F464696

General Info

Members Datasets Scaffolds Average Seq Length
569 186 569 213

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100095623|Ga0068869_1000956232
Length 232
Sequence MKVEPPFNLRIFALHSYRDGMGETVDEGVQISPASDGKAPRTARGERTLRKILDAAQEEFGERGFSESSIVAITQRAGVALGTFYTYFDSKEAVFQALVRDMSAQVRDHVAPAFKDATDAIDGERRALESFLLFARKHRDVYRIIDEAEFVEPDAYREHYETTATRIAARLKAARKQGEIASDLTDSDLDILAWALMGANVFLGLKFEVWSSADAKRVAEVTSRLLRRGLAE

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
145 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
179 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
180 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
181 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
182 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
183 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 7.03
Rhizosphere 92.27
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001649 3300001915 Bacteria 6218
2 JGI24752J21851_1002861 3300001976 Bacteria 2289
3 JGI24740J21852_10001800 3300001979 Bacteria 9829
4 JGI24740J21852_10004494 3300001979 Bacteria 6001
5 JGI24739J22299_10005084 3300001989 Bacteria 5011
6 JGI24739J22299_10015730 3300001989 Bacteria 2748
7 JGI24737J22298_10006447 3300001990 Bacteria 4009
8 JGI24737J22298_10013283 3300001990 Bacteria 2681
9 JGI24737J22298_10024725 3300001990 Bacteria 1901
10 JGI24735J21928_10004612 3300002067 Bacteria 4619
11 JGI24735J21928_10055577 3300002067 Bacteria 1140
12 JGI24738J21930_10056425 3300002075 Bacteria 804
13 Ga0070658_10020495 3300005327 Bacteria 5299
14 Ga0070658_10037980 3300005327 Bacteria 3883
15 Ga0070658_10072079 3300005327 Bacteria 2830
16 Ga0070658_10120228 3300005327 Bacteria 2182
17 Ga0070658_10600874 3300005327 Bacteria 953
18 Ga0070676_10124561 3300005328 Bacteria 1622
19 Ga0070676_10154085 3300005328 Bacteria 1473
20 Ga0070683_100127607 3300005329 Bacteria 2405
21 Ga0070670_100012741 3300005331 Bacteria 7196
22 Ga0070670_100013322 3300005331 Bacteria 7041
23 Ga0070670_100022974 3300005331 Bacteria 5366
24 Ga0070670_100031031 3300005331 Bacteria 4602
25 Ga0070670_100144982 3300005331 Unclassified 2054
26 Ga0068869_100095623 3300005334 Bacteria 2242
27 Ga0070666_10002484 3300005335 Bacteria 11150
28 Ga0070666_10003825 3300005335 Bacteria 9131
29 Ga0070680_100009425 3300005336 Bacteria 7500
30 Ga0070680_100021449 3300005336 Bacteria 5134
31 Ga0070682_100129368 3300005337 Bacteria 1707
32 Ga0070682_100324552 3300005337 Bacteria 1138
33 Ga0070660_100071203 3300005339 Bacteria 2714
34 Ga0070660_100135342 3300005339 Bacteria 1974
35 Ga0070660_100215509 3300005339 Bacteria 1559
36 Ga0070660_100571181 3300005339 Bacteria 944
37 Ga0070689_100168856 3300005340 Bacteria 1772
38 Ga0070661_100006820 3300005344 Bacteria 7871
39 Ga0070661_100009255 3300005344 Bacteria 6810
40 Ga0070661_100009799 3300005344 Bacteria 6643
41 Ga0070661_100012903 3300005344 Bacteria 5853
42 Ga0070661_100057260 3300005344 Bacteria 2856
43 Ga0070661_100060912 3300005344 Bacteria 2769
44 Ga0070661_100109117 3300005344 Bacteria 2065
45 Ga0070661_100153169 3300005344 Bacteria 1744
46 Ga0070692_10019592 3300005345 Bacteria 3267
47 Ga0070692_10170207 3300005345 Bacteria 1255
48 Ga0070668_100432451 3300005347 Bacteria 1128
49 Ga0070669_100018435 3300005353 Bacteria 4988
50 Ga0070675_100026132 3300005354 Bacteria 4683
51 Ga0070671_100010425 3300005355 Bacteria 7454
52 Ga0070671_100011569 3300005355 Bacteria 7097
53 Ga0070671_100020173 3300005355 Bacteria 5432
54 Ga0070671_100028204 3300005355 Bacteria 4622
55 Ga0070671_100157162 3300005355 Bacteria 1921
56 Ga0070671_100226948 3300005355 Bacteria 1585
57 Ga0070671_100247945 3300005355 Unclassified 1512
58 Ga0070674_100029612 3300005356 Bacteria 3609
59 Ga0070674_100037296 3300005356 Bacteria 3269
60 Ga0070673_100003023 3300005364 Bacteria 10401
61 Ga0070673_100014790 3300005364 Bacteria 5455
62 Ga0070659_100060415 3300005366 Bacteria 2994
63 Ga0070659_100064693 3300005366 Bacteria 2895
64 Ga0070659_100136441 3300005366 Bacteria 1995
65 Ga0070659_100161183 3300005366 Bacteria 1834
66 Ga0070659_100328602 3300005366 Unclassified 1279
67 Ga0070659_100536923 3300005366 Bacteria 1000
68 Ga0070659_100768491 3300005366 Bacteria 836
69 Ga0070667_100012824 3300005367 Bacteria 6926
70 Ga0070667_100016340 3300005367 Bacteria 6140
71 Ga0070714_100015580 3300005435 Bacteria 6116
72 Ga0070714_100262801 3300005435 Bacteria 1599
73 Ga0070713_100177911 3300005436 Bacteria 1910
74 Ga0070663_100011073 3300005455 Bacteria 5646
75 Ga0070663_100034062 3300005455 Bacteria 3524
76 Ga0070663_100037027 3300005455 Bacteria 3394
77 Ga0070663_100043731 3300005455 Bacteria 3154
78 Ga0070663_100110161 3300005455 Bacteria 2068
79 Ga0070663_100121757 3300005455 Bacteria 1971
80 Ga0070663_100157882 3300005455 Bacteria 1744
81 Ga0070663_100490480 3300005455 Bacteria 1019
82 Ga0070678_100003317 3300005456 Bacteria 8953
83 Ga0070678_100004428 3300005456 Bacteria 7968
84 Ga0070678_100434170 3300005456 Unclassified 1147
85 Ga0070662_100014950 3300005457 Bacteria 5190
86 Ga0070662_100017613 3300005457 Bacteria 4820
87 Ga0070662_100018836 3300005457 Bacteria 4676
88 Ga0070662_100048600 3300005457 Bacteria 3056
89 Ga0070662_100051225 3300005457 Bacteria 2980
90 Ga0070662_100098668 3300005457 Bacteria 2207
91 Ga0070662_100146183 3300005457 Bacteria 1836
92 Ga0070662_100201427 3300005457 Bacteria 1580
93 Ga0070662_100411777 3300005457 Unclassified 1117
94 Ga0070662_100448726 3300005457 Bacteria 1070
95 Ga0070681_10073734 3300005458 Bacteria 3375
96 Ga0070681_10181212 3300005458 Bacteria 2028
97 Ga0070681_11060092 3300005458 Unclassified 731
98 Ga0068867_100100887 3300005459 Bacteria 2204
99 Ga0068867_100327080 3300005459 Bacteria 1272
100 Ga0070685_10149712 3300005466 Bacteria 1478
101 Ga0070679_100041792 3300005530 Bacteria 4563
102 Ga0070679_100125538 3300005530 Bacteria 2549
103 Ga0070679_100254041 3300005530 Bacteria 1713
104 Ga0070684_100207329 3300005535 Bacteria 1786
105 Ga0070684_100870474 3300005535 Bacteria 844
106 Ga0068853_100033047 3300005539 Bacteria 4386
107 Ga0068853_100213421 3300005539 Bacteria 1760
108 Ga0070672_100024264 3300005543 Bacteria 4479
109 Ga0070672_100028198 3300005543 Bacteria 4196
110 Ga0070672_100045534 3300005543 Bacteria 3394
111 Ga0070696_100061552 3300005546 Bacteria 2626
112 Ga0070696_100116734 3300005546 Bacteria 1928
113 Ga0070693_100106824 3300005547 Bacteria 1714
114 Ga0070693_100117425 3300005547 Bacteria 1646
115 Ga0070665_100008070 3300005548 Bacteria 10657
116 Ga0068855_100009828 3300005563 Bacteria 11541
117 Ga0068855_100115659 3300005563 Bacteria 3075
118 Ga0068855_100718810 3300005563 Bacteria 1067
119 Ga0070664_100005597 3300005564 Bacteria 10099
120 Ga0070664_100008653 3300005564 Bacteria 8234
121 Ga0070664_100009543 3300005564 Bacteria 7868
122 Ga0070664_100013227 3300005564 Bacteria 6721
123 Ga0070664_100032932 3300005564 Bacteria 4336
124 Ga0070664_100035856 3300005564 Bacteria 4165
125 Ga0070664_100041113 3300005564 Bacteria 3900
126 Ga0070664_100081472 3300005564 Bacteria 2789
127 Ga0070664_100333713 3300005564 Bacteria 1376
128 Ga0068857_100006128 3300005577 Bacteria 10274
129 Ga0068857_100008558 3300005577 Bacteria 8849
130 Ga0068857_100012664 3300005577 Bacteria 7348
131 Ga0068857_100021464 3300005577 Bacteria 5683
132 Ga0068857_100182370 3300005577 Bacteria 1910
133 Ga0068857_100587454 3300005577 Bacteria 1052
134 Ga0068854_100007270 3300005578 Bacteria 7072
135 Ga0068854_100017587 3300005578 Bacteria 4785
136 Ga0068854_100183029 3300005578 Bacteria 1638
137 Ga0068854_100564757 3300005578 Bacteria 967
138 Ga0068856_100028713 3300005614 Bacteria 5434
139 Ga0068856_100165438 3300005614 Bacteria 2223
140 Ga0068856_100196044 3300005614 Bacteria 2034
141 Ga0068856_100368346 3300005614 Bacteria 1455
142 Ga0068856_100853588 3300005614 Unclassified 930
143 Ga0068852_100002219 3300005616 Bacteria 13323
144 Ga0068852_100064809 3300005616 Bacteria 3186
145 Ga0068852_100533777 3300005616 Bacteria 1172
146 Ga0068859_100073948 3300005617 Bacteria 3446
147 Ga0068859_100074124 3300005617 Bacteria 3442
148 Ga0068859_100108957 3300005617 Bacteria 2831
149 Ga0068864_100004864 3300005618 Bacteria 11000
150 Ga0068864_100013847 3300005618 Bacteria 6683
151 Ga0068864_100030627 3300005618 Bacteria 4561
152 Ga0068864_100076915 3300005618 Bacteria 2917
153 Ga0068864_100096414 3300005618 Bacteria 2617
154 Ga0068864_100739341 3300005618 Bacteria 963
155 Ga0068861_100637657 3300005719 Bacteria 983
156 Ga0068851_10009898 3300005834 Bacteria 4440
157 Ga0068851_10040782 3300005834 Bacteria 2334
158 Ga0068863_100011912 3300005841 Bacteria 8404
159 Ga0068863_100013285 3300005841 Bacteria 7946
160 Ga0068863_100022135 3300005841 Bacteria 6068
161 Ga0068863_100215496 3300005841 Bacteria 1849
162 Ga0068863_100215670 3300005841 Bacteria 1848
163 Ga0068858_100008769 3300005842 Bacteria 9700
164 Ga0068858_100054707 3300005842 Bacteria 3690
165 Ga0068858_100132877 3300005842 Bacteria 2334
166 Ga0068860_100157128 3300005843 Bacteria 2192
167 Ga0075364_10221870 3300006051 Bacteria 1283
168 Ga0097621_100061215 3300006237 Bacteria 3087
169 Ga0068871_100017299 3300006358 Bacteria 5451
170 Ga0068871_100048304 3300006358 Bacteria 3435
171 Ga0068871_100220707 3300006358 Unclassified 1642
172 Ga0075428_100097508 3300006844 Bacteria 3205
173 Ga0097620_100073945 3300006931 Bacteria 3446
174 Ga0097620_100074122 3300006931 Bacteria 3442
175 Ga0097620_100108960 3300006931 Bacteria 2831
176 Ga0105251_10017734 3300009011 Bacteria 3805
177 Ga0105240_10774926 3300009093 Bacteria 1041
178 Ga0114129_10310521 3300009147 Bacteria 2099
179 Ga0105241_10549256 3300009174 Bacteria 1037
180 Ga0105242_11062360 3300009176 Bacteria 821
181 Ga0105242_11138651 3300009176 Bacteria 796
182 Ga0105248_10016702 3300009177 Bacteria 8080
183 Ga0105248_10028813 3300009177 Bacteria 6189
184 Ga0105248_10032724 3300009177 Bacteria 5808
185 Ga0105248_10059870 3300009177 Bacteria 4277
186 Ga0105248_10135506 3300009177 Bacteria 2778
187 Ga0105249_10181277 3300009553 Bacteria 2049
188 Ga0105246_10046324 3300011119 Bacteria 2965
189 Ga0105246_10215374 3300011119 Bacteria 1502
190 Ga0157373_10012052 3300013100 Bacteria 6354
191 Ga0157373_10012190 3300013100 Bacteria 6320
192 Ga0157373_10310852 3300013100 Bacteria 1120
193 Ga0157373_10576308 3300013100 Bacteria 818
194 Ga0157371_10026098 3300013102 Bacteria 4250
195 Ga0157371_10068369 3300013102 Bacteria 2514
196 Ga0157371_10080793 3300013102 Bacteria 2302
197 Ga0157370_10003707 3300013104 Bacteria 17850
198 Ga0157370_10056632 3300013104 Bacteria 3731
199 Ga0157370_10182666 3300013104 Bacteria 1949
200 Ga0157369_10058734 3300013105 Bacteria 4149
201 Ga0157369_10344494 3300013105 Bacteria 1548
202 Ga0157369_10357239 3300013105 Bacteria 1517
203 Ga0157374_10010749 3300013296 Bacteria 7890
204 Ga0157378_10074941 3300013297 Bacteria 3045
205 Ga0163162_10010545 3300013306 Bacteria 8987
206 Ga0157372_10072950 3300013307 Bacteria 3868
207 Ga0157372_10371810 3300013307 Bacteria 1666
208 Ga0157372_10460162 3300013307 Bacteria 1483
209 Ga0157375_10010265 3300013308 Bacteria 8240
210 Ga0157375_10271395 3300013308 Bacteria 1858
211 Ga0163163_10028711 3300014325 Bacteria 5346
212 Ga0163163_10147460 3300014325 Bacteria 2397
213 Ga0163163_10194456 3300014325 Bacteria 2076
214 Ga0157379_10050074 3300014968 Bacteria 3728
215 Ga0207656_10027583 3300025321 Bacteria 2324
216 Ga0207688_10009726 3300025901 Bacteria 5231
217 Ga0207680_10006094 3300025903 Bacteria 5810
218 Ga0207680_10006720 3300025903 Bacteria 5580
219 Ga0207647_10014284 3300025904 Bacteria 5478
220 Ga0207647_10044379 3300025904 Bacteria 2778
221 Ga0207647_10070270 3300025904 Bacteria 2115
222 Ga0207647_10119440 3300025904 Bacteria 1555
223 Ga0207647_10158747 3300025904 Bacteria 1320
224 Ga0207645_10051027 3300025907 Bacteria 2643
225 Ga0207645_10121475 3300025907 Bacteria 1696
226 Ga0207705_10011534 3300025909 Bacteria 6392
227 Ga0207705_10016171 3300025909 Bacteria 5353
228 Ga0207705_10045863 3300025909 Bacteria 3141
229 Ga0207705_10097861 3300025909 Bacteria 2155
230 Ga0207705_10114803 3300025909 Bacteria 1992
231 Ga0207705_10176396 3300025909 Bacteria 1611
232 Ga0207705_10236209 3300025909 Bacteria 1391
233 Ga0207705_10507173 3300025909 Bacteria 937
234 Ga0207705_10732569 3300025909 Bacteria 768
235 Ga0207654_10355852 3300025911 Bacteria 1009
236 Ga0207654_10558903 3300025911 Bacteria 813
237 Ga0207654_10636175 3300025911 Unclassified 763
238 Ga0207707_10086710 3300025912 Bacteria 2735
239 Ga0207660_10043246 3300025917 Bacteria 3165
240 Ga0207660_10207986 3300025917 Bacteria 1531
241 Ga0207660_10217143 3300025917 Bacteria 1499
242 Ga0207660_10288533 3300025917 Bacteria 1304
243 Ga0207657_10003856 3300025919 Bacteria 15923
244 Ga0207657_10012876 3300025919 Bacteria 8226
245 Ga0207657_10019447 3300025919 Bacteria 6448
246 Ga0207657_10020251 3300025919 Bacteria 6293
247 Ga0207657_10038143 3300025919 Bacteria 4282
248 Ga0207657_10041738 3300025919 Bacteria 4054
249 Ga0207657_10246610 3300025919 Bacteria 1425
250 Ga0207657_10262904 3300025919 Bacteria 1373
251 Ga0207657_10461652 3300025919 Bacteria 996
252 Ga0207649_10016768 3300025920 Bacteria 4141
253 Ga0207649_10043844 3300025920 Bacteria 2737
254 Ga0207649_10084256 3300025920 Bacteria 2066
255 Ga0207649_10097318 3300025920 Bacteria 1940
256 Ga0207649_10806246 3300025920 Bacteria 733
257 Ga0207652_10017978 3300025921 Bacteria 5792
258 Ga0207652_10122504 3300025921 Bacteria 2314
259 Ga0207652_10234439 3300025921 Bacteria 1654
260 Ga0207681_10032525 3300025923 Bacteria 3416
261 Ga0207650_10019734 3300025925 Bacteria 4741
262 Ga0207650_10084981 3300025925 Bacteria 2406
263 Ga0207650_10196325 3300025925 Unclassified 1615
264 Ga0207650_10308077 3300025925 Bacteria 1295
265 Ga0207664_10523552 3300025929 Bacteria 1063
266 Ga0207644_10002557 3300025931 Bacteria 11707
267 Ga0207644_10010230 3300025931 Bacteria 6182
268 Ga0207644_10039216 3300025931 Bacteria 3342
269 Ga0207644_10056459 3300025931 Bacteria 2833
270 Ga0207644_10063269 3300025931 Bacteria 2686
271 Ga0207644_10092594 3300025931 Bacteria 2255
272 Ga0207644_10325950 3300025931 Bacteria 1243
273 Ga0207644_10583270 3300025931 Bacteria 927
274 Ga0207690_10011515 3300025932 Bacteria 5284
275 Ga0207690_10080159 3300025932 Bacteria 2278
276 Ga0207690_10382429 3300025932 Unclassified 1119
277 Ga0207690_10848441 3300025932 Bacteria 756
278 Ga0207706_10002559 3300025933 Bacteria 17732
279 Ga0207706_10026200 3300025933 Bacteria 5218
280 Ga0207706_10030010 3300025933 Bacteria 4853
281 Ga0207706_10054658 3300025933 Bacteria 3523
282 Ga0207706_10071113 3300025933 Bacteria 3060
283 Ga0207706_10081812 3300025933 Bacteria 2838
284 Ga0207706_10083834 3300025933 Bacteria 2802
285 Ga0207706_10089090 3300025933 Bacteria 2713
286 Ga0207706_10243960 3300025933 Bacteria 1570
287 Ga0207706_10476778 3300025933 Bacteria 1078
288 Ga0207670_10241088 3300025936 Bacteria 1393
289 Ga0207669_10040752 3300025937 Bacteria 2697
290 Ga0207669_10083998 3300025937 Bacteria 2050
291 Ga0207669_10145952 3300025937 Unclassified 1650
292 Ga0207691_10020592 3300025940 Bacteria 6236
293 Ga0207691_10034102 3300025940 Bacteria 4737
294 Ga0207691_10053391 3300025940 Bacteria 3689
295 Ga0207691_10917258 3300025940 Bacteria 733
296 Ga0207711_10000123 3300025941 Bacteria 80861
297 Ga0207711_10052077 3300025941 Unclassified 3507
298 Ga0207711_10060642 3300025941 Bacteria 3260
299 Ga0207711_10210852 3300025941 Bacteria 1774
300 Ga0207689_10090153 3300025942 Bacteria 2519
301 Ga0207689_10294449 3300025942 Bacteria 1345
302 Ga0207679_10014539 3300025945 Bacteria 5179
303 Ga0207679_10022504 3300025945 Bacteria 4294
304 Ga0207679_10041173 3300025945 Bacteria 3311
305 Ga0207679_10080448 3300025945 Bacteria 2488
306 Ga0207679_10203144 3300025945 Bacteria 1657
307 Ga0207667_10042495 3300025949 Bacteria 4830
308 Ga0207667_10056214 3300025949 Bacteria 4135
309 Ga0207651_10000258 3300025960 Bacteria 22795
310 Ga0207651_10343595 3300025960 Bacteria 1254
311 Ga0207651_10502044 3300025960 Bacteria 1049
312 Ga0207640_10011228 3300025981 Bacteria 5067
313 Ga0207640_10065127 3300025981 Bacteria 2430
314 Ga0207640_10104068 3300025981 Bacteria 1997
315 Ga0207640_10289255 3300025981 Bacteria 1291
316 Ga0207640_10332765 3300025981 Bacteria 1214
317 Ga0207640_10485470 3300025981 Bacteria 1026
318 Ga0207677_11207029 3300026023 Bacteria 692
319 Ga0207703_10307353 3300026035 Bacteria 1448
320 Ga0207639_10065518 3300026041 Bacteria 2820
321 Ga0207639_10391275 3300026041 Bacteria 1250
322 Ga0207639_10674497 3300026041 Bacteria 958
323 Ga0207639_10702228 3300026041 Bacteria 938
324 Ga0207678_10004043 3300026067 Bacteria 13193
325 Ga0207678_10004189 3300026067 Bacteria 12946
326 Ga0207678_10009292 3300026067 Bacteria 8653
327 Ga0207678_10022133 3300026067 Bacteria 5569
328 Ga0207678_10031276 3300026067 Bacteria 4643
329 Ga0207678_10045005 3300026067 Bacteria 3816
330 Ga0207678_10070423 3300026067 Bacteria 2999
331 Ga0207678_10087283 3300026067 Bacteria 2666
332 Ga0207678_10158576 3300026067 Bacteria 1932
333 Ga0207678_10494079 3300026067 Bacteria 1066
334 Ga0207702_10045166 3300026078 Bacteria 3706
335 Ga0207702_10046685 3300026078 Bacteria 3646
336 Ga0207702_10167227 3300026078 Bacteria 2013
337 Ga0207641_10007293 3300026088 Bacteria 9214
338 Ga0207641_10011929 3300026088 Bacteria 7130
339 Ga0207641_10066568 3300026088 Bacteria 3083
340 Ga0207641_10219091 3300026088 Bacteria 1764
341 Ga0207641_10261252 3300026088 Bacteria 1621
342 Ga0207648_10196580 3300026089 Bacteria 1788
343 Ga0207648_10274322 3300026089 Bacteria 1507
344 Ga0207648_10333654 3300026089 Bacteria 1364
345 Ga0207648_10423326 3300026089 Bacteria 1209
346 Ga0207676_10011451 3300026095 Bacteria 6339
347 Ga0207676_10013343 3300026095 Bacteria 5902
348 Ga0207676_10022532 3300026095 Bacteria 4633
349 Ga0207676_10079155 3300026095 Bacteria 2664
350 Ga0207676_10109591 3300026095 Bacteria 2307
351 Ga0207676_10127926 3300026095 Bacteria 2155
352 Ga0207674_10000742 3300026116 Bacteria 42731
353 Ga0207674_10002644 3300026116 Bacteria 22388
354 Ga0207674_10009197 3300026116 Bacteria 11325
355 Ga0207674_10012020 3300026116 Bacteria 9699
356 Ga0207674_10034906 3300026116 Bacteria 5252
357 Ga0207674_10531686 3300026116 Bacteria 1136
358 Ga0207683_10007506 3300026121 Bacteria 9350
359 Ga0207683_10009904 3300026121 Bacteria 8127
360 Ga0207698_10311958 3300026142 Bacteria 1469
361 Ga0268266_10108797 3300028379 Bacteria 2453
362 Ga0268265_10368543 3300028380 Bacteria 1317
363 Ga0268264_10036103 3300028381 Bacteria 4069
364 Ga0307408_100052894 3300031548 Bacteria 2931
365 Ga0307405_10212389 3300031731 Bacteria 1414
366 Ga0307413_10029918 3300031824 Bacteria 3054
367 Ga0307413_10139340 3300031824 Bacteria 1673
368 Ga0307413_10591715 3300031824 Bacteria 906
369 Ga0307410_10011162 3300031852 Bacteria 5125
370 Ga0307410_10011551 3300031852 Bacteria 5056
371 Ga0307406_10495267 3300031901 Bacteria 990
372 Ga0307406_10641408 3300031901 Bacteria 880
373 Ga0307412_10235139 3300031911 Bacteria 1413
374 Ga0307409_100005232 3300031995 Bacteria 7436
375 Ga0307416_100000663 3300032002 Bacteria 17833
376 Ga0307414_10024190 3300032004 Bacteria 3868
377 Ga0307411_10023247 3300032005 Bacteria 3668
378 Ga0307411_10184143 3300032005 Bacteria 1588
379 Ga0307415_100037869 3300032126 Bacteria 3173
380 Ga0307415_100140339 3300032126 Bacteria 1844
381 Ga0373943_0003327 3300035170 Bacteria 7303
382 Ga0373947_0051941 3300035725 Bacteria 2468
383 Ga0373925_0055913 3300037068 Bacteria 2955
384 Ga0395899_0000511 3300037312 Bacteria 43020
385 Ga0395899_0000618 3300037312 Bacteria 37007
386 Ga0395899_0024786 3300037312 Bacteria 4533
387 Ga0395899_0030551 3300037312 Bacteria 4051
388 Ga0395899_0033119 3300037312 Bacteria 3882
389 Ga0395899_0045921 3300037312 Bacteria 3254
390 Ga0395899_0186260 3300037312 Bacteria 1454
391 Ga0395899_0437160 3300037312 Bacteria 859
392 Ga0395900_0000221 3300037418 Bacteria 89883
393 Ga0395900_0000500 3300037418 Bacteria 55148
394 Ga0395900_0000968 3300037418 Bacteria 37351
395 Ga0395900_0004072 3300037418 Bacteria 15590
396 Ga0395900_0011502 3300037418 Bacteria 9059
397 Ga0395900_0015114 3300037418 Bacteria 7868
398 Ga0395900_0029936 3300037418 Bacteria 5587
399 Ga0395900_0034947 3300037418 Bacteria 5177
400 Ga0395900_0059112 3300037418 Bacteria 3946
401 Ga0395900_0062520 3300037418 Bacteria 3827
402 Ga0395900_0080612 3300037418 Bacteria 3345
403 Ga0395900_0123482 3300037418 Bacteria 2655
404 Ga0395900_0149247 3300037418 Bacteria 2389
405 Ga0395900_0175599 3300037418 Bacteria 2179
406 Ga0395900_0188789 3300037418 Bacteria 2091
407 Ga0395900_0237648 3300037418 Bacteria 1829
408 Ga0395900_0800188 3300037418 Bacteria 871
409 Ga0395898_0000053 3300037466 Bacteria 279600
410 Ga0395898_0001272 3300037466 Bacteria 37253
411 Ga0395898_0018979 3300037466 Bacteria 7004
412 Ga0395898_0023182 3300037466 Bacteria 6274
413 Ga0395898_0039484 3300037466 Bacteria 4672
414 Ga0395898_0074592 3300037466 Bacteria 3276
415 Ga0395898_0110076 3300037466 Bacteria 2640
416 Ga0395898_0470447 3300037466 Bacteria 1196
417 Ga0395898_0618587 3300037466 Bacteria 1026
418 Ga0395898_1040523 3300037466 Bacteria 753
419 Ga0395905_0000031 3300037471 Bacteria 286757
420 Ga0395905_0000735 3300037471 Bacteria 43152
421 Ga0395905_0010337 3300037471 Bacteria 9083
422 Ga0395905_0017950 3300037471 Bacteria 6719
423 Ga0395905_0021814 3300037471 Bacteria 6057
424 Ga0395905_0022657 3300037471 Bacteria 5938
425 Ga0395905_0024415 3300037471 Bacteria 5705
426 Ga0395905_0025362 3300037471 Bacteria 5591
427 Ga0395905_0045903 3300037471 Bacteria 4098
428 Ga0395905_0051594 3300037471 Bacteria 3853
429 Ga0395905_0062849 3300037471 Bacteria 3473
430 Ga0395905_0066518 3300037471 Bacteria 3375
431 Ga0395905_0073352 3300037471 Bacteria 3208
432 Ga0395905_0080406 3300037471 Bacteria 3054
433 Ga0395905_0096896 3300037471 Bacteria 2769
434 Ga0395905_0106812 3300037471 Unclassified 2628
435 Ga0395905_0106954 3300037471 Bacteria 2626
436 Ga0395905_0147569 3300037471 Bacteria 2213
437 Ga0395905_0152004 3300037471 Bacteria 2177
438 Ga0395905_0183655 3300037471 Bacteria 1963
439 Ga0395905_0188236 3300037471 Bacteria 1937
440 Ga0395905_0202428 3300037471 Unclassified 1861
441 Ga0395905_0700145 3300037471 Bacteria 915
442 Ga0395905_0704959 3300037471 Bacteria 912
443 Ga0395905_0945654 3300037471 Bacteria 765
444 Ga0395901_0000163 3300038443 Bacteria 87103
445 Ga0395901_0000459 3300038443 Bacteria 47200
446 Ga0395901_0000469 3300038443 Bacteria 46905
447 Ga0395901_0011842 3300038443 Bacteria 8842
448 Ga0395901_0016131 3300038443 Bacteria 7609
449 Ga0395901_0018026 3300038443 Bacteria 7206
450 Ga0395901_0019807 3300038443 Bacteria 6881
451 Ga0395901_0028609 3300038443 Bacteria 5731
452 Ga0395901_0042301 3300038443 Bacteria 4723
453 Ga0395901_0146042 3300038443 Bacteria 2486
454 Ga0395901_0165209 3300038443 Bacteria 2324
455 Ga0395901_0168187 3300038443 Bacteria 2301
456 Ga0395901_0209680 3300038443 Bacteria 2040
457 Ga0395901_0248439 3300038443 Bacteria 1854
458 Ga0395901_0254944 3300038443 Bacteria 1827
459 Ga0395901_0322659 3300038443 Bacteria 1597
460 Ga0395901_0340506 3300038443 Bacteria 1549
461 Ga0395901_0508662 3300038443 Bacteria 1225
462 Ga0395901_1194432 3300038443 Bacteria 727
463 Ga0436365_0822316 3300039437 Bacteria 19672
464 Ga0439448_0034143 3300042005 Bacteria 1624
465 Ga0439432_010307 3300042006 Bacteria 3241
466 Ga0439449_0027842 3300042007 Bacteria 2108
467 Ga0450898_019110 3300042134 Bacteria 1192
468 Ga0439458_0000459 3300042157 Bacteria 10339
469 Ga0439458_0002234 3300042157 Bacteria 4775
470 Ga0439458_0032083 3300042157 Bacteria 1254
471 Ga0466969_0015202 3300044656 Bacteria 4035
472 Ga0466972_0099050 3300044658 Bacteria 1380
473 Ga0466965_0033609 3300044683 Bacteria 2507
474 Ga0466966_0000040 3300044684 Bacteria 97159
475 Ga0466966_0007349 3300044684 Bacteria 7305
476 Ga0466966_0158666 3300044684 Bacteria 1378
477 Ga0466963_0021233 3300044694 Bacteria 4093
478 Ga0466963_0021574 3300044694 Bacteria 4066
479 Ga0466963_0023497 3300044694 Bacteria 3916
480 Ga0466963_0051083 3300044694 Bacteria 2739
481 Ga0466963_0223167 3300044694 Bacteria 1320
482 Ga0466963_0298468 3300044694 Bacteria 1133
483 Ga0466963_0368676 3300044694 Bacteria 1012
484 Ga0466963_0663528 3300044694 Bacteria 736
485 Ga0466964_0042579 3300044706 Bacteria 1840
486 Ga0466964_0045328 3300044706 Bacteria 1789
487 Ga0466964_0322721 3300044706 Bacteria 785
488 Ga0466971_0005763 3300044719 Bacteria 5386
489 Ga0466971_0115878 3300044719 Bacteria 1239
490 Ga0466968_0006589 3300044735 Bacteria 4382
491 Ga0466970_0024472 3300044765 Bacteria 3158
492 Ga0466970_0063447 3300044765 Bacteria 1980
493 Ga0466957_0009281 3300044842 Bacteria 5612
494 Ga0466957_0050735 3300044842 Bacteria 2525
495 Ga0466957_0093994 3300044842 Bacteria 1882
496 Ga0466957_0095946 3300044842 Bacteria 1863
497 Ga0466959_0072714 3300045049 Bacteria 2488
498 Ga0466959_0082185 3300045049 Bacteria 2321
499 Ga0466959_0102031 3300045049 Bacteria 2053
500 Ga0466959_0214819 3300045049 Bacteria 1335
501 Ga0466958_0041878 3300045836 Bacteria 2756
502 Ga0466958_0049557 3300045836 Bacteria 2541
503 Ga0466958_0079367 3300045836 Bacteria 2018
504 Ga0466958_0198870 3300045836 Bacteria 1275
505 Ga0466967_0016947 3300045976 Bacteria 5763
506 Ga0466967_0028204 3300045976 Bacteria 4684
507 Ga0466967_0041010 3300045976 Bacteria 3988
508 Ga0466967_0050456 3300045976 Bacteria 3643
509 Ga0466967_0072749 3300045976 Bacteria 3082
510 Ga0466967_0082075 3300045976 Bacteria 2912
511 Ga0466967_0157962 3300045976 Bacteria 2126
512 Ga0466967_0403035 3300045976 Bacteria 1331
513 Ga0466967_0513291 3300045976 Bacteria 1177
514 Ga0466967_0950602 3300045976 Bacteria 855
515 Ga0495663_0014977 3300046525 Bacteria 2181
516 Ga0495663_0072875 3300046525 Bacteria 1096
517 Ga0495669_0006784 3300046684 Bacteria 4791
518 Ga0495677_0012201 3300047445 Bacteria 3136
519 Ga0495677_0073677 3300047445 Bacteria 1274
520 Ga0496100_0010059 3300048903 Bacteria 5346
521 Ga0496100_0334487 3300048903 Unclassified 1140
522 Ga0496101_0013569 3300048904 Bacteria 5463
523 Ga0496101_0035442 3300048904 Bacteria 3529
524 Ga0496102_0045755 3300048905 Bacteria 3973
525 Ga0496103_0109966 3300048906 Bacteria 1750
526 Ga0496104_0054465 3300048907 Bacteria 3781
527 Ga0496105_0027615 3300048908 Bacteria 4639
528 Ga0496105_0159157 3300048908 Bacteria 1854
529 Ga0496106_0018119 3300048909 Bacteria 5207
530 Ga0496106_0168887 3300048909 Bacteria 1733
531 Ga0496107_0026049 3300048910 Bacteria 4144
532 Ga0496107_0063821 3300048910 Bacteria 2669
533 Ga0496107_0238067 3300048910 Bacteria 1354
534 Ga0496108_0021534 3300048911 Bacteria 5297
535 Ga0496108_0023791 3300048911 Bacteria 5041
536 Ga0496109_0000584 3300048912 Bacteria 30505
537 Ga0496109_0001226 3300048912 Bacteria 21305
538 Ga0496109_0003874 3300048912 Bacteria 12496
539 Ga0496109_0044034 3300048912 Bacteria 4047
540 Ga0496109_0223369 3300048912 Unclassified 1771
541 Ga0496109_0287808 3300048912 Bacteria 1549
542 Ga0496110_0000437 3300048913 Bacteria 28365
543 Ga0496110_0011575 3300048913 Bacteria 7230
544 Ga0496110_0033525 3300048913 Bacteria 4442
545 Ga0496110_0057646 3300048913 Bacteria 3419
546 Ga0496110_0795116 3300048913 Bacteria 850
547 Ga0496111_0003375 3300048914 Bacteria 9872
548 Ga0496111_0003969 3300048914 Bacteria 9284
549 Ga0496111_0009813 3300048914 Bacteria 6399
550 Ga0496111_0026261 3300048914 Bacteria 4111
551 Ga0496111_0050178 3300048914 Bacteria 3009
552 Ga0496112_0021772 3300048915 Bacteria 6099
553 Ga0496112_0036668 3300048915 Bacteria 4783
554 Ga0496112_0036799 3300048915 Bacteria 4775
555 Ga0496113_0005531 3300048916 Bacteria 7888
556 Ga0496113_0017037 3300048916 Bacteria 5034
557 Ga0496113_0034688 3300048916 Bacteria 3683
558 Ga0496114_0121402 3300048917 Bacteria 2247
559 Ga0496115_0094388 3300048918 Bacteria 2447
560 Ga0501199_021420 3300049650 Bacteria 753
561 Ga0501202_060838 3300049652 Bacteria 853
562 Ga0501223_030197 3300049663 Bacteria 1054
563 Ga0501227_070897 3300049665 Bacteria 904
564 Ga0501262_001919 3300049759 Bacteria 2340
565 Ga0501270_021667 3300049767 Bacteria 985
566 nmdc:mga00v17_202506_c1 3300050491 Bacteria 1283
567 nmdc:mga0k408_76482_c1 3300050493 Bacteria 1956
568 Ga0466962_0010311 3300061719 Bacteria 4488
569 Ga0466962_0116593 3300061719 Bacteria 1287

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10016702 Ga0105248_100167024 182
2 3300005719 Ga0068861_100637657 Ga0068861_1006376572 193
3 3300042157 Ga0439458_0032083 Ga0439458_0032083_30_668 193
4 3300005614 Ga0068856_100368346 Ga0068856_1003683462 194
5 3300037418 Ga0395900_0004072 Ga0395900_0004072_8934_9569 195
6 3300038443 Ga0395901_0000459 Ga0395901_0000459_39987_40622 195
7 3300037312 Ga0395899_0045921 Ga0395899_0045921_201_839 197
8 3300037418 Ga0395900_0011502 Ga0395900_0011502_5543_6181 197
9 3300037466 Ga0395898_1040523 Ga0395898_1040523_25_663 197
10 3300037471 Ga0395905_0022657 Ga0395905_0022657_1221_1859 197
11 3300038443 Ga0395901_0508662 Ga0395901_0508662_229_867 197
12 3300031824 Ga0307413_10139340 Ga0307413_101393402 198
13 3300031911 Ga0307412_10235139 Ga0307412_102351392 198
14 3300032002 Ga0307416_100000663 Ga0307416_1000006632 198
15 3300032126 Ga0307415_100037869 Ga0307415_1000378692 198
16 3300042006 Ga0439432_010307 Ga0439432_010307_685_1323 198
17 3300042007 Ga0439449_0027842 Ga0439449_0027842_1227_1865 198
18 3300042134 Ga0450898_019110 Ga0450898_019110_443_1081 198
19 3300049650 Ga0501199_021420 Ga0501199_021420_61_699 198
20 3300049652 Ga0501202_060838 Ga0501202_060838_70_708 198
21 3300049663 Ga0501223_030197 Ga0501223_030197_238_876 198
22 3300049665 Ga0501227_070897 Ga0501227_070897_227_865 198
23 3300049759 Ga0501262_001919 Ga0501262_001919_1487_2125 198
24 3300049767 Ga0501270_021667 Ga0501270_021667_316_954 198
25 3300037312 Ga0395899_0030551 Ga0395899_0030551_2821_3435 201
26 3300037418 Ga0395900_0123482 Ga0395900_0123482_773_1387 201
27 3300037466 Ga0395898_0110076 Ga0395898_0110076_773_1387 201
28 3300037471 Ga0395905_0152004 Ga0395905_0152004_1127_1741 201
29 3300038443 Ga0395901_0322659 Ga0395901_0322659_758_1372 201
30 3300048913 Ga0496110_0033525 Ga0496110_0033525_1336_1980 203
31 3300048908 Ga0496105_0159157 Ga0496105_0159157_27_650 204
32 3300001990 JGI24737J22298_10013283 JGI24737J22298_100132834 205
33 3300044684 Ga0466966_0000040 Ga0466966_0000040_7571_8197 205
34 3300044694 Ga0466963_0663528 Ga0466963_0663528_43_669 205
35 3300045836 Ga0466958_0198870 Ga0466958_0198870_76_702 205
36 3300048904 Ga0496101_0013569 Ga0496101_0013569_4825_5451 205
37 3300048906 Ga0496103_0109966 Ga0496103_0109966_104_730 205
38 3300002067 JGI24735J21928_10055577 JGI24735J21928_100555771 207
39 3300005339 Ga0070660_100135342 Ga0070660_1001353422 207
40 3300005457 Ga0070662_100048600 Ga0070662_1000486002 207
41 3300005578 Ga0068854_100564757 Ga0068854_1005647571 207
42 3300025919 Ga0207657_10246610 Ga0207657_102466102 207
43 3300025932 Ga0207690_10011515 Ga0207690_100115152 207
44 3300025933 Ga0207706_10081812 Ga0207706_100818122 207
45 3300025937 Ga0207669_10083998 Ga0207669_100839982 207
46 3300025981 Ga0207640_10485470 Ga0207640_104854702 207
47 3300050493 nmdc:mga0k408_76482_c1 nmdc:mga0k408_76482_c1_449_1081 207
48 3300001990 JGI24737J22298_10006447 JGI24737J22298_100064472 208
49 3300002075 JGI24738J21930_10056425 JGI24738J21930_100564251 208
50 3300005331 Ga0070670_100013322 Ga0070670_1000133223 208
51 3300005331 Ga0070670_100031031 Ga0070670_1000310313 208
52 3300005335 Ga0070666_10003825 Ga0070666_100038254 208
53 3300005355 Ga0070671_100028204 Ga0070671_1000282042 208
54 3300005355 Ga0070671_100226948 Ga0070671_1002269482 208
55 3300005356 Ga0070674_100037296 Ga0070674_1000372962 208
56 3300005364 Ga0070673_100003023 Ga0070673_1000030234 208
57 3300005366 Ga0070659_100060415 Ga0070659_1000604152 208
58 3300005367 Ga0070667_100016340 Ga0070667_1000163406 208
59 3300005455 Ga0070663_100110161 Ga0070663_1001101612 208
60 3300005455 Ga0070663_100490480 Ga0070663_1004904802 208
61 3300005456 Ga0070678_100003317 Ga0070678_1000033174 208
62 3300005456 Ga0070678_100434170 Ga0070678_1004341701 208
63 3300005457 Ga0070662_100018836 Ga0070662_1000188362 208
64 3300005466 Ga0070685_10149712 Ga0070685_101497122 208
65 3300005543 Ga0070672_100028198 Ga0070672_1000281983 208
66 3300005564 Ga0070664_100035856 Ga0070664_1000358562 208
67 3300005577 Ga0068857_100021464 Ga0068857_1000214642 208
68 3300005616 Ga0068852_100533777 Ga0068852_1005337772 208
69 3300005617 Ga0068859_100108957 Ga0068859_1001089573 208
70 3300005618 Ga0068864_100004864 Ga0068864_1000048643 208
71 3300005841 Ga0068863_100011912 Ga0068863_1000119123 208
72 3300005841 Ga0068863_100013285 Ga0068863_1000132854 208
73 3300005842 Ga0068858_100008769 Ga0068858_1000087694 208
74 3300006051 Ga0075364_10221870 Ga0075364_102218702 208
75 3300006358 Ga0068871_100048304 Ga0068871_1000483044 208
76 3300006931 Ga0097620_100108960 Ga0097620_1001089603 208
77 3300009177 Ga0105248_10032724 Ga0105248_100327244 208
78 3300013104 Ga0157370_10003707 Ga0157370_100037073 208
79 3300013296 Ga0157374_10010749 Ga0157374_100107494 208
80 3300013306 Ga0163162_10010545 Ga0163162_100105454 208
81 3300013308 Ga0157375_10010265 Ga0157375_100102653 208
82 3300014325 Ga0163163_10028711 Ga0163163_100287113 208
83 3300014325 Ga0163163_10147460 Ga0163163_101474602 208
84 3300025903 Ga0207680_10006720 Ga0207680_100067203 208
85 3300025909 Ga0207705_10097861 Ga0207705_100978612 208
86 3300025911 Ga0207654_10636175 Ga0207654_106361752 208
87 3300025919 Ga0207657_10019447 Ga0207657_100194472 208
88 3300025920 Ga0207649_10016768 Ga0207649_100167682 208
89 3300025920 Ga0207649_10806246 Ga0207649_108062461 208
90 3300025925 Ga0207650_10084981 Ga0207650_100849812 208
91 3300025931 Ga0207644_10010230 Ga0207644_100102302 208
92 3300025932 Ga0207690_10080159 Ga0207690_100801592 208
93 3300025933 Ga0207706_10026200 Ga0207706_100262003 208
94 3300025937 Ga0207669_10145952 Ga0207669_101459522 208
95 3300025940 Ga0207691_10034102 Ga0207691_100341023 208
96 3300025941 Ga0207711_10052077 Ga0207711_100520772 208
97 3300025941 Ga0207711_10060642 Ga0207711_100606422 208
98 3300025960 Ga0207651_10000258 Ga0207651_1000025820 208
99 3300026041 Ga0207639_10674497 Ga0207639_106744971 208
100 3300026067 Ga0207678_10009292 Ga0207678_100092927 208
101 3300026088 Ga0207641_10007293 Ga0207641_100072933 208
102 3300026095 Ga0207676_10127926 Ga0207676_101279262 208
103 3300026116 Ga0207674_10012020 Ga0207674_100120203 208
104 3300026121 Ga0207683_10007506 Ga0207683_100075063 208
105 3300026142 Ga0207698_10311958 Ga0207698_103119581 208
106 3300037312 Ga0395899_0024786 Ga0395899_0024786_1952_2587 208
107 3300037312 Ga0395899_0186260 Ga0395899_0186260_37_672 208
108 3300037418 Ga0395900_0000968 Ga0395900_0000968_6504_7139 208
109 3300037418 Ga0395900_0062520 Ga0395900_0062520_1252_1890 208
110 3300037418 Ga0395900_0149247 Ga0395900_0149247_475_1110 208
111 3300037418 Ga0395900_0175599 Ga0395900_0175599_222_854 208
112 3300037418 Ga0395900_0188789 Ga0395900_0188789_1167_1799 208
113 3300037466 Ga0395898_0023182 Ga0395898_0023182_4957_5592 208
114 3300037471 Ga0395905_0000735 Ga0395905_0000735_9673_10308 208
115 3300037471 Ga0395905_0010337 Ga0395905_0010337_3042_3677 208
116 3300037471 Ga0395905_0051594 Ga0395905_0051594_3081_3713 208
117 3300037471 Ga0395905_0062849 Ga0395905_0062849_45_680 208
118 3300037471 Ga0395905_0106812 Ga0395905_0106812_766_1401 208
119 3300037471 Ga0395905_0106954 Ga0395905_0106954_395_1033 208
120 3300037471 Ga0395905_0188236 Ga0395905_0188236_1087_1722 208
121 3300037471 Ga0395905_0202428 Ga0395905_0202428_537_1169 208
122 3300038443 Ga0395901_0011842 Ga0395901_0011842_2359_2994 208
123 3300038443 Ga0395901_0042301 Ga0395901_0042301_1350_1988 208
124 3300038443 Ga0395901_0146042 Ga0395901_0146042_141_773 208
125 3300038443 Ga0395901_0165209 Ga0395901_0165209_1131_1766 208
126 3300038443 Ga0395901_0168187 Ga0395901_0168187_542_1174 208
127 3300042157 Ga0439458_0002234 Ga0439458_0002234_109_741 208
128 3300044658 Ga0466972_0099050 Ga0466972_0099050_725_1360 208
129 3300044683 Ga0466965_0033609 Ga0466965_0033609_1564_2199 208
130 3300044684 Ga0466966_0158666 Ga0466966_0158666_624_1259 208
131 3300044694 Ga0466963_0021233 Ga0466963_0021233_2969_3604 208
132 3300044694 Ga0466963_0023497 Ga0466963_0023497_2966_3601 208
133 3300044694 Ga0466963_0051083 Ga0466963_0051083_1905_2540 208
134 3300044706 Ga0466964_0042579 Ga0466964_0042579_291_926 208
135 3300044706 Ga0466964_0045328 Ga0466964_0045328_495_1130 208
136 3300044719 Ga0466971_0005763 Ga0466971_0005763_1743_2378 208
137 3300044735 Ga0466968_0006589 Ga0466968_0006589_2701_3336 208
138 3300044765 Ga0466970_0063447 Ga0466970_0063447_832_1467 208
139 3300044842 Ga0466957_0009281 Ga0466957_0009281_2759_3394 208
140 3300044842 Ga0466957_0050735 Ga0466957_0050735_1769_2404 208
141 3300044842 Ga0466957_0095946 Ga0466957_0095946_44_679 208
142 3300045049 Ga0466959_0072714 Ga0466959_0072714_864_1499 208
143 3300045049 Ga0466959_0102031 Ga0466959_0102031_434_1069 208
144 3300045049 Ga0466959_0214819 Ga0466959_0214819_32_667 208
145 3300045836 Ga0466958_0041878 Ga0466958_0041878_1069_1704 208
146 3300045836 Ga0466958_0049557 Ga0466958_0049557_435_1070 208
147 3300045976 Ga0466967_0016947 Ga0466967_0016947_4577_5212 208
148 3300045976 Ga0466967_0028204 Ga0466967_0028204_2048_2683 208
149 3300045976 Ga0466967_0072749 Ga0466967_0072749_2353_2988 208
150 3300045976 Ga0466967_0403035 Ga0466967_0403035_622_1257 208
151 3300045976 Ga0466967_0950602 Ga0466967_0950602_77_712 208
152 3300047445 Ga0495677_0073677 Ga0495677_0073677_454_1095 208
153 3300048903 Ga0496100_0334487 Ga0496100_0334487_91_726 208
154 3300048904 Ga0496101_0035442 Ga0496101_0035442_410_1045 208
155 3300048909 Ga0496106_0168887 Ga0496106_0168887_19_654 208
156 3300048910 Ga0496107_0026049 Ga0496107_0026049_907_1542 208
157 3300048912 Ga0496109_0000584 Ga0496109_0000584_15669_16304 208
158 3300048913 Ga0496110_0000437 Ga0496110_0000437_3395_4030 208
159 3300048914 Ga0496111_0026261 Ga0496111_0026261_991_1626 208
160 3300048916 Ga0496113_0017037 Ga0496113_0017037_3371_4006 208
161 3300048917 Ga0496114_0121402 Ga0496114_0121402_1519_2154 208
162 3300048918 Ga0496115_0094388 Ga0496115_0094388_103_738 208
163 3300050491 nmdc:mga00v17_202506_c1 nmdc:mga00v17_202506_c1_350_985 208
164 3300061719 Ga0466962_0010311 Ga0466962_0010311_809_1444 208
165 3300001915 JGI24741J21665_1001649 JGI24741J21665_10016492 209
166 3300001976 JGI24752J21851_1002861 JGI24752J21851_10028612 209
167 3300001979 JGI24740J21852_10001800 JGI24740J21852_100018002 209
168 3300001979 JGI24740J21852_10004494 JGI24740J21852_100044942 209
169 3300001989 JGI24739J22299_10005084 JGI24739J22299_100050842 209
170 3300001989 JGI24739J22299_10015730 JGI24739J22299_100157302 209
171 3300001990 JGI24737J22298_10024725 JGI24737J22298_100247252 209
172 3300002067 JGI24735J21928_10004612 JGI24735J21928_100046122 209
173 3300005327 Ga0070658_10020495 Ga0070658_100204952 209
174 3300005327 Ga0070658_10037980 Ga0070658_100379804 209
175 3300005327 Ga0070658_10072079 Ga0070658_100720792 209
176 3300005327 Ga0070658_10120228 Ga0070658_101202282 209
177 3300005327 Ga0070658_10600874 Ga0070658_106008742 209
178 3300005328 Ga0070676_10124561 Ga0070676_101245612 209
179 3300005328 Ga0070676_10154085 Ga0070676_101540852 209
180 3300005329 Ga0070683_100127607 Ga0070683_1001276072 209
181 3300005331 Ga0070670_100012741 Ga0070670_1000127412 209
182 3300005331 Ga0070670_100022974 Ga0070670_1000229742 209
183 3300005331 Ga0070670_100144982 Ga0070670_1001449822 209
184 3300005334 Ga0068869_100095623 Ga0068869_1000956232 209
185 3300005335 Ga0070666_10002484 Ga0070666_100024842 209
186 3300005336 Ga0070680_100009425 Ga0070680_1000094256 209
187 3300005336 Ga0070680_100021449 Ga0070680_1000214497 209
188 3300005337 Ga0070682_100129368 Ga0070682_1001293682 209
189 3300005337 Ga0070682_100324552 Ga0070682_1003245521 209
190 3300005339 Ga0070660_100071203 Ga0070660_1000712032 209
191 3300005339 Ga0070660_100215509 Ga0070660_1002155092 209
192 3300005339 Ga0070660_100571181 Ga0070660_1005711811 209
193 3300005340 Ga0070689_100168856 Ga0070689_1001688562 209
194 3300005344 Ga0070661_100006820 Ga0070661_1000068205 209
195 3300005344 Ga0070661_100009255 Ga0070661_1000092552 209
196 3300005344 Ga0070661_100009799 Ga0070661_1000097996 209
197 3300005344 Ga0070661_100012903 Ga0070661_1000129033 209
198 3300005344 Ga0070661_100057260 Ga0070661_1000572602 209
199 3300005344 Ga0070661_100060912 Ga0070661_1000609123 209
200 3300005344 Ga0070661_100109117 Ga0070661_1001091172 209
201 3300005344 Ga0070661_100153169 Ga0070661_1001531692 209
202 3300005345 Ga0070692_10019592 Ga0070692_100195922 209
203 3300005345 Ga0070692_10170207 Ga0070692_101702072 209
204 3300005347 Ga0070668_100432451 Ga0070668_1004324512 209
205 3300005353 Ga0070669_100018435 Ga0070669_1000184353 209
206 3300005354 Ga0070675_100026132 Ga0070675_1000261323 209
207 3300005355 Ga0070671_100010425 Ga0070671_1000104256 209
208 3300005355 Ga0070671_100011569 Ga0070671_1000115694 209
209 3300005355 Ga0070671_100020173 Ga0070671_1000201732 209
210 3300005355 Ga0070671_100157162 Ga0070671_1001571622 209
211 3300005355 Ga0070671_100247945 Ga0070671_1002479452 209
212 3300005356 Ga0070674_100029612 Ga0070674_1000296121 209
213 3300005364 Ga0070673_100014790 Ga0070673_1000147903 209
214 3300005366 Ga0070659_100064693 Ga0070659_1000646932 209
215 3300005366 Ga0070659_100136441 Ga0070659_1001364412 209
216 3300005366 Ga0070659_100161183 Ga0070659_1001611832 209
217 3300005366 Ga0070659_100328602 Ga0070659_1003286022 209
218 3300005366 Ga0070659_100536923 Ga0070659_1005369232 209
219 3300005366 Ga0070659_100768491 Ga0070659_1007684911 209
220 3300005367 Ga0070667_100012824 Ga0070667_1000128243 209
221 3300005435 Ga0070714_100015580 Ga0070714_1000155807 209
222 3300005435 Ga0070714_100262801 Ga0070714_1002628012 209
223 3300005436 Ga0070713_100177911 Ga0070713_1001779112 209
224 3300005455 Ga0070663_100011073 Ga0070663_1000110732 209
225 3300005455 Ga0070663_100034062 Ga0070663_1000340622 209
226 3300005455 Ga0070663_100037027 Ga0070663_1000370272 209
227 3300005455 Ga0070663_100043731 Ga0070663_1000437312 209
228 3300005455 Ga0070663_100121757 Ga0070663_1001217572 209
229 3300005455 Ga0070663_100157882 Ga0070663_1001578822 209
230 3300005456 Ga0070678_100004428 Ga0070678_1000044285 209
231 3300005457 Ga0070662_100014950 Ga0070662_1000149502 209
232 3300005457 Ga0070662_100017613 Ga0070662_1000176134 209
233 3300005457 Ga0070662_100051225 Ga0070662_1000512254 209
234 3300005457 Ga0070662_100098668 Ga0070662_1000986683 209
235 3300005457 Ga0070662_100146183 Ga0070662_1001461832 209
236 3300005457 Ga0070662_100201427 Ga0070662_1002014272 209
237 3300005457 Ga0070662_100411777 Ga0070662_1004117772 209
238 3300005457 Ga0070662_100448726 Ga0070662_1004487261 209
239 3300005458 Ga0070681_10073734 Ga0070681_100737341 209
240 3300005458 Ga0070681_10181212 Ga0070681_101812122 209
241 3300005458 Ga0070681_11060092 Ga0070681_110600921 209
242 3300005459 Ga0068867_100100887 Ga0068867_1001008873 209
243 3300005459 Ga0068867_100327080 Ga0068867_1003270802 209
244 3300005530 Ga0070679_100041792 Ga0070679_1000417922 209
245 3300005530 Ga0070679_100125538 Ga0070679_1001255382 209
246 3300005530 Ga0070679_100254041 Ga0070679_1002540412 209
247 3300005535 Ga0070684_100207329 Ga0070684_1002073292 209
248 3300005535 Ga0070684_100870474 Ga0070684_1008704742 209
249 3300005539 Ga0068853_100033047 Ga0068853_1000330472 209
250 3300005539 Ga0068853_100213421 Ga0068853_1002134212 209
251 3300005543 Ga0070672_100024264 Ga0070672_1000242645 209
252 3300005543 Ga0070672_100045534 Ga0070672_1000455341 209
253 3300005546 Ga0070696_100061552 Ga0070696_1000615523 209
254 3300005546 Ga0070696_100116734 Ga0070696_1001167342 209
255 3300005547 Ga0070693_100106824 Ga0070693_1001068241 209
256 3300005547 Ga0070693_100117425 Ga0070693_1001174252 209
257 3300005548 Ga0070665_100008070 Ga0070665_1000080708 209
258 3300005563 Ga0068855_100009828 Ga0068855_1000098288 209
259 3300005563 Ga0068855_100115659 Ga0068855_1001156592 209
260 3300005563 Ga0068855_100718810 Ga0068855_1007188101 209
261 3300005564 Ga0070664_100005597 Ga0070664_1000055979 209
262 3300005564 Ga0070664_100008653 Ga0070664_1000086536 209
263 3300005564 Ga0070664_100009543 Ga0070664_1000095436 209
264 3300005564 Ga0070664_100013227 Ga0070664_1000132278 209
265 3300005564 Ga0070664_100032932 Ga0070664_1000329322 209
266 3300005564 Ga0070664_100041113 Ga0070664_1000411132 209
267 3300005564 Ga0070664_100081472 Ga0070664_1000814724 209
268 3300005564 Ga0070664_100333713 Ga0070664_1003337132 209
269 3300005577 Ga0068857_100006128 Ga0068857_1000061283 209
270 3300005577 Ga0068857_100008558 Ga0068857_10000855811 209
271 3300005577 Ga0068857_100012664 Ga0068857_1000126644 209
272 3300005577 Ga0068857_100182370 Ga0068857_1001823703 209
273 3300005577 Ga0068857_100587454 Ga0068857_1005874542 209
274 3300005578 Ga0068854_100007270 Ga0068854_1000072705 209
275 3300005578 Ga0068854_100017587 Ga0068854_1000175872 209
276 3300005578 Ga0068854_100183029 Ga0068854_1001830292 209
277 3300005614 Ga0068856_100028713 Ga0068856_1000287132 209
278 3300005614 Ga0068856_100165438 Ga0068856_1001654382 209
279 3300005614 Ga0068856_100196044 Ga0068856_1001960442 209
280 3300005614 Ga0068856_100853588 Ga0068856_1008535882 209
281 3300005616 Ga0068852_100002219 Ga0068852_10000221914 209
282 3300005616 Ga0068852_100064809 Ga0068852_1000648092 209
283 3300005617 Ga0068859_100073948 Ga0068859_1000739482 209
284 3300005617 Ga0068859_100074124 Ga0068859_1000741242 209
285 3300005618 Ga0068864_100013847 Ga0068864_1000138472 209
286 3300005618 Ga0068864_100030627 Ga0068864_1000306276 209
287 3300005618 Ga0068864_100076915 Ga0068864_1000769152 209
288 3300005618 Ga0068864_100096414 Ga0068864_1000964142 209
289 3300005618 Ga0068864_100739341 Ga0068864_1007393412 209
290 3300005834 Ga0068851_10009898 Ga0068851_100098983 209
291 3300005834 Ga0068851_10040782 Ga0068851_100407823 209
292 3300005841 Ga0068863_100022135 Ga0068863_1000221355 209
293 3300005841 Ga0068863_100215496 Ga0068863_1002154962 209
294 3300005841 Ga0068863_100215670 Ga0068863_1002156702 209
295 3300005842 Ga0068858_100054707 Ga0068858_1000547074 209
296 3300005842 Ga0068858_100132877 Ga0068858_1001328771 209
297 3300005843 Ga0068860_100157128 Ga0068860_1001571282 209
298 3300006237 Ga0097621_100061215 Ga0097621_1000612152 209
299 3300006358 Ga0068871_100017299 Ga0068871_1000172997 209
300 3300006358 Ga0068871_100220707 Ga0068871_1002207072 209
301 3300006844 Ga0075428_100097508 Ga0075428_1000975082 209
302 3300006931 Ga0097620_100073945 Ga0097620_1000739452 209
303 3300006931 Ga0097620_100074122 Ga0097620_1000741222 209
304 3300009011 Ga0105251_10017734 Ga0105251_100177344 209
305 3300009093 Ga0105240_10774926 Ga0105240_107749261 209
306 3300009147 Ga0114129_10310521 Ga0114129_103105212 209
307 3300009174 Ga0105241_10549256 Ga0105241_105492561 209
308 3300009176 Ga0105242_11062360 Ga0105242_110623602 209
309 3300009176 Ga0105242_11138651 Ga0105242_111386511 209
310 3300009177 Ga0105248_10028813 Ga0105248_100288137 209
311 3300009177 Ga0105248_10059870 Ga0105248_100598702 209
312 3300009177 Ga0105248_10135506 Ga0105248_101355062 209
313 3300009553 Ga0105249_10181277 Ga0105249_101812773 209
314 3300011119 Ga0105246_10046324 Ga0105246_100463244 209
315 3300011119 Ga0105246_10215374 Ga0105246_102153742 209
316 3300013100 Ga0157373_10012052 Ga0157373_100120523 209
317 3300013100 Ga0157373_10012190 Ga0157373_100121906 209
318 3300013100 Ga0157373_10310852 Ga0157373_103108522 209
319 3300013100 Ga0157373_10576308 Ga0157373_105763081 209
320 3300013102 Ga0157371_10026098 Ga0157371_100260983 209
321 3300013102 Ga0157371_10068369 Ga0157371_100683692 209
322 3300013102 Ga0157371_10080793 Ga0157371_100807932 209
323 3300013104 Ga0157370_10056632 Ga0157370_100566325 209
324 3300013104 Ga0157370_10182666 Ga0157370_101826663 209
325 3300013105 Ga0157369_10058734 Ga0157369_100587345 209
326 3300013105 Ga0157369_10344494 Ga0157369_103444941 209
327 3300013105 Ga0157369_10357239 Ga0157369_103572392 209
328 3300013297 Ga0157378_10074941 Ga0157378_100749412 209
329 3300013307 Ga0157372_10072950 Ga0157372_100729502 209
330 3300013307 Ga0157372_10371810 Ga0157372_103718102 209
331 3300013307 Ga0157372_10460162 Ga0157372_104601622 209
332 3300013308 Ga0157375_10271395 Ga0157375_102713952 209
333 3300014325 Ga0163163_10194456 Ga0163163_101944562 209
334 3300014968 Ga0157379_10050074 Ga0157379_100500742 209
335 3300025321 Ga0207656_10027583 Ga0207656_100275832 209
336 3300025901 Ga0207688_10009726 Ga0207688_100097262 209
337 3300025903 Ga0207680_10006094 Ga0207680_100060942 209
338 3300025904 Ga0207647_10014284 Ga0207647_100142842 209
339 3300025904 Ga0207647_10044379 Ga0207647_100443792 209
340 3300025904 Ga0207647_10070270 Ga0207647_100702701 209
341 3300025904 Ga0207647_10119440 Ga0207647_101194401 209
342 3300025904 Ga0207647_10158747 Ga0207647_101587472 209
343 3300025907 Ga0207645_10051027 Ga0207645_100510272 209
344 3300025907 Ga0207645_10121475 Ga0207645_101214752 209
345 3300025909 Ga0207705_10011534 Ga0207705_100115342 209
346 3300025909 Ga0207705_10016171 Ga0207705_100161712 209
347 3300025909 Ga0207705_10045863 Ga0207705_100458632 209
348 3300025909 Ga0207705_10114803 Ga0207705_101148031 209
349 3300025909 Ga0207705_10176396 Ga0207705_101763962 209
350 3300025909 Ga0207705_10236209 Ga0207705_102362092 209
351 3300025909 Ga0207705_10507173 Ga0207705_105071732 209
352 3300025909 Ga0207705_10732569 Ga0207705_107325691 209
353 3300025911 Ga0207654_10355852 Ga0207654_103558521 209
354 3300025911 Ga0207654_10558903 Ga0207654_105589031 209
355 3300025912 Ga0207707_10086710 Ga0207707_100867101 209
356 3300025917 Ga0207660_10043246 Ga0207660_100432461 209
357 3300025917 Ga0207660_10207986 Ga0207660_102079862 209
358 3300025917 Ga0207660_10217143 Ga0207660_102171432 209
359 3300025917 Ga0207660_10288533 Ga0207660_102885332 209
360 3300025919 Ga0207657_10003856 Ga0207657_1000385613 209
361 3300025919 Ga0207657_10012876 Ga0207657_100128766 209
362 3300025919 Ga0207657_10020251 Ga0207657_100202516 209
363 3300025919 Ga0207657_10038143 Ga0207657_100381432 209
364 3300025919 Ga0207657_10041738 Ga0207657_100417384 209
365 3300025919 Ga0207657_10262904 Ga0207657_102629041 209
366 3300025919 Ga0207657_10461652 Ga0207657_104616522 209
367 3300025920 Ga0207649_10043844 Ga0207649_100438442 209
368 3300025920 Ga0207649_10084256 Ga0207649_100842562 209
369 3300025920 Ga0207649_10097318 Ga0207649_100973183 209
370 3300025921 Ga0207652_10017978 Ga0207652_100179782 209
371 3300025921 Ga0207652_10122504 Ga0207652_101225042 209
372 3300025921 Ga0207652_10234439 Ga0207652_102344392 209
373 3300025923 Ga0207681_10032525 Ga0207681_100325252 209
374 3300025925 Ga0207650_10019734 Ga0207650_100197342 209
375 3300025925 Ga0207650_10196325 Ga0207650_101963252 209
376 3300025925 Ga0207650_10308077 Ga0207650_103080772 209
377 3300025929 Ga0207664_10523552 Ga0207664_105235522 209
378 3300025931 Ga0207644_10002557 Ga0207644_100025572 209
379 3300025931 Ga0207644_10039216 Ga0207644_100392162 209
380 3300025931 Ga0207644_10056459 Ga0207644_100564594 209
381 3300025931 Ga0207644_10063269 Ga0207644_100632692 209
382 3300025931 Ga0207644_10092594 Ga0207644_100925942 209
383 3300025931 Ga0207644_10325950 Ga0207644_103259502 209
384 3300025931 Ga0207644_10583270 Ga0207644_105832701 209
385 3300025932 Ga0207690_10382429 Ga0207690_103824292 209
386 3300025932 Ga0207690_10848441 Ga0207690_108484411 209
387 3300025933 Ga0207706_10002559 Ga0207706_1000255916 209
388 3300025933 Ga0207706_10030010 Ga0207706_100300102 209
389 3300025933 Ga0207706_10054658 Ga0207706_100546584 209
390 3300025933 Ga0207706_10071113 Ga0207706_100711134 209
391 3300025933 Ga0207706_10083834 Ga0207706_100838342 209
392 3300025933 Ga0207706_10089090 Ga0207706_100890902 209
393 3300025933 Ga0207706_10243960 Ga0207706_102439602 209
394 3300025933 Ga0207706_10476778 Ga0207706_104767782 209
395 3300025936 Ga0207670_10241088 Ga0207670_102410882 209
396 3300025937 Ga0207669_10040752 Ga0207669_100407521 209
397 3300025940 Ga0207691_10020592 Ga0207691_100205923 209
398 3300025940 Ga0207691_10053391 Ga0207691_100533911 209
399 3300025940 Ga0207691_10917258 Ga0207691_109172581 209
400 3300025941 Ga0207711_10000123 Ga0207711_1000012377 209
401 3300025941 Ga0207711_10210852 Ga0207711_102108522 209
402 3300025942 Ga0207689_10090153 Ga0207689_100901532 209
403 3300025942 Ga0207689_10294449 Ga0207689_102944492 209
404 3300025945 Ga0207679_10014539 Ga0207679_100145393 209
405 3300025945 Ga0207679_10022504 Ga0207679_100225042 209
406 3300025945 Ga0207679_10041173 Ga0207679_100411732 209
407 3300025945 Ga0207679_10080448 Ga0207679_100804482 209
408 3300025945 Ga0207679_10203144 Ga0207679_102031442 209
409 3300025949 Ga0207667_10042495 Ga0207667_100424953 209
410 3300025949 Ga0207667_10056214 Ga0207667_100562143 209
411 3300025960 Ga0207651_10343595 Ga0207651_103435952 209
412 3300025960 Ga0207651_10502044 Ga0207651_105020441 209
413 3300025981 Ga0207640_10011228 Ga0207640_100112282 209
414 3300025981 Ga0207640_10065127 Ga0207640_100651272 209
415 3300025981 Ga0207640_10104068 Ga0207640_101040682 209
416 3300025981 Ga0207640_10289255 Ga0207640_102892551 209
417 3300025981 Ga0207640_10332765 Ga0207640_103327652 209
418 3300026023 Ga0207677_11207029 Ga0207677_112070291 209
419 3300026035 Ga0207703_10307353 Ga0207703_103073532 209
420 3300026041 Ga0207639_10065518 Ga0207639_100655182 209
421 3300026041 Ga0207639_10391275 Ga0207639_103912752 209
422 3300026041 Ga0207639_10702228 Ga0207639_107022282 209
423 3300026067 Ga0207678_10004043 Ga0207678_1000404310 209
424 3300026067 Ga0207678_10004189 Ga0207678_1000418913 209
425 3300026067 Ga0207678_10022133 Ga0207678_100221332 209
426 3300026067 Ga0207678_10031276 Ga0207678_100312763 209
427 3300026067 Ga0207678_10045005 Ga0207678_100450052 209
428 3300026067 Ga0207678_10070423 Ga0207678_100704232 209
429 3300026067 Ga0207678_10087283 Ga0207678_100872834 209
430 3300026067 Ga0207678_10158576 Ga0207678_101585762 209
431 3300026067 Ga0207678_10494079 Ga0207678_104940792 209
432 3300026078 Ga0207702_10045166 Ga0207702_100451662 209
433 3300026078 Ga0207702_10046685 Ga0207702_100466852 209
434 3300026078 Ga0207702_10167227 Ga0207702_101672271 209
435 3300026088 Ga0207641_10011929 Ga0207641_100119295 209
436 3300026088 Ga0207641_10066568 Ga0207641_100665682 209
437 3300026088 Ga0207641_10219091 Ga0207641_102190912 209
438 3300026088 Ga0207641_10261252 Ga0207641_102612522 209
439 3300026089 Ga0207648_10196580 Ga0207648_101965802 209
440 3300026089 Ga0207648_10274322 Ga0207648_102743222 209
441 3300026089 Ga0207648_10333654 Ga0207648_103336541 209
442 3300026089 Ga0207648_10423326 Ga0207648_104233261 209
443 3300026095 Ga0207676_10011451 Ga0207676_100114512 209
444 3300026095 Ga0207676_10013343 Ga0207676_100133433 209
445 3300026095 Ga0207676_10022532 Ga0207676_100225324 209
446 3300026095 Ga0207676_10079155 Ga0207676_100791554 209
447 3300026095 Ga0207676_10109591 Ga0207676_101095912 209
448 3300026116 Ga0207674_10000742 Ga0207674_1000074233 209
449 3300026116 Ga0207674_10002644 Ga0207674_1000264419 209
450 3300026116 Ga0207674_10009197 Ga0207674_100091972 209
451 3300026116 Ga0207674_10034906 Ga0207674_100349062 209
452 3300026116 Ga0207674_10531686 Ga0207674_105316862 209
453 3300026121 Ga0207683_10009904 Ga0207683_100099045 209
454 3300028379 Ga0268266_10108797 Ga0268266_101087973 209
455 3300028380 Ga0268265_10368543 Ga0268265_103685432 209
456 3300028381 Ga0268264_10036103 Ga0268264_100361036 209
457 3300031548 Ga0307408_100052894 Ga0307408_1000528942 209
458 3300031731 Ga0307405_10212389 Ga0307405_102123892 209
459 3300031824 Ga0307413_10029918 Ga0307413_100299182 209
460 3300031824 Ga0307413_10591715 Ga0307413_105917151 209
461 3300031852 Ga0307410_10011162 Ga0307410_100111622 209
462 3300031852 Ga0307410_10011551 Ga0307410_100115512 209
463 3300031901 Ga0307406_10495267 Ga0307406_104952671 209
464 3300031901 Ga0307406_10641408 Ga0307406_106414082 209
465 3300031995 Ga0307409_100005232 Ga0307409_1000052323 209
466 3300032004 Ga0307414_10024190 Ga0307414_100241902 209
467 3300032005 Ga0307411_10023247 Ga0307411_100232472 209
468 3300032005 Ga0307411_10184143 Ga0307411_101841432 209
469 3300032126 Ga0307415_100140339 Ga0307415_1001403392 209
470 3300035170 Ga0373943_0003327 Ga0373943_0003327_1308_1955 209
471 3300035725 Ga0373947_0051941 Ga0373947_0051941_64_711 209
472 3300037068 Ga0373925_0055913 Ga0373925_0055913_1309_1956 209
473 3300037312 Ga0395899_0000511 Ga0395899_0000511_1028_1678 209
474 3300037312 Ga0395899_0000618 Ga0395899_0000618_7647_8285 209
475 3300037312 Ga0395899_0033119 Ga0395899_0033119_884_1522 209
476 3300037312 Ga0395899_0437160 Ga0395899_0437160_96_734 209
477 3300037418 Ga0395900_0000221 Ga0395900_0000221_55092_55730 209
478 3300037418 Ga0395900_0000500 Ga0395900_0000500_16491_17141 209
479 3300037418 Ga0395900_0015114 Ga0395900_0015114_3719_4357 209
480 3300037418 Ga0395900_0029936 Ga0395900_0029936_4374_5012 209
481 3300037418 Ga0395900_0034947 Ga0395900_0034947_2700_3338 209
482 3300037418 Ga0395900_0059112 Ga0395900_0059112_2081_2719 209
483 3300037418 Ga0395900_0080612 Ga0395900_0080612_1387_2055 209
484 3300037418 Ga0395900_0237648 Ga0395900_0237648_778_1416 209
485 3300037418 Ga0395900_0800188 Ga0395900_0800188_19_657 209
486 3300037466 Ga0395898_0000053 Ga0395898_0000053_223871_224509 209
487 3300037466 Ga0395898_0001272 Ga0395898_0001272_30110_30760 209
488 3300037466 Ga0395898_0018979 Ga0395898_0018979_6047_6685 209
489 3300037466 Ga0395898_0039484 Ga0395898_0039484_3936_4574 209
490 3300037466 Ga0395898_0074592 Ga0395898_0074592_886_1524 209
491 3300037466 Ga0395898_0470447 Ga0395898_0470447_455_1093 209
492 3300037466 Ga0395898_0618587 Ga0395898_0618587_204_872 209
493 3300037471 Ga0395905_0000031 Ga0395905_0000031_62249_62887 209
494 3300037471 Ga0395905_0017950 Ga0395905_0017950_4019_4657 209
495 3300037471 Ga0395905_0021814 Ga0395905_0021814_877_1515 209
496 3300037471 Ga0395905_0024415 Ga0395905_0024415_4630_5268 209
497 3300037471 Ga0395905_0025362 Ga0395905_0025362_3016_3663 209
498 3300037471 Ga0395905_0045903 Ga0395905_0045903_84_722 209
499 3300037471 Ga0395905_0066518 Ga0395905_0066518_2321_2959 209
500 3300037471 Ga0395905_0073352 Ga0395905_0073352_1950_2588 209
501 3300037471 Ga0395905_0080406 Ga0395905_0080406_234_872 209
502 3300037471 Ga0395905_0096896 Ga0395905_0096896_930_1568 209
503 3300037471 Ga0395905_0147569 Ga0395905_0147569_742_1380 209
504 3300037471 Ga0395905_0183655 Ga0395905_0183655_514_1152 209
505 3300037471 Ga0395905_0700145 Ga0395905_0700145_190_828 209
506 3300037471 Ga0395905_0704959 Ga0395905_0704959_195_863 209
507 3300037471 Ga0395905_0945654 Ga0395905_0945654_100_738 209
508 3300038443 Ga0395901_0000163 Ga0395901_0000163_23065_23703 209
509 3300038443 Ga0395901_0000469 Ga0395901_0000469_16499_17149 209
510 3300038443 Ga0395901_0016131 Ga0395901_0016131_3993_4631 209
511 3300038443 Ga0395901_0018026 Ga0395901_0018026_4875_5513 209
512 3300038443 Ga0395901_0019807 Ga0395901_0019807_2833_3480 209
513 3300038443 Ga0395901_0028609 Ga0395901_0028609_784_1422 209
514 3300038443 Ga0395901_0209680 Ga0395901_0209680_560_1198 209
515 3300038443 Ga0395901_0248439 Ga0395901_0248439_963_1601 209
516 3300038443 Ga0395901_0254944 Ga0395901_0254944_959_1627 209
517 3300038443 Ga0395901_0340506 Ga0395901_0340506_128_766 209
518 3300038443 Ga0395901_1194432 Ga0395901_1194432_68_706 209
519 3300039437 Ga0436365_0822316 Ga0436365_0822316_13853_14491 209
520 3300042005 Ga0439448_0034143 Ga0439448_0034143_585_1223 209
521 3300042157 Ga0439458_0000459 Ga0439458_0000459_4772_5410 209
522 3300044656 Ga0466969_0015202 Ga0466969_0015202_3301_3939 209
523 3300044684 Ga0466966_0007349 Ga0466966_0007349_4029_4667 209
524 3300044694 Ga0466963_0021574 Ga0466963_0021574_1961_2605 209
525 3300044694 Ga0466963_0223167 Ga0466963_0223167_553_1251 209
526 3300044694 Ga0466963_0298468 Ga0466963_0298468_313_951 209
527 3300044694 Ga0466963_0368676 Ga0466963_0368676_342_980 209
528 3300044706 Ga0466964_0322721 Ga0466964_0322721_96_740 209
529 3300044719 Ga0466971_0115878 Ga0466971_0115878_359_997 209
530 3300044765 Ga0466970_0024472 Ga0466970_0024472_291_929 209
531 3300044842 Ga0466957_0093994 Ga0466957_0093994_514_1152 209
532 3300045049 Ga0466959_0082185 Ga0466959_0082185_1162_1800 209
533 3300045836 Ga0466958_0079367 Ga0466958_0079367_1301_1939 209
534 3300045976 Ga0466967_0041010 Ga0466967_0041010_873_1517 209
535 3300045976 Ga0466967_0050456 Ga0466967_0050456_383_1081 209
536 3300045976 Ga0466967_0082075 Ga0466967_0082075_1725_2369 209
537 3300045976 Ga0466967_0157962 Ga0466967_0157962_1108_1746 209
538 3300045976 Ga0466967_0513291 Ga0466967_0513291_167_805 209
539 3300046525 Ga0495663_0014977 Ga0495663_0014977_929_1567 209
540 3300046525 Ga0495663_0072875 Ga0495663_0072875_299_937 209
541 3300046684 Ga0495669_0006784 Ga0495669_0006784_2092_2730 209
542 3300047445 Ga0495677_0012201 Ga0495677_0012201_1143_1781 209
543 3300048903 Ga0496100_0010059 Ga0496100_0010059_4114_4758 209
544 3300048905 Ga0496102_0045755 Ga0496102_0045755_1266_1904 209
545 3300048907 Ga0496104_0054465 Ga0496104_0054465_2066_2704 209
546 3300048908 Ga0496105_0027615 Ga0496105_0027615_1091_1738 209
547 3300048909 Ga0496106_0018119 Ga0496106_0018119_2709_3353 209
548 3300048910 Ga0496107_0063821 Ga0496107_0063821_91_729 209
549 3300048910 Ga0496107_0238067 Ga0496107_0238067_310_954 209
550 3300048911 Ga0496108_0021534 Ga0496108_0021534_2914_3561 209
551 3300048911 Ga0496108_0023791 Ga0496108_0023791_4368_5012 209
552 3300048912 Ga0496109_0001226 Ga0496109_0001226_16415_17059 209
553 3300048912 Ga0496109_0003874 Ga0496109_0003874_5473_6120 209
554 3300048912 Ga0496109_0044034 Ga0496109_0044034_2790_3428 209
555 3300048912 Ga0496109_0223369 Ga0496109_0223369_651_1289 209
556 3300048912 Ga0496109_0287808 Ga0496109_0287808_547_1245 209
557 3300048913 Ga0496110_0011575 Ga0496110_0011575_4128_4775 209
558 3300048913 Ga0496110_0057646 Ga0496110_0057646_990_1628 209
559 3300048913 Ga0496110_0795116 Ga0496110_0795116_78_716 209
560 3300048914 Ga0496111_0003375 Ga0496111_0003375_4532_5179 209
561 3300048914 Ga0496111_0003969 Ga0496111_0003969_3689_4333 209
562 3300048914 Ga0496111_0009813 Ga0496111_0009813_3971_4609 209
563 3300048914 Ga0496111_0050178 Ga0496111_0050178_444_1082 209
564 3300048915 Ga0496112_0021772 Ga0496112_0021772_1653_2297 209
565 3300048915 Ga0496112_0036668 Ga0496112_0036668_2835_3473 209
566 3300048915 Ga0496112_0036799 Ga0496112_0036799_799_1437 209
567 3300048916 Ga0496113_0005531 Ga0496113_0005531_3686_4333 209
568 3300048916 Ga0496113_0034688 Ga0496113_0034688_30_668 209
569 3300061719 Ga0466962_0116593 Ga0466962_0116593_65_703 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

52

98

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8654 25 96
4pxi-assembly1.cif.gz_A elucidation of the structural and functional mechanism of action of the tetr family protein, cprb from s. coelicolor a3(2) 0.6343 21 163
4pxi-assembly1.cif.gz_D elucidation of the structural and functional mechanism of action of the tetr family protein, cprb from s. coelicolor a3(2) 0.6272 24 174
3pas-assembly1.cif.gz_A crystal structure of a tetr family transcription regulator (maqu_1417) from marinobacter aquaeolei vt8 at 1.90 a resolution 0.6215 21 174
1ui5-assembly1.cif.gz_A crystal structure of gamma-butyrolactone receptor (arpa like protein) 0.6195 21 174
ID Description Score Start End Superfamily
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.003 27 67 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9995 25 67 1.10.10.60
5gp9B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9977 27 67 1.10.10.60
6azhB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9917 28 71 1.10.10.60
2wv1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9917 23 59 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A259HH19-F1-model_v4 TetR family transcriptional regulator 0.9432 10 112 GO:0000976
GO:0003700
AF-A0A7V9DIR6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.925 16 119 GO:0000976
GO:0003700
AF-A0A7V9IWJ0-F1-model_v4 TetR/AcrR family transcriptional regulator 0.8894 15 121 GO:0000976
GO:0003700
AF-A0A524KFS5-F1-model_v4 TetR/AcrR family transcriptional regulator 0.8881 21 126 GO:0000976
GO:0003700
AF-A0A2N2LHZ8-F1-model_v4 HTH tetR-type domain-containing protein 0.8846 23 121 GO:0003677

Feature Viewer

pLDDT pTM Quality
87.78 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map