006846 Bacteria 3497
86 Ga0097620_100233808 3300006931 Bacteria 1926
87 Ga0079104_1000045 3300006946 Bacteria 183705
88 Ga0099826_10000040 3300006948 Bacteria 98176
89 Ga0105244_10019353 3300009036 Bacteria 3803
90 Ga0105240_10087309 3300009093 Bacteria 3820
91 Ga0105240_10404689 3300009093 Bacteria 1536
92 Ga0105245_10077730 3300009098 Bacteria 3026
93 Ga0105243_10003889 3300009148 Bacteria 11928
94 Ga0105243_10009899 3300009148 Bacteria 7249
95 Ga0105243_10044765 3300009148 Bacteria 3474
96 Ga0105248_10131373 3300009177 Bacteria 2825
97 Ga0105248_10243677 3300009177 Bacteria 2023
98 Ga0105237_10016580 3300009545 Bacteria 7654
99 Ga0105239_10013543 3300010375 Bacteria 9054
100 Ga0105239_10065310 3300010375 Bacteria 3996
101 Ga0105246_10069913 3300011119 Bacteria 2467
102 Ga0105246_10113079 3300011119 Bacteria 1998
103 Ga0105246_10137234 3300011119 Bacteria 1835
104 Ga0157373_10061125 3300013100 Bacteria 2668
105 Ga0157371_10000042 3300013102 Bacteria 198938
106 Ga0157371_10072261 3300013102 Bacteria 2443
107 Ga0157370_10000035 3300013104 Bacteria 137103
108 Ga0157370_10145886 3300013104 Bacteria 2204
109 Ga0157369_10032344 3300013105 Bacteria 5754
110 Ga0157369_10085528 3300013105 Bacteria 3370
111 Ga0171462_1007 3300013250 Bacteria 417698
112 Ga0157374_10156800 3300013296 Bacteria 2216
113 Ga0157378_10122276 3300013297 Bacteria 2401
114 Ga0163162_10096742 3300013306 Bacteria 3040
115 Ga0163162_10491413 3300013306 Bacteria 1358
116 Ga0163162_10685990 3300013306 Bacteria 1147
117 Ga0157372_10088223 3300013307 Bacteria 3521
118 Ga0163163_10047147 3300014325 Bacteria 4235
119 Ga0157380_10003985 3300014326 Bacteria 10193
120 Ga0157380_10047696 3300014326 Bacteria 3370
121 Ga0157380_10076095 3300014326 Bacteria 2730
122 Ga0182008_10002347 3300014497 Bacteria 11911
123 Ga0182008_10005141 3300014497 Bacteria 7507
124 Ga0182008_10026739 3300014497 Bacteria 2925
125 Ga0182006_1010908 3300015261 Bacteria 4020
126 Ga0182006_1011731 3300015261 Bacteria 3847
127 Ga0182007_10006147 3300015262 Bacteria 5185
128 Ga0182007_10006877 3300015262 Bacteria 4834
129 Ga0182005_1000242 3300015265 Bacteria 34928
130 Ga0182005_1013790 3300015265 Bacteria 2271
131 Ga0163161_10000556 3300017792 Bacteria 30048
132 Ga0209436_104691 3300025208 Bacteria 3320
133 Ga0209784_100010 3300025224 Bacteria 683664
134 Ga0209566_100008 3300025225 Bacteria 683664
135 Ga0209674_100019 3300025226 Bacteria 683664
136 Ga0209672_100281 3300025228 Bacteria 36341
137 Ga0209147_101221 3300025229 Bacteria 10249
138 Ga0209563_100021 3300025230 Bacteria 683764
139 Ga0207427_100688 3300025231 Bacteria 16016
140 Ga0209437_100019 3300025233 Bacteria 683764
141 Ga0209258_100089 3300025242 Bacteria 234040
142 Ga0207425_1000769 3300025245 Bacteria 16526
143 Ga0209677_100011 3300025253 Bacteria 683664
144 Ga0209148_1000097 3300025254 Bacteria 234049
145 Ga0209129_1000033 3300025258 Bacteria 336894
146 Ga0209129_1001362 3300025258 Bacteria 13765
147 Ga0209129_1004512 3300025258 Bacteria 5396
148 Ga0209233_1000025 3300025261 Bacteria 683764
149 Ga0209565_1001049 3300025263 Bacteria 13952
150 Ga0209673_1000185 3300025273 Bacteria 125742
151 Ga0209673_1001086 3300025273 Bacteria 30612
152 Ga0209673_1019875 3300025273 Bacteria 2398
153 Ga0209130_1000685 3300025284 Bacteria 30601
154 Ga0209130_1000780 3300025284 Bacteria 27490
155 Ga0209130_1000795 3300025284 Bacteria 26873
156 Ga0209675_1000296 3300025291 Bacteria 46253
157 Ga0209676_1000179 3300025292 Bacteria 150096
158 Ga0209676_1002190 3300025292 Bacteria 14628
159 Ga0209676_1041282 3300025292 Bacteria 1291
160 Ga0209025_1000016 3300025294 Bacteria 770739
161 Ga0209025_1000374 3300025294 Bacteria 93607
162 Ga0209025_1000714 3300025294 Bacteria 56537
163 Ga0209025_1000743 3300025294 Bacteria 54915
164 Ga0209025_1001287 3300025294 Bacteria 34364
165 Ga0209025_1007510 3300025294 Bacteria 8102
166 Ga0209564_1000035 3300025295 Bacteria 442446
167 Ga0209564_1000246 3300025295 Bacteria 117096
168 Ga0209564_1008340 3300025295 Bacteria 5128
169 Ga0209758_1000027 3300025297 Bacteria 549650
170 Ga0209758_1000237 3300025297 Bacteria 115867
171 Ga0209758_1004228 3300025297 Bacteria 12156
172 Ga0209050_1000172 3300025298 Bacteria 150096
173 Ga0209050_1004459 3300025298 Bacteria 9445
174 Ga0209256_1000025 3300025299 Bacteria 442449
175 Ga0209256_1000069 3300025299 Bacteria 245640
176 Ga0209256_1000161 3300025299 Bacteria 138270
177 Ga0207426_1000027 3300025302 Bacteria 513176
178 Ga0207426_1000066 3300025302 Bacteria 351182
179 Ga0207426_1000115 3300025302 Bacteria 227423
180 Ga0209051_1000046 3300025303 Bacteria 296424
181 Ga0209051_1000183 3300025303 Bacteria 113192
182 Ga0209051_1000240 3300025303 Bacteria 92221
183 Ga0209051_1000483 3300025303 Bacteria 51423
184 Ga0209051_1005574 3300025303 Bacteria 7315
185 Ga0209257_1000281 3300025304 Bacteria 114413
186 Ga0209257_1004578 3300025304 Bacteria 10575
187 Ga0209257_1009049 3300025304 Bacteria 5453
188 Ga0207656_10139909 3300025321 Bacteria 1140
189 Ga0207682_10023872 3300025893 Bacteria 2418
190 Ga0207688_10025095 3300025901 Bacteria 3271
191 Ga0207647_10017250 3300025904 Bacteria 4910
192 Ga0207645_10016574 3300025907 Bacteria 4875
193 Ga0207645_10134370 3300025907 Bacteria 1611
194 Ga0207654_10044153 3300025911 Bacteria 2530
195 Ga0207695_10266199 3300025913 Bacteria 1610
196 Ga0207671_10071779 3300025914 Bacteria 2583
197 Ga0207681_10020275 3300025923 Bacteria 4209
198 Ga0207694_10095939 3300025924 Bacteria 2345
199 Ga0207644_10047025 3300025931 Bacteria 3077
200 Ga0207644_10074397 3300025931 Bacteria 2493
201 Ga0207706_10086334 3300025933 Bacteria 2758
202 Ga0207706_10131949 3300025933 Bacteria 2197
203 Ga0207709_10000319 3300025935 Bacteria 52470
204 Ga0207704_10103064 3300025938 Bacteria 1908
205 Ga0207691_10027795 3300025940 Bacteria 5301
206 Ga0207691_10045199 3300025940 Bacteria 4049
207 Ga0207691_10080468 3300025940 Bacteria 2930
208 Ga0207691_10433117 3300025940 Bacteria 1120
209 Ga0207711_10047536 3300025941 Bacteria 3669
210 Ga0207689_10098640 3300025942 Bacteria 2400
211 Ga0207679_10223166 3300025945 Bacteria 1586
212 Ga0207667_10077210 3300025949 Bacteria 3455
213 Ga0207640_10133945 3300025981 Bacteria 1796
214 Ga0207640_10258572 3300025981 Bacteria 1355
215 Ga0207658_10080671 3300025986 Bacteria 2493
216 Ga0207639_10073878 3300026041 Bacteria 2675
217 Ga0207702_10125385 3300026078 Bacteria 2304
218 Ga0207641_10106081 3300026088 Bacteria 2483
219 Ga0207641_10271745 3300026088 Bacteria 1591
220 Ga0207648_10398172 3300026089 Bacteria 1247
221 Ga0207674_10041262 3300026116 Bacteria 4774
222 Ga0207674_10060342 3300026116 Bacteria 3836
223 Ga0207674_10078794 3300026116 Bacteria 3300
224 Ga0207683_10045689 3300026121 Bacteria 3830
225 Ga0207698_10121586 3300026142 Bacteria 2211
226 Ga0207698_10161521 3300026142 Bacteria 1960
227 Ga0209281_1000034 3300027111 Bacteria 382562
228 Ga0209371_1000003 3300027312 Bacteria 1122971
229 Ga0209371_1000976 3300027312 Bacteria 22110
230 Ga0209371_1017649 3300027312 Bacteria 1842
231 Ga0209179_1003388 3300027512 Bacteria 2290
232 Ga0209282_1000167 3300027666 Bacteria 37134
233 Ga0209588_1045099 3300027671 Bacteria 1426
234 Ga0209813_10004291 3300027866 Bacteria 3395
235 Ga0209813_10030737 3300027866 Bacteria 1580
236 Ga0268266_10076409 3300028379 Bacteria 2911
237 Ga0268265_10144807 3300028380 Bacteria 1995
238 Ga0268265_10340466 3300028380 Bacteria 1365
239 Ga0307515_10000017 3300028794 Bacteria 550465
240 Ga0307515_10239750 3300028794 Bacteria 1587
241 Ga0268256_1000004 3300030500 Bacteria 1122967
242 Ga0268256_1002843 3300030500 Bacteria 8345
243 Ga0268256_1016451 3300030500 Bacteria 2119
244 Ga0307511_10011176 3300030521 Bacteria 8858
245 Ga0307513_10012532 3300031456 Bacteria 10453
246 Ga0307513_10017435 3300031456 Bacteria 8611
247 Ga0307513_10169961 3300031456 Bacteria 2059
248 Ga0307405_10380040 3300031731 Bacteria 1099
249 Ga0307412_10070317 3300031911 Bacteria 2385
250 Ga0307409_100299331 3300031995 Bacteria 1496
251 Ga0307416_100033715 3300032002 Bacteria 3886
252 Ga0307416_100510262 3300032002 Bacteria 1268
253 Ga0307510_10003495 3300033180 Bacteria 18312
254 Ga0307510_10010802 3300033180 Bacteria 10856
255 Ga0373940_0045459 3300035088 Bacteria 1219
256 Ga0373936_0007382 3300035113 Bacteria 4137
257 Ga0373954_0003046 3300035118 Bacteria 7073
258 Ga0373946_0015091 3300035171 Bacteria 2923
259 Ga0373955_0007907 3300035172 Bacteria 4910
260 Ga0373942_0028398 3300035207 Bacteria 1462
261 Ga0373925_0019447 3300037068 Bacteria 4939
262 Ga0395898_0018189 3300037466 Bacteria 7171
263 Ga0395898_0116585 3300037466 Bacteria 2559
264 Ga0395905_0000132 3300037471 Bacteria 123636
265 Ga0395905_0017872 3300037471 Bacteria 6737
266 Ga0439431_0016393 3300041997 Bacteria 1734
267 Ga0450890_009041 3300042127 Bacteria 1274
268 Ga0466972_0002467 3300044658 Bacteria 9148
269 Ga0466965_0017530 3300044683 Bacteria 3424
270 Ga0466965_0025743 3300044683 Bacteria 2849
271 Ga0466965_0071458 3300044683 Bacteria 1746
272 Ga0466968_0001363 3300044735 Bacteria 8731
273 Ga0466968_0118229 3300044735 Bacteria 1197
274 Ga0495627_026660 3300046453 Bacteria 1861
275 Ga0495592_0009626 3300046454 Bacteria 7272
276 Ga0495638_0008916 3300046460 Bacteria 7072
277 Ga0495638_0036587 3300046460 Bacteria 3127
278 Ga0495651_0007305 3300046462 Bacteria 8446
279 Ga0495653_0004408 3300046463 Bacteria 11381
280 Ga0495653_0016904 3300046463 Bacteria 5934
281 Ga0495582_0013199 3300046473 Bacteria 4546
282 Ga0495639_0008292 3300046475 Bacteria 4459
283 Ga0495594_0013961 3300046499 Bacteria 4205
284 Ga0495594_0152188 3300046499 Bacteria 1314
285 Ga0495607_0014919 3300046501 Bacteria 5051
286 Ga0495608_0007913 3300046511 Bacteria 7469
287 Ga0495608_0022687 3300046511 Bacteria 4305
288 Ga0495610_0021182 3300046512 Bacteria 3581
289 Ga0495610_0025940 3300046512 Bacteria 3136
290 Ga0495610_0044351 3300046512 Bacteria 2207
291 Ga0495616_0128999 3300046513 Bacteria 1160
292 Ga0495618_0019739 3300046514 Bacteria 4148
293 Ga0495620_0034262 3300046515 Bacteria 2296
294 Ga0495628_0004819 3300046516 Bacteria 11867
295 Ga0495628_0028536 3300046516 Bacteria 4532
296 Ga0495637_0043494 3300046520 Bacteria 1916
297 Ga0495643_0013434 3300046522 Bacteria 4901
298 Ga0495663_0010724 3300046525 Bacteria 2550
299 Ga0495652_0007395 3300046529 Bacteria 10126
300 Ga0495654_0000655 3300046530 Bacteria 27305
301 Ga0495654_0006531 3300046530 Bacteria 6611
302 Ga0495654_0013016 3300046530 Bacteria 4458
303 Ga0495640_0024308 3300046533 Bacteria 4409
304 Ga0495586_0032364 3300046535 Bacteria 2803
305 Ga0495598_0055732 3300046537 Bacteria 1205
306 Ga0495621_0043183 3300046539 Bacteria 1590
307 Ga0495597_0022960 3300046542 Bacteria 2889
308 Ga0495645_0000419 3300046543 Bacteria 29318
309 Ga0495645_0028103 3300046543 Bacteria 4086
310 Ga0495622_0044836 3300046557 Bacteria 2055
311 Ga0495656_0000895 3300046615 Bacteria 9642
312 Ga0495634_0060778 3300046642 Bacteria 2513
313 Ga0495635_0079620 3300046663 Bacteria 2242
314 Ga0495635_0111142 3300046663 Bacteria 1872
315 Ga0495661_0052702 3300046665 Bacteria 2450
316 Ga0495588_0048985 3300046674 Bacteria 2171
317 Ga0495657_0130796 3300046675 Bacteria 1572
318 Ga0495599_0002127 3300046678 Bacteria 11512
319 Ga0495599_0005279 3300046678 Bacteria 7709
320 Ga0495658_0049358 3300046683 Bacteria 2377
321 Ga0495624_0025127 3300046690 Bacteria 3915
322 Ga0495671_0127481 3300046692 Bacteria 1241
323 Ga0495600_0003412 3300046809 Bacteria 9345
324 Ga0495600_0004887 3300046809 Bacteria 8050
325 Ga0495674_0112499 3300047319 Bacteria 2306
326 Ga0495680_0066621 3300047322 Bacteria 2755
327 Ga0495687_036609 3300047443 Bacteria 2194
328 Ga0495675_0012789 3300047444 Bacteria 5286
329 Ga0495677_0043055 3300047445 Bacteria 1655
330 Ga0495684_0017923 3300047471 Bacteria 5455
331 Ga0495593_0006733 3300047673 Bacteria 6726
332 Ga0495614_0047087 3300048089 Bacteria 1849
333 Ga0496102_0042459 3300048905 Bacteria 4120
334 Ga0496102_0205141 3300048905 Bacteria 1858
335 Ga0496103_0025680 3300048906 Bacteria 3562
336 Ga0496104_0266385 3300048907 Bacteria 1626
337 Ga0496106_0160566 3300048909 Bacteria 1777
338 Ga0496108_0150289 3300048911 Bacteria 2009
339 Ga0496109_0051712 3300048912 Bacteria 3742
340 Ga0496110_0071113 3300048913 Bacteria 3084
341 Ga0496110_0221515 3300048913 Bacteria 1720
342 Ga0496111_0000414 3300048914 Bacteria 21472
343 Ga0496112_0041994 3300048915 Bacteria 4474
344 Ga0496113_0012803 3300048916 Bacteria 5653
345 Ga0496113_0056395 3300048916 Bacteria 2949
346 Ga0496114_0038778 3300048917 Bacteria 3942
347 Ga0496116_0005240 3300048919 Bacteria 12117
348 Ga0496117_0000036 3300048920 Bacteria 325635
349 Ga0496117_0043503 3300048920 Bacteria 3264
350 Ga0496118_0009373 3300048921 Bacteria 9909
351 Ga0496118_0021537 3300048921 Bacteria 5669
352 Ga0496119_0003892 3300048922 Bacteria 15196
353 Ga0496119_0010135 3300048922 Bacteria 7960
354 Ga0496119_0032020 3300048922 Bacteria 3511
355 Ga0496120_0000036 3300048923 Bacteria 206505
356 Ga0496120_0022268 3300048923 Bacteria 3988
357 Ga0496121_0000005 3300048924 Bacteria 1034486
358 Ga0496121_0140726 3300048924 Bacteria 1791
359 Ga0496121_0308199 3300048924 Bacteria 1071
360 Ga0496122_0000002 3300048925 Bacteria 905834
361 Ga0496122_0000199 3300048925 Bacteria 133898
362 Ga0496122_0004236 3300048925 Bacteria 17989
363 Ga0496122_0021552 3300048925 Bacteria 5763
364 Ga0496123_0000002 3300048926 Bacteria 1811682
365 Ga0496123_0000102 3300048926 Bacteria 169327
366 Ga0496123_0000306 3300048926 Bacteria 95266
367 Ga0496123_0003286 3300048926 Bacteria 18319
368 Ga0496123_0008710 3300048926 Bacteria 9263
369 Ga0496124_0010515 3300048927 Bacteria 9361
370 Ga0496124_0034463 3300048927 Bacteria 4442
371 Ga0496124_0052048 3300048927 Bacteria 3481
372 Ga0496124_0106426 3300048927 Bacteria 2264
373 Ga0496124_0126295 3300048927 Bacteria 2037
374 Ga0496125_0000163 3300048928 Bacteria 148473
375 Ga0496125_0028615 3300048928 Bacteria 5028
376 Ga0496125_0066847 3300048928 Bacteria 2837
377 Ga0496125_0081016 3300048928 Bacteria 2482
378 Ga0496125_0144222 3300048928 Bacteria 1649
379 Ga0496126_0163702 3300048929 Bacteria 1899
380 Ga0501238_009141 3300049671 Bacteria 1311
381 Ga0501280_008257 3300049776 Bacteria 1452
382 nmdc:mga03683_2127_c2 3300050489 Bacteria 4384
383 nmdc:mga00v17_110273_c1 3300050491 Bacteria 1745
384 nmdc:mga00v17_114230_c1 3300050491 Bacteria 1715
385 nmdc:mga00v17_19_c1 3300050491 Bacteria 115002
386 nmdc:mga00v17_58374_c1 3300050491 Bacteria 2364
387 nmdc:mga00v17_8788_c1 3300050491 Bacteria 5442
388 nmdc:mga0yw44_42084_c1 3300050492 Bacteria 2723
389 nmdc:mga0yw44_524_c1 3300050492 Bacteria 13742
390 nmdc:mga0k408_233838_c1 3300050493 Bacteria 1097
391 nmdc:mga0k408_7058_c1 3300050493 Bacteria 5999
392 nmdc:mga0k408_8116_c1 3300050493 Bacteria 5627
393 nmdc:mga06z11_25829_c1 3300050494 Bacteria 2789
394 nmdc:mga06z11_62179_c1 3300050494 Bacteria 1950
395 nmdc:mga04h51_14089_c1 3300050495 Bacteria 2278
396 nmdc:mga04h51_7118_c1 3300050495 Bacteria 2938
397 nmdc:mga07m45_125556_c1 3300050496 Bacteria 1484
398 nmdc:mga07m45_61285_c1 3300050496 Bacteria 2131
399 nmdc:mga0qj67_112254_c1 3300050509 Bacteria 2200
400 nmdc:mga0a205_196659_c1 3300050515 Bacteria 1907
401 nmdc:mga0sz30_197_c1 3300050516 Bacteria 22540
402 nmdc:mga0sz30_20283_c1 3300050516 Bacteria 2680
403 nmdc:mga0sz30_37241_c1 3300050516 Bacteria 2036
404 Ga0495601_0005292 3300053077 Bacteria 7510
405 Ga0500610_0017161 3300053079 Bacteria 3470
406 Ga0500610_0018150 3300053079 Bacteria 3393
407 Ga0495595_0023007 3300053084 Bacteria 2740
408 Ga0500578_0070044 3300053086 Bacteria 2236
409 Ga0500643_000037 3300053087 Bacteria 180821
410 Ga0500644_0004400 3300053088 Bacteria 3524
411 Ga0500646_0002099 3300053090 Bacteria 5197
412 Ga0500583_0030174 3300053092 Bacteria 2372
413 Ga0500641_0017538 3300053096 Bacteria 2680
414 Ga0500556_0000102 3300053104 Bacteria 76549
415 Ga0500560_000019 3300053107 Bacteria 20063
416 Ga0500560_000279 3300053107 Bacteria 6438
417 Ga0500562_029295 3300053108 Bacteria 1448
418 Ga0500593_026070 3300053117 Bacteria 2603
419 Ga0500594_0002948 3300053118 Bacteria 3718
420 Ga0500595_000815 3300053119 Bacteria 18007
421 Ga0500608_104499 3300053122 Bacteria 1307
422 Ga0500618_000271 3300053125 Bacteria 39933
423 Ga0500618_011628 3300053125 Bacteria 2328
424 Ga0500652_105669 3300053131 Bacteria 1177
425 Ga0500658_0000204 3300053134 Bacteria 27941
426 Ga0500658_0000207 3300053134 Bacteria 27833
427 Ga0500559_0001509 3300053136 Bacteria 13100
428 Ga0500559_0012313 3300053136 Bacteria 3638
429 Ga0500561_0000107 3300053137 Bacteria 16095
430 Ga0500568_0004050 3300053139 Bacteria 7937
431 Ga0500568_0012196 3300053139 Bacteria 3960
432 Ga0500574_006273 3300053141 Bacteria 2380
433 Ga0500616_0000102 3300053153 Bacteria 168834
434 Ga0500616_0010794 3300053153 Bacteria 5445
435 Ga0500619_000250 3300053154 Bacteria 11571
436 Ga0500622_0000973 3300053156 Bacteria 24257
437 Ga0500634_0001772 3300053161 Bacteria 8672
438 Ga0500645_004918 3300053730 Bacteria 5024
439 Ga0500599_000310 3300053736 Bacteria 4744
440 Ga0500587_000981 3300053739 Bacteria 3843
441 Ga0466962_0026648 3300061719 Bacteria 2774
442 2508729159 2508501050 Bacteria 9633614
443 2509078034 2508501114 Bacteria 7082538
444 2511174879 2510917026 Bacteria 7046020
445 2537875922 2537561587 Bacteria 5425293
446 2548497739 2547132374 Bacteria 5530232
447 2554245822 2554235003 Bacteria 5877155
448 2559296411 2558860242 Bacteria 5568029
449 2585996349 2585427633 Bacteria 6413184
450 2586000957 2585427634 Bacteria 6455027
451 2599334006 2599185156 Bacteria 5403036
452 2599605541 2599185210 Bacteria 5624189
453 2599624260 2599185214 Bacteria 8209958
454 2599672272 2599185226 Bacteria 8233575
455 2599681644 2599185227 Bacteria 8246414
456 2599693658 2599185229 Bacteria 8216126
457 2599721864 2599185236 Bacteria 6875203
458 2600374308 2600254933 Bacteria 4750527
459 2601611743 2600255279 Bacteria 5605316
460 2601749526 2600255308 Bacteria 5611129
461 2643813880 2643221558 Bacteria 5460675
462 2643867203 2643221570 Bacteria 5103772
463 2644059348 2643221609 Bacteria 6756331
464 2644075613 2643221611 Bacteria 6820941
465 2644106383 2643221618 Bacteria 7717186
466 2644145983 2643221626 Bacteria 8069654
467 2644295609 2643221652 Bacteria 5140275
468 2644305754 2643221654 Bacteria 5273570
469 2644308460 2643221655 Bacteria 7722067
470 2644331825 2643221659 Bacteria 7890716
471 2644397708 2643221672 Bacteria 6322190
472 2644469024 2643221683 Bacteria 5749203
473 2644522786 2643221693 Bacteria 5513853
474 2644542205 2643221698 Bacteria 7756764
475 2644615653 2643221712 Bacteria 7729434
476 2644645147 2643221717 Bacteria 5676132
477 2738719793 2738541277 Bacteria 7458140
478 2738879788 2738541307 Bacteria 8606193
479 2739240846 2738543012 Bacteria 7115078
480 2739249886 2738543013 Bacteria 5618633
481 2739278992 2738543019 Bacteria 7459457
482 2757569337 2757320392 Bacteria 3737298
483 2774868967 2773857925 Bacteria 6472445
484 2776258883 2775506901 Bacteria 9631051
485 2808988631 2808606387 Bacteria 5697198
486 2816472080 2816332133 Bacteria 7249298
487 2819541881 2818991436 Bacteria 5376622
488 2819557799 2818991439 Bacteria 6907412
489 2819596620 2818991446 Bacteria 7757362
490 2819684978 2818991461 Bacteria 7026071
491 2821127441 2821123053 Bacteria 7836056
492 2821449255 2821443989 Bacteria 7658172
493 2831267910 2831265667 Bacteria 7184833
494 2835312814 2835312727 Bacteria 7413381
495 2838060148 2838054893 Bacteria 7451788
496 2838679804 2838675328 Bacteria 4909118
497 2838717426 2838714209 Bacteria 5525906
498 2838724373 2838719591 Bacteria 5523910
499 2838729310 2838724970 Bacteria 4908691
500 2838737966 2838736955 Bacteria 5760694
501 2841841665 2841840854 Bacteria 5761912
502 2841850737 2841846520 Bacteria 5345850
503 2842129542 2842124991 Bacteria 5346824
504 2842134687 2842130223 Bacteria 4909145
505 2842141443 2842140634 Bacteria 5759631
506 2842156795 2842152218 Bacteria 4908957
507 2842173053 2842170452 Bacteria 5525737
508 2842180413 2842175837 Bacteria 4908771
509 2842191928 2842187318 Bacteria 5524014
510 2842216244 2842211629 Bacteria 5523832
511 2842228964 2842224351 Bacteria 5524473
512 2842719229 2842718218 Bacteria 4560148
513 2842738984 2842733646 Bacteria 5716726
514 2842748651 2842747753 Bacteria 5578255
515 2842925715 2842922631 Bacteria 5824079
516 2844166774 2844163670 Bacteria 7266046
517 2844535347 2844533157 Bacteria 7517899
518 2854901138 2854896431 Bacteria 5869725
519 2854918529 2854916844 Bacteria 5725939
520 2857536545 2857531043 Bacteria 6754041
521 2857540219 2857537821 Bacteria 5248181
522 2857576208 2857576091 Bacteria 5465855
523 2882457465 2882456835 Bacteria 6863978
524 2885199344 2885198086 Bacteria 7212419
525 2885212995 2885211737 Bacteria 7212420
526 2894774705 2894772417 Bacteria 5305674
527 2899793662 2899792073 Bacteria 4926588
528 2899848758 2899845264 Bacteria 5672268
529 2899931338 2899924645 Bacteria 7487985
530 2904450202 2904449895 Bacteria 6927402
531 2904456975 2904456579 Bacteria 6819253
532 2904544070 2904541872 Bacteria 8915136
533 2919119179 2919114240 Bacteria 5700270
534 2919174563 2919171160 Bacteria 6499771
535 2919455971 2919450847 Bacteria 5631160
536 2926759211 2926754445 Bacteria 5964435
537 2926763359 2926760298 Bacteria 5505990
538 2928037889 2928037797 Bacteria 7273642
539 2928046505 2928044640 Bacteria 7271509
540 2928054200 2928051484 Bacteria 7773759
541 2928065954 2928064002 Bacteria 7419480
542 2928076867 2928070936 Bacteria 8062541
543 2928087878 2928084124 Bacteria 7159212
544 2928117882 2928115317 Bacteria 6477646
545 2929143237 2929138655 Bacteria 5810547
546 2929162371 2929160207 Bacteria 9075316
547 2929205482 2929199973 Bacteria 7260745
548 2932422963 2932422444 Bacteria 4678430
549 2933011400 2933006813 Bacteria 4912075
550 2933596029 2933594066 Bacteria 5594265
551 2941505201 2941499720 Bacteria 7599444
552 2945913299 2945909444 Bacteria 7065066
553 2945948864 2945945610 Bacteria 5951079
554 2945972982 2945972063 Bacteria 6086495
555 2945984477 2945984333 Bacteria 7358892
556 2974323624 2974320154 Bacteria 4571377
557 2979091608 2979089926 Bacteria 5670289
558 2979097129 2979095461 Bacteria 5669583
559 2979102839 2979100975 Bacteria 5423623
560 2984509272 2984509177 Bacteria 5274802
561 2984520028 2984518228 Bacteria 5277463
562 2984537601 2984537506 Bacteria 5277481
563 2984604350 2984601300 Bacteria 5455244
564 2989773024 2989771324 Bacteria 5605128
565 650842807 650716007 Bacteria 5573770
566 8001849247 8001845381 Bacteria 5804942
567 8018153479 8018150411 Bacteria 5549903
568 8055914479 8055909800 Bacteria 7278581
569 Ga0496122_0000215
570 JGI24739J22299_10052550
571 JGI25162J39368_1000061
572 JGI25152J39213_1009790
573 JGI25159J45721_1010657
574 JGI25151J46595_10000056
575 JGI25151J46595_10000549
576 JGI25151J46595_10002420
577 JGI25406J46586_10000219
578 JGI25165J46597_1000117
579 JGI25153J46596_10011428
580 JGI25153J46596_10047422
581 rootH1_10013620
582 JGI25160J50197_1016382
583 Ga0055538_1000046
584 Ga0055539_1000065
585 Ga0055533_1000075
586 Ga0055525_1000095
587 Ga0055535_1000084
588 Ga0055542_1000033
589 Ga0055524_1000202
590 Ga0055536_1004023
591 Ga0055536_1004772
592 Ga0055536_1023941
593 Ga0055534_1007751
594 Ga0055530_10003203
595 Ga0055540_1002570
596 Ga0055531_10002976
597 Ga0055541_1000047
598 Ga0058692_1001187
599 Ga0065165_1007646
600 Ga0065714_10020118
601 Ga0065714_10085205
602 Ga0065704_10097093
603 Ga0070677_10116141
604 Ga0070689_100146383
605 Ga0070669_100014537
606 Ga0070669_100104130
607 Ga0070675_100188751
608 Ga0070671_100066892
609 Ga0070673_100230995
610 Ga0070667_100061492
611 Ga0070667_100135311
612 Ga0070667_100234088
613 Ga0070709_10136205
614 Ga0070663_100392081
615 Ga0070678_100019941
616 Ga0070662_100110836
617 Ga0070662_100234784
618 Ga0070706_100091100
619 Ga0070672_100051192
620 Ga0070672_100070229
621 Ga0070693_100146272
622 Ga0070665_100096760
623 Ga0070664_100407839
624 Ga0068854_100095840
625 Ga0068856_100208414
626 Ga0068852_100293036
627 Ga0068859_100233809
628 Ga0068870_10016501
629 Ga0068863_100184293
630 Ga0068863_100361062
631 Ga0068858_100035096
632 Ga0081539_10000207
633 Ga0075365_10011394
634 Ga0075365_10162535
635 Ga0075365_10237956
636 Ga0075368_10009553
637 Ga0075363_100078075
638 Ga0075364_10006182
639 Ga0075364_10019864
640 Ga0075364_10069035
641 Ga0075362_10002916
642 Ga0075362_10012147
643 Ga0075367_10034692
644 Ga0075367_10098708
645 Ga0075369_10028655
646 Ga0075366_10001569
647 Ga0075366_10021735
648 Ga0075366_10022494
649 Ga0075370_10025870
650 Ga0075370_10030136
651 Ga0075370_10052481
652 Ga0075370_10063398
653 Ga0075430_100050751
654 Ga0097620_100233808
655 Ga0079104_1000045
656 Ga0099826_10000040
657 Ga0105244_10019353
658 Ga0105240_10087309
659 Ga0105240_10404689
660 Ga0105245_10077730
661 Ga0105243_10003889
662 Ga0105243_10009899
663 Ga0105243_10044765
664 Ga0105248_10131373
665 Ga0105248_10243677
666 Ga0105237_10016580
667 Ga0105239_10013543
668 Ga0105239_10065310
669 Ga0105246_10069913
670 Ga0105246_10113079
671 Ga0105246_10137234
672 Ga0157373_10061125
673 Ga0157371_10000042
674 Ga0157371_10072261
675 Ga0157370_10000035
676 Ga0157370_10145886
677 Ga0157369_10032344
678 Ga0157369_10085528
679 Ga0171462_1007
680 Ga0157374_10156800
681 Ga0157378_10122276
682 Ga0163162_10096742
683 Ga0163162_10491413
684 Ga0163162_10685990
685 Ga0157372_10088223
686 Ga0163163_10047147
687 Ga0157380_10003985
688 Ga0157380_10047696
689 Ga0157380_10076095
690 Ga0182008_10002347
691 Ga0182008_10005141
692 Ga0182008_10026739
693 Ga0182006_1010908
694 Ga0182006_1011731
695 Ga0182007_10006147
696 Ga0182007_10006877
697 Ga0182005_1000242
698 Ga0182005_1013790
699 Ga0163161_10000556
700 Ga0209436_104691
701 Ga0209784_100010
702 Ga0209566_100008
703 Ga0209674_100019
704 Ga0209672_100281
705 Ga0209147_101221
706 Ga0209563_100021
707 Ga0207427_100688
708 Ga0209437_100019
709 Ga0209258_100089
710 Ga0207425_1000769
711 Ga0209677_100011
712 Ga0209148_1000097
713 Ga0209129_1000033
714 Ga0209129_1001362
715 Ga0209129_1004512
716 Ga0209233_1000025
717 Ga0209565_1001049
718 Ga0209673_1000185
719 Ga0209673_1001086
720 Ga0209673_1019875
721 Ga0209130_1000685
722 Ga0209130_1000780
723 Ga0209130_1000795
724 Ga0209675_1000296
725 Ga0209676_1000179
726 Ga0209676_1002190
727 Ga0209676_1041282
728 Ga0209025_1000016
729 Ga0209025_1000374
730 Ga0209025_1000714
731 Ga0209025_1000743
732 Ga0209025_1001287
733 Ga0209025_1007510
734 Ga0209564_1000035
735 Ga0209564_1000246
736 Ga0209564_1008340
737 Ga0209758_1000027
738 Ga0209758_1000237
739 Ga0209758_1004228
740 Ga0209050_1000172
741 Ga0209050_1004459
742 Ga0209256_1000025
743 Ga0209256_1000069
744 Ga0209256_1000161
745 Ga0207426_1000027
746 Ga0207426_1000066
747 Ga0207426_1000115
748 Ga0209051_1000046
749 Ga0209051_1000183
750 Ga0209051_1000240
751 Ga0209051_1000483
752 Ga0209051_1005574
753 Ga0209257_1000281
754 Ga0209257_1004578
755 Ga0209257_1009049
756 Ga0207656_10139909
757 Ga0207682_10023872
758 Ga0207688_10025095
759 Ga0207647_10017250
760 Ga0207645_10016574
761 Ga0207645_10134370
762 Ga0207654_10044153
763 Ga0207695_10266199
764 Ga0207671_10071779
765 Ga0207681_10020275
766 Ga0207694_10095939
767 Ga0207644_10047025
768 Ga0207644_10074397
769 Ga0207706_10086334
770 Ga0207706_10131949
771 Ga0207709_10000319
772 Ga0207704_10103064
773 Ga0207691_10027795
774 Ga0207691_10045199
775 Ga0207691_10080468
776 Ga0207691_10433117
777 Ga0207711_10047536
778 Ga0207689_10098640
779 Ga0207679_10223166
780 Ga0207667_10077210
781 Ga0207640_10133945
782 Ga0207640_10258572
783 Ga0207658_10080671
784 Ga0207639_10073878
785 Ga0207702_10125385
786 Ga0207641_10106081
787 Ga0207641_10271745
788 Ga0207648_10398172
789 Ga0207674_10041262
790 Ga0207674_10060342
791 Ga0207674_10078794
792 Ga0207683_10045689
793 Ga0207698_10121586
794 Ga0207698_10161521
795 Ga0209281_1000034
796 Ga0209371_1000003
797 Ga0209371_1000976
798 Ga0209371_1017649
799 Ga0209179_1003388
800 Ga0209282_1000167
801 Ga0209588_1045099
802 Ga0209813_10004291
803 Ga0209813_10030737
804 Ga0268266_10076409
805 Ga0268265_10144807
806 Ga0268265_10340466
807 Ga0307515_10000017
808 Ga0307515_10239750
809 Ga0268256_1000004
810 Ga0268256_1002843
811 Ga0268256_1016451
812 Ga0307511_10011176
813 Ga0307513_10012532
814 Ga0307513_10017435
815 Ga0307513_10169961
816 Ga0307405_10380040
817 Ga0307412_10070317
818 Ga0307409_100299331
819 Ga0307416_100033715
820 Ga0307416_100510262
821 Ga0307510_10003495
822 Ga0307510_10010802
823 Ga0373940_0045459
824 Ga0373936_0007382
825 Ga0373954_0003046
826 Ga0373946_0015091
827 Ga0373955_0007907
828 Ga0373942_0028398
829 Ga0373925_0019447
830 Ga0395898_0018189
831 Ga0395898_0116585
832 Ga0395905_0000132
833 Ga0395905_0017872
834 Ga0439431_0016393
835 Ga0450890_009041
836 Ga0466972_0002467
837 Ga0466965_0017530
838 Ga0466965_0025743
839 Ga0466965_0071458
840 Ga0466968_0001363
841 Ga0466968_0118229
842 Ga0495627_026660
843 Ga0495592_0009626
844 Ga0495638_0008916
845 Ga0495638_0036587
846 Ga0495651_0007305
847 Ga0495653_0004408
848 Ga0495653_0016904
849 Ga0495582_0013199
850 Ga0495639_0008292
851 Ga0495594_0013961
852 Ga0495594_0152188
853 Ga0495607_0014919
854 Ga0495608_0007913
855 Ga0495608_0022687
856 Ga0495610_0021182
857 Ga0495610_0025940
858 Ga0495610_0044351
859 Ga0495616_0128999
860 Ga0495618_0019739
861 Ga0495620_0034262
862 Ga0495628_0004819
863 Ga0495628_0028536
864 Ga0495637_0043494
865 Ga0495643_0013434
866 Ga0495663_0010724
867 Ga0495652_0007395
868 Ga0495654_0000655
869 Ga0495654_0006531
870 Ga0495654_0013016
871 Ga0495640_0024308
872 Ga0495586_0032364
873 Ga0495598_0055732
874 Ga0495621_0043183
875 Ga0495597_0022960
876 Ga0495645_0000419
877 Ga0495645_0028103
878 Ga0495622_0044836
879 Ga0495656_0000895
880 Ga0495634_0060778
881 Ga0495635_0079620
882 Ga0495635_0111142
883 Ga0495661_0052702
884 Ga0495588_0048985
885 Ga0495657_0130796
886 Ga0495599_0002127
887 Ga0495599_0005279
888 Ga0495658_0049358
889 Ga0495624_0025127
890 Ga0495671_0127481
891 Ga0495600_0003412
892 Ga0495600_0004887
893 Ga0495674_0112499
894 Ga0495680_0066621
895 Ga0495687_036609
896 Ga0495675_0012789
897 Ga0495677_0043055
898 Ga0495684_0017923
899 Ga0495593_0006733
900 Ga0495614_0047087
901 Ga0496102_0042459
902 Ga0496102_0205141
903 Ga0496103_0025680
904 Ga0496104_0266385
905 Ga0496106_0160566
906 Ga0496108_0150289
907 Ga0496109_0051712
908 Ga0496110_0071113
909 Ga0496110_0221515
910 Ga0496111_0000414
911 Ga0496112_0041994
912 Ga0496113_0012803
913 Ga0496113_0056395
914 Ga0496114_0038778
915 Ga0496116_0005240
916 Ga0496117_0000036
917 Ga0496117_0043503
918 Ga0496118_0009373
919 Ga0496118_0021537
920 Ga0496119_0003892
921 Ga0496119_0010135
922 Ga0496119_0032020
923 Ga0496120_0000036
924 Ga0496120_0022268
925 Ga0496121_0000005
926 Ga0496121_0140726
927 Ga0496121_0308199
928 Ga0496122_0000002
929 Ga0496122_0000199
930 Ga0496122_0004236
931 Ga0496122_0021552
932 Ga0496123_0000002
933 Ga0496123_0000102
934 Ga0496123_0000306
935 Ga0496123_0003286
936 Ga0496123_0008710
937 Ga0496124_0010515
938 Ga0496124_0034463
939 Ga0496124_0052048
940 Ga0496124_0106426
941 Ga0496124_0126295
942 Ga0496125_0000163
943 Ga0496125_0028615
944 Ga0496125_0066847
945 Ga0496125_0081016
946 Ga0496125_0144222
947 Ga0496126_0163702
948 Ga0501238_009141
949 Ga0501280_008257
950 nmdc:mga03683_2127_c2
951 nmdc:mga00v17_110273_c1
952 nmdc:mga00v17_114230_c1
953 nmdc:mga00v17_19_c1
954 nmdc:mga00v17_58374_c1
955 nmdc:mga00v17_8788_c1
956 nmdc:mga0yw44_42084_c1
957 nmdc:mga0yw44_524_c1
958 nmdc:mga0k408_233838_c1
959 nmdc:mga0k408_7058_c1
960 nmdc:mga0k408_8116_c1
961 nmdc:mga06z11_25829_c1
962 nmdc:mga06z11_62179_c1
963 nmdc:mga04h51_14089_c1
964 nmdc:mga04h51_7118_c1
965 nmdc:mga07m45_125556_c1
966 nmdc:mga07m45_61285_c1
967 nmdc:mga0qj67_112254_c1
968 nmdc:mga0a205_196659_c1
969 nmdc:mga0sz30_197_c1
970 nmdc:mga0sz30_20283_c1
971 nmdc:mga0sz30_37241_c1
972 Ga0495601_0005292
973 Ga0500610_0017161
974 Ga0500610_0018150
975 Ga0495595_0023007
976 Ga0500578_0070044
977 Ga0500643_000037
978 Ga0500644_0004400
979 Ga0500646_0002099
980 Ga0500583_0030174
981 Ga0500641_0017538
982 Ga0500556_0000102
983 Ga0500560_000019
984 Ga0500560_000279
985 Ga0500562_029295
986 Ga0500593_026070
987 Ga0500594_0002948
988 Ga0500595_000815
989 Ga0500608_104499
990 Ga0500618_000271
991 Ga0500618_011628
992 Ga0500652_105669
993 Ga0500658_0000204
994 Ga0500658_0000207
995 Ga0500559_0001509
996 Ga0500559_0012313
997 Ga0500561_0000107
998 Ga0500568_0004050
999 Ga0500568_0012196
1000 Ga0500574_006273
1001 Ga0500616_0000102
1002 Ga0500616_0010794
1003 Ga0500619_000250
1004 Ga0500622_0000973
1005 Ga0500634_0001772
1006 Ga0500645_004918
1007 Ga0500599_000310
1008 Ga0500587_000981
1009 Ga0466962_0026648
1010 2508729159
1011 2509078034
1012 2511174879
1013 2537875922
1014 2548497739
1015 2554245822
1016 2559296411
1017 2585996349
1018 2586000957
1019 2599334006
1020 2599605541
1021 2599624260
1022 2599672272
1023 2599681644
1024 2599693658
1025 2599721864
1026 2600374308
1027 2601611743
1028 2601749526
1029 2643813880
1030 2643867203
1031 2644059348
1032 2644075613
1033 2644106383
1034 2644145983
1035 2644295609
1036 2644305754
1037 2644308460
1038 2644331825
1039 2644397708
1040 2644469024
1041 2644522786
1042 2644542205
1043 2644615653
1044 2644645147
1045 2738719793
1046 2738879788
1047 2739240846
1048 2739249886
1049 2739278992
1050 2757569337
1051 2774868967
1052 2776258883
1053 2808988631
1054 2816472080
1055 2819541881
1056 2819557799
1057 2819596620
1058 2819684978
1059 2821127441
1060 2821449255
1061 2831267910
1062 2835312814
1063 2838060148
1064 2838679804
1065 2838717426
1066 2838724373
1067 2838729310
1068 2838737966
1069 2841841665
1070 2841850737
1071 2842129542
1072 2842134687
1073 2842141443
1074 2842156795
1075 2842173053
1076 2842180413
1077 2842191928
1078 2842216244
1079 2842228964
1080 2842719229
1081 2842738984
1082 2842748651
1083 2842925715
1084 2844166774
1085 2844535347
1086 2854901138
1087 2854918529
1088 2857536545
1089 2857540219
1090 2857576208
1091 2882457465
1092 2885199344
1093 2885212995
1094 2894774705
1095 2899793662
1096 2899848758
1097 2899931338
1098 2904450202
1099 2904456975
1100 2904544070
1101 2919119179
1102 2919174563
1103 2919455971
1104 2926759211
1105 2926763359
1106 2928037889
1107 2928046505
1108 2928054200
1109 2928065954
1110 2928076867
1111 2928087878
1112 2928117882
1113 2929143237
1114 2929162371
1115 2929205482
1116 2932422963
1117 2933011400
1118 2933596029
1119 2941505201
1120 2945913299
1121 2945948864
1122 2945972982
1123 2945984477
1124 2974323624
1125 2979091608
1126 2979097129
1127 2979102839
1128 2984509272
1129 2984520028
1130 2984537601
1131 2984604350
1132 2989773024
1133 650842807
1134 8001849247
1135 8018153479
1136 8055914479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

58

339

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xfe-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d-glucuronate 0.8816 23 282
4xeq-assembly4.cif.gz_D crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid 0.8718 23 282
4pf8-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1 (target efi-510299) with bound beta-d-galacturonate 0.8665 24 288
4pf8-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1 (target efi-510299) with bound beta-d-galacturonate 0.8561 23 288
4nn3-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens (desal_2161), target efi-510109, with bound orotic acid 0.8521 24 286
ID Description Score Start End Superfamily
af_P37676_23_328_3.40.190.170 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8759 21 286 3.40.190.170
4pf8A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8619 24 286 3.40.190.170
4nn3A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8521 24 286 3.40.190.170
4nf0G00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8476 24 289 3.40.190.170
4xeqD00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8436 23 269 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A836RDQ3-F1-model_v4 DctP family TRAP transporter solute-binding subunit 0.9448 24 198 GO:0030246
GO:0030288
GO:0055085
AF-A0A3M5WH73-F1-model_v4 TRAP-type C4-dicarboxylate transport system, periplasmic protein 0.9347 12 129 GO:0030246
GO:0055085
AF-A0A376VBH0-F1-model_v4 2,3-diketo-L-gulonate TRAP transporter, substrate-binding periplasmic protein 0.9309 12 140 GO:0030246
GO:0030313
GO:0055085
AF-A0A828U0V0-F1-model_v4 Putative C4-dicarboxylate periplasmic binding protein DctP 0.9309 12 127 GO:0030246
GO:0055085
AF-A0A4V1V7U8-F1-model_v4 deleted 0.9217 12 163

Map