F464696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 569 | 186 | 569 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100095623|Ga0068869_1000956232 |
| Length | 232 |
| Sequence | MKVEPPFNLRIFALHSYRDGMGETVDEGVQISPASDGKAPRTARGERTLRKILDAAQEEFGERGFSESSIVAITQRAGVALGTFYTYFDSKEAVFQALVRDMSAQVRDHVAPAFKDATDAIDGERRALESFLLFARKHRDVYRIIDEAEFVEPDAYREHYETTATRIAARLKAARKQGEIASDLTDSDLDILAWALMGANVFLGLKFEVWSSADAKRVAEVTSRLLRRGLAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 122 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 124 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 141 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 142 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 143 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 144 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 145 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 146 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 147 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 148 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 151 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 152 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 153 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 154 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 165 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 166 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 167 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 173 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 179 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 180 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 181 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 182 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 183 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 184 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 186 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.53 |
| Nodule | 0 |
| Rhizoplane | 7.03 |
| Rhizosphere | 92.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001649 | 3300001915 | Bacteria | 6218 |
| 2 | JGI24752J21851_1002861 | 3300001976 | Bacteria | 2289 |
| 3 | JGI24740J21852_10001800 | 3300001979 | Bacteria | 9829 |
| 4 | JGI24740J21852_10004494 | 3300001979 | Bacteria | 6001 |
| 5 | JGI24739J22299_10005084 | 3300001989 | Bacteria | 5011 |
| 6 | JGI24739J22299_10015730 | 3300001989 | Bacteria | 2748 |
| 7 | JGI24737J22298_10006447 | 3300001990 | Bacteria | 4009 |
| 8 | JGI24737J22298_10013283 | 3300001990 | Bacteria | 2681 |
| 9 | JGI24737J22298_10024725 | 3300001990 | Bacteria | 1901 |
| 10 | JGI24735J21928_10004612 | 3300002067 | Bacteria | 4619 |
| 11 | JGI24735J21928_10055577 | 3300002067 | Bacteria | 1140 |
| 12 | JGI24738J21930_10056425 | 3300002075 | Bacteria | 804 |
| 13 | Ga0070658_10020495 | 3300005327 | Bacteria | 5299 |
| 14 | Ga0070658_10037980 | 3300005327 | Bacteria | 3883 |
| 15 | Ga0070658_10072079 | 3300005327 | Bacteria | 2830 |
| 16 | Ga0070658_10120228 | 3300005327 | Bacteria | 2182 |
| 17 | Ga0070658_10600874 | 3300005327 | Bacteria | 953 |
| 18 | Ga0070676_10124561 | 3300005328 | Bacteria | 1622 |
| 19 | Ga0070676_10154085 | 3300005328 | Bacteria | 1473 |
| 20 | Ga0070683_100127607 | 3300005329 | Bacteria | 2405 |
| 21 | Ga0070670_100012741 | 3300005331 | Bacteria | 7196 |
| 22 | Ga0070670_100013322 | 3300005331 | Bacteria | 7041 |
| 23 | Ga0070670_100022974 | 3300005331 | Bacteria | 5366 |
| 24 | Ga0070670_100031031 | 3300005331 | Bacteria | 4602 |
| 25 | Ga0070670_100144982 | 3300005331 | Unclassified | 2054 |
| 26 | Ga0068869_100095623 | 3300005334 | Bacteria | 2242 |
| 27 | Ga0070666_10002484 | 3300005335 | Bacteria | 11150 |
| 28 | Ga0070666_10003825 | 3300005335 | Bacteria | 9131 |
| 29 | Ga0070680_100009425 | 3300005336 | Bacteria | 7500 |
| 30 | Ga0070680_100021449 | 3300005336 | Bacteria | 5134 |
| 31 | Ga0070682_100129368 | 3300005337 | Bacteria | 1707 |
| 32 | Ga0070682_100324552 | 3300005337 | Bacteria | 1138 |
| 33 | Ga0070660_100071203 | 3300005339 | Bacteria | 2714 |
| 34 | Ga0070660_100135342 | 3300005339 | Bacteria | 1974 |
| 35 | Ga0070660_100215509 | 3300005339 | Bacteria | 1559 |
| 36 | Ga0070660_100571181 | 3300005339 | Bacteria | 944 |
| 37 | Ga0070689_100168856 | 3300005340 | Bacteria | 1772 |
| 38 | Ga0070661_100006820 | 3300005344 | Bacteria | 7871 |
| 39 | Ga0070661_100009255 | 3300005344 | Bacteria | 6810 |
| 40 | Ga0070661_100009799 | 3300005344 | Bacteria | 6643 |
| 41 | Ga0070661_100012903 | 3300005344 | Bacteria | 5853 |
| 42 | Ga0070661_100057260 | 3300005344 | Bacteria | 2856 |
| 43 | Ga0070661_100060912 | 3300005344 | Bacteria | 2769 |
| 44 | Ga0070661_100109117 | 3300005344 | Bacteria | 2065 |
| 45 | Ga0070661_100153169 | 3300005344 | Bacteria | 1744 |
| 46 | Ga0070692_10019592 | 3300005345 | Bacteria | 3267 |
| 47 | Ga0070692_10170207 | 3300005345 | Bacteria | 1255 |
| 48 | Ga0070668_100432451 | 3300005347 | Bacteria | 1128 |
| 49 | Ga0070669_100018435 | 3300005353 | Bacteria | 4988 |
| 50 | Ga0070675_100026132 | 3300005354 | Bacteria | 4683 |
| 51 | Ga0070671_100010425 | 3300005355 | Bacteria | 7454 |
| 52 | Ga0070671_100011569 | 3300005355 | Bacteria | 7097 |
| 53 | Ga0070671_100020173 | 3300005355 | Bacteria | 5432 |
| 54 | Ga0070671_100028204 | 3300005355 | Bacteria | 4622 |
| 55 | Ga0070671_100157162 | 3300005355 | Bacteria | 1921 |
| 56 | Ga0070671_100226948 | 3300005355 | Bacteria | 1585 |
| 57 | Ga0070671_100247945 | 3300005355 | Unclassified | 1512 |
| 58 | Ga0070674_100029612 | 3300005356 | Bacteria | 3609 |
| 59 | Ga0070674_100037296 | 3300005356 | Bacteria | 3269 |
| 60 | Ga0070673_100003023 | 3300005364 | Bacteria | 10401 |
| 61 | Ga0070673_100014790 | 3300005364 | Bacteria | 5455 |
| 62 | Ga0070659_100060415 | 3300005366 | Bacteria | 2994 |
| 63 | Ga0070659_100064693 | 3300005366 | Bacteria | 2895 |
| 64 | Ga0070659_100136441 | 3300005366 | Bacteria | 1995 |
| 65 | Ga0070659_100161183 | 3300005366 | Bacteria | 1834 |
| 66 | Ga0070659_100328602 | 3300005366 | Unclassified | 1279 |
| 67 | Ga0070659_100536923 | 3300005366 | Bacteria | 1000 |
| 68 | Ga0070659_100768491 | 3300005366 | Bacteria | 836 |
| 69 | Ga0070667_100012824 | 3300005367 | Bacteria | 6926 |
| 70 | Ga0070667_100016340 | 3300005367 | Bacteria | 6140 |
| 71 | Ga0070714_100015580 | 3300005435 | Bacteria | 6116 |
| 72 | Ga0070714_100262801 | 3300005435 | Bacteria | 1599 |
| 73 | Ga0070713_100177911 | 3300005436 | Bacteria | 1910 |
| 74 | Ga0070663_100011073 | 3300005455 | Bacteria | 5646 |
| 75 | Ga0070663_100034062 | 3300005455 | Bacteria | 3524 |
| 76 | Ga0070663_100037027 | 3300005455 | Bacteria | 3394 |
| 77 | Ga0070663_100043731 | 3300005455 | Bacteria | 3154 |
| 78 | Ga0070663_100110161 | 3300005455 | Bacteria | 2068 |
| 79 | Ga0070663_100121757 | 3300005455 | Bacteria | 1971 |
| 80 | Ga0070663_100157882 | 3300005455 | Bacteria | 1744 |
| 81 | Ga0070663_100490480 | 3300005455 | Bacteria | 1019 |
| 82 | Ga0070678_100003317 | 3300005456 | Bacteria | 8953 |
| 83 | Ga0070678_100004428 | 3300005456 | Bacteria | 7968 |
| 84 | Ga0070678_100434170 | 3300005456 | Unclassified | 1147 |
| 85 | Ga0070662_100014950 | 3300005457 | Bacteria | 5190 |
| 86 | Ga0070662_100017613 | 3300005457 | Bacteria | 4820 |
| 87 | Ga0070662_100018836 | 3300005457 | Bacteria | 4676 |
| 88 | Ga0070662_100048600 | 3300005457 | Bacteria | 3056 |
| 89 | Ga0070662_100051225 | 3300005457 | Bacteria | 2980 |
| 90 | Ga0070662_100098668 | 3300005457 | Bacteria | 2207 |
| 91 | Ga0070662_100146183 | 3300005457 | Bacteria | 1836 |
| 92 | Ga0070662_100201427 | 3300005457 | Bacteria | 1580 |
| 93 | Ga0070662_100411777 | 3300005457 | Unclassified | 1117 |
| 94 | Ga0070662_100448726 | 3300005457 | Bacteria | 1070 |
| 95 | Ga0070681_10073734 | 3300005458 | Bacteria | 3375 |
| 96 | Ga0070681_10181212 | 3300005458 | Bacteria | 2028 |
| 97 | Ga0070681_11060092 | 3300005458 | Unclassified | 731 |
| 98 | Ga0068867_100100887 | 3300005459 | Bacteria | 2204 |
| 99 | Ga0068867_100327080 | 3300005459 | Bacteria | 1272 |
| 100 | Ga0070685_10149712 | 3300005466 | Bacteria | 1478 |
| 101 | Ga0070679_100041792 | 3300005530 | Bacteria | 4563 |
| 102 | Ga0070679_100125538 | 3300005530 | Bacteria | 2549 |
| 103 | Ga0070679_100254041 | 3300005530 | Bacteria | 1713 |
| 104 | Ga0070684_100207329 | 3300005535 | Bacteria | 1786 |
| 105 | Ga0070684_100870474 | 3300005535 | Bacteria | 844 |
| 106 | Ga0068853_100033047 | 3300005539 | Bacteria | 4386 |
| 107 | Ga0068853_100213421 | 3300005539 | Bacteria | 1760 |
| 108 | Ga0070672_100024264 | 3300005543 | Bacteria | 4479 |
| 109 | Ga0070672_100028198 | 3300005543 | Bacteria | 4196 |
| 110 | Ga0070672_100045534 | 3300005543 | Bacteria | 3394 |
| 111 | Ga0070696_100061552 | 3300005546 | Bacteria | 2626 |
| 112 | Ga0070696_100116734 | 3300005546 | Bacteria | 1928 |
| 113 | Ga0070693_100106824 | 3300005547 | Bacteria | 1714 |
| 114 | Ga0070693_100117425 | 3300005547 | Bacteria | 1646 |
| 115 | Ga0070665_100008070 | 3300005548 | Bacteria | 10657 |
| 116 | Ga0068855_100009828 | 3300005563 | Bacteria | 11541 |
| 117 | Ga0068855_100115659 | 3300005563 | Bacteria | 3075 |
| 118 | Ga0068855_100718810 | 3300005563 | Bacteria | 1067 |
| 119 | Ga0070664_100005597 | 3300005564 | Bacteria | 10099 |
| 120 | Ga0070664_100008653 | 3300005564 | Bacteria | 8234 |
| 121 | Ga0070664_100009543 | 3300005564 | Bacteria | 7868 |
| 122 | Ga0070664_100013227 | 3300005564 | Bacteria | 6721 |
| 123 | Ga0070664_100032932 | 3300005564 | Bacteria | 4336 |
| 124 | Ga0070664_100035856 | 3300005564 | Bacteria | 4165 |
| 125 | Ga0070664_100041113 | 3300005564 | Bacteria | 3900 |
| 126 | Ga0070664_100081472 | 3300005564 | Bacteria | 2789 |
| 127 | Ga0070664_100333713 | 3300005564 | Bacteria | 1376 |
| 128 | Ga0068857_100006128 | 3300005577 | Bacteria | 10274 |
| 129 | Ga0068857_100008558 | 3300005577 | Bacteria | 8849 |
| 130 | Ga0068857_100012664 | 3300005577 | Bacteria | 7348 |
| 131 | Ga0068857_100021464 | 3300005577 | Bacteria | 5683 |
| 132 | Ga0068857_100182370 | 3300005577 | Bacteria | 1910 |
| 133 | Ga0068857_100587454 | 3300005577 | Bacteria | 1052 |
| 134 | Ga0068854_100007270 | 3300005578 | Bacteria | 7072 |
| 135 | Ga0068854_100017587 | 3300005578 | Bacteria | 4785 |
| 136 | Ga0068854_100183029 | 3300005578 | Bacteria | 1638 |
| 137 | Ga0068854_100564757 | 3300005578 | Bacteria | 967 |
| 138 | Ga0068856_100028713 | 3300005614 | Bacteria | 5434 |
| 139 | Ga0068856_100165438 | 3300005614 | Bacteria | 2223 |
| 140 | Ga0068856_100196044 | 3300005614 | Bacteria | 2034 |
| 141 | Ga0068856_100368346 | 3300005614 | Bacteria | 1455 |
| 142 | Ga0068856_100853588 | 3300005614 | Unclassified | 930 |
| 143 | Ga0068852_100002219 | 3300005616 | Bacteria | 13323 |
| 144 | Ga0068852_100064809 | 3300005616 | Bacteria | 3186 |
| 145 | Ga0068852_100533777 | 3300005616 | Bacteria | 1172 |
| 146 | Ga0068859_100073948 | 3300005617 | Bacteria | 3446 |
| 147 | Ga0068859_100074124 | 3300005617 | Bacteria | 3442 |
| 148 | Ga0068859_100108957 | 3300005617 | Bacteria | 2831 |
| 149 | Ga0068864_100004864 | 3300005618 | Bacteria | 11000 |
| 150 | Ga0068864_100013847 | 3300005618 | Bacteria | 6683 |
| 151 | Ga0068864_100030627 | 3300005618 | Bacteria | 4561 |
| 152 | Ga0068864_100076915 | 3300005618 | Bacteria | 2917 |
| 153 | Ga0068864_100096414 | 3300005618 | Bacteria | 2617 |
| 154 | Ga0068864_100739341 | 3300005618 | Bacteria | 963 |
| 155 | Ga0068861_100637657 | 3300005719 | Bacteria | 983 |
| 156 | Ga0068851_10009898 | 3300005834 | Bacteria | 4440 |
| 157 | Ga0068851_10040782 | 3300005834 | Bacteria | 2334 |
| 158 | Ga0068863_100011912 | 3300005841 | Bacteria | 8404 |
| 159 | Ga0068863_100013285 | 3300005841 | Bacteria | 7946 |
| 160 | Ga0068863_100022135 | 3300005841 | Bacteria | 6068 |
| 161 | Ga0068863_100215496 | 3300005841 | Bacteria | 1849 |
| 162 | Ga0068863_100215670 | 3300005841 | Bacteria | 1848 |
| 163 | Ga0068858_100008769 | 3300005842 | Bacteria | 9700 |
| 164 | Ga0068858_100054707 | 3300005842 | Bacteria | 3690 |
| 165 | Ga0068858_100132877 | 3300005842 | Bacteria | 2334 |
| 166 | Ga0068860_100157128 | 3300005843 | Bacteria | 2192 |
| 167 | Ga0075364_10221870 | 3300006051 | Bacteria | 1283 |
| 168 | Ga0097621_100061215 | 3300006237 | Bacteria | 3087 |
| 169 | Ga0068871_100017299 | 3300006358 | Bacteria | 5451 |
| 170 | Ga0068871_100048304 | 3300006358 | Bacteria | 3435 |
| 171 | Ga0068871_100220707 | 3300006358 | Unclassified | 1642 |
| 172 | Ga0075428_100097508 | 3300006844 | Bacteria | 3205 |
| 173 | Ga0097620_100073945 | 3300006931 | Bacteria | 3446 |
| 174 | Ga0097620_100074122 | 3300006931 | Bacteria | 3442 |
| 175 | Ga0097620_100108960 | 3300006931 | Bacteria | 2831 |
| 176 | Ga0105251_10017734 | 3300009011 | Bacteria | 3805 |
| 177 | Ga0105240_10774926 | 3300009093 | Bacteria | 1041 |
| 178 | Ga0114129_10310521 | 3300009147 | Bacteria | 2099 |
| 179 | Ga0105241_10549256 | 3300009174 | Bacteria | 1037 |
| 180 | Ga0105242_11062360 | 3300009176 | Bacteria | 821 |
| 181 | Ga0105242_11138651 | 3300009176 | Bacteria | 796 |
| 182 | Ga0105248_10016702 | 3300009177 | Bacteria | 8080 |
| 183 | Ga0105248_10028813 | 3300009177 | Bacteria | 6189 |
| 184 | Ga0105248_10032724 | 3300009177 | Bacteria | 5808 |
| 185 | Ga0105248_10059870 | 3300009177 | Bacteria | 4277 |
| 186 | Ga0105248_10135506 | 3300009177 | Bacteria | 2778 |
| 187 | Ga0105249_10181277 | 3300009553 | Bacteria | 2049 |
| 188 | Ga0105246_10046324 | 3300011119 | Bacteria | 2965 |
| 189 | Ga0105246_10215374 | 3300011119 | Bacteria | 1502 |
| 190 | Ga0157373_10012052 | 3300013100 | Bacteria | 6354 |
| 191 | Ga0157373_10012190 | 3300013100 | Bacteria | 6320 |
| 192 | Ga0157373_10310852 | 3300013100 | Bacteria | 1120 |
| 193 | Ga0157373_10576308 | 3300013100 | Bacteria | 818 |
| 194 | Ga0157371_10026098 | 3300013102 | Bacteria | 4250 |
| 195 | Ga0157371_10068369 | 3300013102 | Bacteria | 2514 |
| 196 | Ga0157371_10080793 | 3300013102 | Bacteria | 2302 |
| 197 | Ga0157370_10003707 | 3300013104 | Bacteria | 17850 |
| 198 | Ga0157370_10056632 | 3300013104 | Bacteria | 3731 |
| 199 | Ga0157370_10182666 | 3300013104 | Bacteria | 1949 |
| 200 | Ga0157369_10058734 | 3300013105 | Bacteria | 4149 |
| 201 | Ga0157369_10344494 | 3300013105 | Bacteria | 1548 |
| 202 | Ga0157369_10357239 | 3300013105 | Bacteria | 1517 |
| 203 | Ga0157374_10010749 | 3300013296 | Bacteria | 7890 |
| 204 | Ga0157378_10074941 | 3300013297 | Bacteria | 3045 |
| 205 | Ga0163162_10010545 | 3300013306 | Bacteria | 8987 |
| 206 | Ga0157372_10072950 | 3300013307 | Bacteria | 3868 |
| 207 | Ga0157372_10371810 | 3300013307 | Bacteria | 1666 |
| 208 | Ga0157372_10460162 | 3300013307 | Bacteria | 1483 |
| 209 | Ga0157375_10010265 | 3300013308 | Bacteria | 8240 |
| 210 | Ga0157375_10271395 | 3300013308 | Bacteria | 1858 |
| 211 | Ga0163163_10028711 | 3300014325 | Bacteria | 5346 |
| 212 | Ga0163163_10147460 | 3300014325 | Bacteria | 2397 |
| 213 | Ga0163163_10194456 | 3300014325 | Bacteria | 2076 |
| 214 | Ga0157379_10050074 | 3300014968 | Bacteria | 3728 |
| 215 | Ga0207656_10027583 | 3300025321 | Bacteria | 2324 |
| 216 | Ga0207688_10009726 | 3300025901 | Bacteria | 5231 |
| 217 | Ga0207680_10006094 | 3300025903 | Bacteria | 5810 |
| 218 | Ga0207680_10006720 | 3300025903 | Bacteria | 5580 |
| 219 | Ga0207647_10014284 | 3300025904 | Bacteria | 5478 |
| 220 | Ga0207647_10044379 | 3300025904 | Bacteria | 2778 |
| 221 | Ga0207647_10070270 | 3300025904 | Bacteria | 2115 |
| 222 | Ga0207647_10119440 | 3300025904 | Bacteria | 1555 |
| 223 | Ga0207647_10158747 | 3300025904 | Bacteria | 1320 |
| 224 | Ga0207645_10051027 | 3300025907 | Bacteria | 2643 |
| 225 | Ga0207645_10121475 | 3300025907 | Bacteria | 1696 |
| 226 | Ga0207705_10011534 | 3300025909 | Bacteria | 6392 |
| 227 | Ga0207705_10016171 | 3300025909 | Bacteria | 5353 |
| 228 | Ga0207705_10045863 | 3300025909 | Bacteria | 3141 |
| 229 | Ga0207705_10097861 | 3300025909 | Bacteria | 2155 |
| 230 | Ga0207705_10114803 | 3300025909 | Bacteria | 1992 |
| 231 | Ga0207705_10176396 | 3300025909 | Bacteria | 1611 |
| 232 | Ga0207705_10236209 | 3300025909 | Bacteria | 1391 |
| 233 | Ga0207705_10507173 | 3300025909 | Bacteria | 937 |
| 234 | Ga0207705_10732569 | 3300025909 | Bacteria | 768 |
| 235 | Ga0207654_10355852 | 3300025911 | Bacteria | 1009 |
| 236 | Ga0207654_10558903 | 3300025911 | Bacteria | 813 |
| 237 | Ga0207654_10636175 | 3300025911 | Unclassified | 763 |
| 238 | Ga0207707_10086710 | 3300025912 | Bacteria | 2735 |
| 239 | Ga0207660_10043246 | 3300025917 | Bacteria | 3165 |
| 240 | Ga0207660_10207986 | 3300025917 | Bacteria | 1531 |
| 241 | Ga0207660_10217143 | 3300025917 | Bacteria | 1499 |
| 242 | Ga0207660_10288533 | 3300025917 | Bacteria | 1304 |
| 243 | Ga0207657_10003856 | 3300025919 | Bacteria | 15923 |
| 244 | Ga0207657_10012876 | 3300025919 | Bacteria | 8226 |
| 245 | Ga0207657_10019447 | 3300025919 | Bacteria | 6448 |
| 246 | Ga0207657_10020251 | 3300025919 | Bacteria | 6293 |
| 247 | Ga0207657_10038143 | 3300025919 | Bacteria | 4282 |
| 248 | Ga0207657_10041738 | 3300025919 | Bacteria | 4054 |
| 249 | Ga0207657_10246610 | 3300025919 | Bacteria | 1425 |
| 250 | Ga0207657_10262904 | 3300025919 | Bacteria | 1373 |
| 251 | Ga0207657_10461652 | 3300025919 | Bacteria | 996 |
| 252 | Ga0207649_10016768 | 3300025920 | Bacteria | 4141 |
| 253 | Ga0207649_10043844 | 3300025920 | Bacteria | 2737 |
| 254 | Ga0207649_10084256 | 3300025920 | Bacteria | 2066 |
| 255 | Ga0207649_10097318 | 3300025920 | Bacteria | 1940 |
| 256 | Ga0207649_10806246 | 3300025920 | Bacteria | 733 |
| 257 | Ga0207652_10017978 | 3300025921 | Bacteria | 5792 |
| 258 | Ga0207652_10122504 | 3300025921 | Bacteria | 2314 |
| 259 | Ga0207652_10234439 | 3300025921 | Bacteria | 1654 |
| 260 | Ga0207681_10032525 | 3300025923 | Bacteria | 3416 |
| 261 | Ga0207650_10019734 | 3300025925 | Bacteria | 4741 |
| 262 | Ga0207650_10084981 | 3300025925 | Bacteria | 2406 |
| 263 | Ga0207650_10196325 | 3300025925 | Unclassified | 1615 |
| 264 | Ga0207650_10308077 | 3300025925 | Bacteria | 1295 |
| 265 | Ga0207664_10523552 | 3300025929 | Bacteria | 1063 |
| 266 | Ga0207644_10002557 | 3300025931 | Bacteria | 11707 |
| 267 | Ga0207644_10010230 | 3300025931 | Bacteria | 6182 |
| 268 | Ga0207644_10039216 | 3300025931 | Bacteria | 3342 |
| 269 | Ga0207644_10056459 | 3300025931 | Bacteria | 2833 |
| 270 | Ga0207644_10063269 | 3300025931 | Bacteria | 2686 |
| 271 | Ga0207644_10092594 | 3300025931 | Bacteria | 2255 |
| 272 | Ga0207644_10325950 | 3300025931 | Bacteria | 1243 |
| 273 | Ga0207644_10583270 | 3300025931 | Bacteria | 927 |
| 274 | Ga0207690_10011515 | 3300025932 | Bacteria | 5284 |
| 275 | Ga0207690_10080159 | 3300025932 | Bacteria | 2278 |
| 276 | Ga0207690_10382429 | 3300025932 | Unclassified | 1119 |
| 277 | Ga0207690_10848441 | 3300025932 | Bacteria | 756 |
| 278 | Ga0207706_10002559 | 3300025933 | Bacteria | 17732 |
| 279 | Ga0207706_10026200 | 3300025933 | Bacteria | 5218 |
| 280 | Ga0207706_10030010 | 3300025933 | Bacteria | 4853 |
| 281 | Ga0207706_10054658 | 3300025933 | Bacteria | 3523 |
| 282 | Ga0207706_10071113 | 3300025933 | Bacteria | 3060 |
| 283 | Ga0207706_10081812 | 3300025933 | Bacteria | 2838 |
| 284 | Ga0207706_10083834 | 3300025933 | Bacteria | 2802 |
| 285 | Ga0207706_10089090 | 3300025933 | Bacteria | 2713 |
| 286 | Ga0207706_10243960 | 3300025933 | Bacteria | 1570 |
| 287 | Ga0207706_10476778 | 3300025933 | Bacteria | 1078 |
| 288 | Ga0207670_10241088 | 3300025936 | Bacteria | 1393 |
| 289 | Ga0207669_10040752 | 3300025937 | Bacteria | 2697 |
| 290 | Ga0207669_10083998 | 3300025937 | Bacteria | 2050 |
| 291 | Ga0207669_10145952 | 3300025937 | Unclassified | 1650 |
| 292 | Ga0207691_10020592 | 3300025940 | Bacteria | 6236 |
| 293 | Ga0207691_10034102 | 3300025940 | Bacteria | 4737 |
| 294 | Ga0207691_10053391 | 3300025940 | Bacteria | 3689 |
| 295 | Ga0207691_10917258 | 3300025940 | Bacteria | 733 |
| 296 | Ga0207711_10000123 | 3300025941 | Bacteria | 80861 |
| 297 | Ga0207711_10052077 | 3300025941 | Unclassified | 3507 |
| 298 | Ga0207711_10060642 | 3300025941 | Bacteria | 3260 |
| 299 | Ga0207711_10210852 | 3300025941 | Bacteria | 1774 |
| 300 | Ga0207689_10090153 | 3300025942 | Bacteria | 2519 |
| 301 | Ga0207689_10294449 | 3300025942 | Bacteria | 1345 |
| 302 | Ga0207679_10014539 | 3300025945 | Bacteria | 5179 |
| 303 | Ga0207679_10022504 | 3300025945 | Bacteria | 4294 |
| 304 | Ga0207679_10041173 | 3300025945 | Bacteria | 3311 |
| 305 | Ga0207679_10080448 | 3300025945 | Bacteria | 2488 |
| 306 | Ga0207679_10203144 | 3300025945 | Bacteria | 1657 |
| 307 | Ga0207667_10042495 | 3300025949 | Bacteria | 4830 |
| 308 | Ga0207667_10056214 | 3300025949 | Bacteria | 4135 |
| 309 | Ga0207651_10000258 | 3300025960 | Bacteria | 22795 |
| 310 | Ga0207651_10343595 | 3300025960 | Bacteria | 1254 |
| 311 | Ga0207651_10502044 | 3300025960 | Bacteria | 1049 |
| 312 | Ga0207640_10011228 | 3300025981 | Bacteria | 5067 |
| 313 | Ga0207640_10065127 | 3300025981 | Bacteria | 2430 |
| 314 | Ga0207640_10104068 | 3300025981 | Bacteria | 1997 |
| 315 | Ga0207640_10289255 | 3300025981 | Bacteria | 1291 |
| 316 | Ga0207640_10332765 | 3300025981 | Bacteria | 1214 |
| 317 | Ga0207640_10485470 | 3300025981 | Bacteria | 1026 |
| 318 | Ga0207677_11207029 | 3300026023 | Bacteria | 692 |
| 319 | Ga0207703_10307353 | 3300026035 | Bacteria | 1448 |
| 320 | Ga0207639_10065518 | 3300026041 | Bacteria | 2820 |
| 321 | Ga0207639_10391275 | 3300026041 | Bacteria | 1250 |
| 322 | Ga0207639_10674497 | 3300026041 | Bacteria | 958 |
| 323 | Ga0207639_10702228 | 3300026041 | Bacteria | 938 |
| 324 | Ga0207678_10004043 | 3300026067 | Bacteria | 13193 |
| 325 | Ga0207678_10004189 | 3300026067 | Bacteria | 12946 |
| 326 | Ga0207678_10009292 | 3300026067 | Bacteria | 8653 |
| 327 | Ga0207678_10022133 | 3300026067 | Bacteria | 5569 |
| 328 | Ga0207678_10031276 | 3300026067 | Bacteria | 4643 |
| 329 | Ga0207678_10045005 | 3300026067 | Bacteria | 3816 |
| 330 | Ga0207678_10070423 | 3300026067 | Bacteria | 2999 |
| 331 | Ga0207678_10087283 | 3300026067 | Bacteria | 2666 |
| 332 | Ga0207678_10158576 | 3300026067 | Bacteria | 1932 |
| 333 | Ga0207678_10494079 | 3300026067 | Bacteria | 1066 |
| 334 | Ga0207702_10045166 | 3300026078 | Bacteria | 3706 |
| 335 | Ga0207702_10046685 | 3300026078 | Bacteria | 3646 |
| 336 | Ga0207702_10167227 | 3300026078 | Bacteria | 2013 |
| 337 | Ga0207641_10007293 | 3300026088 | Bacteria | 9214 |
| 338 | Ga0207641_10011929 | 3300026088 | Bacteria | 7130 |
| 339 | Ga0207641_10066568 | 3300026088 | Bacteria | 3083 |
| 340 | Ga0207641_10219091 | 3300026088 | Bacteria | 1764 |
| 341 | Ga0207641_10261252 | 3300026088 | Bacteria | 1621 |
| 342 | Ga0207648_10196580 | 3300026089 | Bacteria | 1788 |
| 343 | Ga0207648_10274322 | 3300026089 | Bacteria | 1507 |
| 344 | Ga0207648_10333654 | 3300026089 | Bacteria | 1364 |
| 345 | Ga0207648_10423326 | 3300026089 | Bacteria | 1209 |
| 346 | Ga0207676_10011451 | 3300026095 | Bacteria | 6339 |
| 347 | Ga0207676_10013343 | 3300026095 | Bacteria | 5902 |
| 348 | Ga0207676_10022532 | 3300026095 | Bacteria | 4633 |
| 349 | Ga0207676_10079155 | 3300026095 | Bacteria | 2664 |
| 350 | Ga0207676_10109591 | 3300026095 | Bacteria | 2307 |
| 351 | Ga0207676_10127926 | 3300026095 | Bacteria | 2155 |
| 352 | Ga0207674_10000742 | 3300026116 | Bacteria | 42731 |
| 353 | Ga0207674_10002644 | 3300026116 | Bacteria | 22388 |
| 354 | Ga0207674_10009197 | 3300026116 | Bacteria | 11325 |
| 355 | Ga0207674_10012020 | 3300026116 | Bacteria | 9699 |
| 356 | Ga0207674_10034906 | 3300026116 | Bacteria | 5252 |
| 357 | Ga0207674_10531686 | 3300026116 | Bacteria | 1136 |
| 358 | Ga0207683_10007506 | 3300026121 | Bacteria | 9350 |
| 359 | Ga0207683_10009904 | 3300026121 | Bacteria | 8127 |
| 360 | Ga0207698_10311958 | 3300026142 | Bacteria | 1469 |
| 361 | Ga0268266_10108797 | 3300028379 | Bacteria | 2453 |
| 362 | Ga0268265_10368543 | 3300028380 | Bacteria | 1317 |
| 363 | Ga0268264_10036103 | 3300028381 | Bacteria | 4069 |
| 364 | Ga0307408_100052894 | 3300031548 | Bacteria | 2931 |
| 365 | Ga0307405_10212389 | 3300031731 | Bacteria | 1414 |
| 366 | Ga0307413_10029918 | 3300031824 | Bacteria | 3054 |
| 367 | Ga0307413_10139340 | 3300031824 | Bacteria | 1673 |
| 368 | Ga0307413_10591715 | 3300031824 | Bacteria | 906 |
| 369 | Ga0307410_10011162 | 3300031852 | Bacteria | 5125 |
| 370 | Ga0307410_10011551 | 3300031852 | Bacteria | 5056 |
| 371 | Ga0307406_10495267 | 3300031901 | Bacteria | 990 |
| 372 | Ga0307406_10641408 | 3300031901 | Bacteria | 880 |
| 373 | Ga0307412_10235139 | 3300031911 | Bacteria | 1413 |
| 374 | Ga0307409_100005232 | 3300031995 | Bacteria | 7436 |
| 375 | Ga0307416_100000663 | 3300032002 | Bacteria | 17833 |
| 376 | Ga0307414_10024190 | 3300032004 | Bacteria | 3868 |
| 377 | Ga0307411_10023247 | 3300032005 | Bacteria | 3668 |
| 378 | Ga0307411_10184143 | 3300032005 | Bacteria | 1588 |
| 379 | Ga0307415_100037869 | 3300032126 | Bacteria | 3173 |
| 380 | Ga0307415_100140339 | 3300032126 | Bacteria | 1844 |
| 381 | Ga0373943_0003327 | 3300035170 | Bacteria | 7303 |
| 382 | Ga0373947_0051941 | 3300035725 | Bacteria | 2468 |
| 383 | Ga0373925_0055913 | 3300037068 | Bacteria | 2955 |
| 384 | Ga0395899_0000511 | 3300037312 | Bacteria | 43020 |
| 385 | Ga0395899_0000618 | 3300037312 | Bacteria | 37007 |
| 386 | Ga0395899_0024786 | 3300037312 | Bacteria | 4533 |
| 387 | Ga0395899_0030551 | 3300037312 | Bacteria | 4051 |
| 388 | Ga0395899_0033119 | 3300037312 | Bacteria | 3882 |
| 389 | Ga0395899_0045921 | 3300037312 | Bacteria | 3254 |
| 390 | Ga0395899_0186260 | 3300037312 | Bacteria | 1454 |
| 391 | Ga0395899_0437160 | 3300037312 | Bacteria | 859 |
| 392 | Ga0395900_0000221 | 3300037418 | Bacteria | 89883 |
| 393 | Ga0395900_0000500 | 3300037418 | Bacteria | 55148 |
| 394 | Ga0395900_0000968 | 3300037418 | Bacteria | 37351 |
| 395 | Ga0395900_0004072 | 3300037418 | Bacteria | 15590 |
| 396 | Ga0395900_0011502 | 3300037418 | Bacteria | 9059 |
| 397 | Ga0395900_0015114 | 3300037418 | Bacteria | 7868 |
| 398 | Ga0395900_0029936 | 3300037418 | Bacteria | 5587 |
| 399 | Ga0395900_0034947 | 3300037418 | Bacteria | 5177 |
| 400 | Ga0395900_0059112 | 3300037418 | Bacteria | 3946 |
| 401 | Ga0395900_0062520 | 3300037418 | Bacteria | 3827 |
| 402 | Ga0395900_0080612 | 3300037418 | Bacteria | 3345 |
| 403 | Ga0395900_0123482 | 3300037418 | Bacteria | 2655 |
| 404 | Ga0395900_0149247 | 3300037418 | Bacteria | 2389 |
| 405 | Ga0395900_0175599 | 3300037418 | Bacteria | 2179 |
| 406 | Ga0395900_0188789 | 3300037418 | Bacteria | 2091 |
| 407 | Ga0395900_0237648 | 3300037418 | Bacteria | 1829 |
| 408 | Ga0395900_0800188 | 3300037418 | Bacteria | 871 |
| 409 | Ga0395898_0000053 | 3300037466 | Bacteria | 279600 |
| 410 | Ga0395898_0001272 | 3300037466 | Bacteria | 37253 |
| 411 | Ga0395898_0018979 | 3300037466 | Bacteria | 7004 |
| 412 | Ga0395898_0023182 | 3300037466 | Bacteria | 6274 |
| 413 | Ga0395898_0039484 | 3300037466 | Bacteria | 4672 |
| 414 | Ga0395898_0074592 | 3300037466 | Bacteria | 3276 |
| 415 | Ga0395898_0110076 | 3300037466 | Bacteria | 2640 |
| 416 | Ga0395898_0470447 | 3300037466 | Bacteria | 1196 |
| 417 | Ga0395898_0618587 | 3300037466 | Bacteria | 1026 |
| 418 | Ga0395898_1040523 | 3300037466 | Bacteria | 753 |
| 419 | Ga0395905_0000031 | 3300037471 | Bacteria | 286757 |
| 420 | Ga0395905_0000735 | 3300037471 | Bacteria | 43152 |
| 421 | Ga0395905_0010337 | 3300037471 | Bacteria | 9083 |
| 422 | Ga0395905_0017950 | 3300037471 | Bacteria | 6719 |
| 423 | Ga0395905_0021814 | 3300037471 | Bacteria | 6057 |
| 424 | Ga0395905_0022657 | 3300037471 | Bacteria | 5938 |
| 425 | Ga0395905_0024415 | 3300037471 | Bacteria | 5705 |
| 426 | Ga0395905_0025362 | 3300037471 | Bacteria | 5591 |
| 427 | Ga0395905_0045903 | 3300037471 | Bacteria | 4098 |
| 428 | Ga0395905_0051594 | 3300037471 | Bacteria | 3853 |
| 429 | Ga0395905_0062849 | 3300037471 | Bacteria | 3473 |
| 430 | Ga0395905_0066518 | 3300037471 | Bacteria | 3375 |
| 431 | Ga0395905_0073352 | 3300037471 | Bacteria | 3208 |
| 432 | Ga0395905_0080406 | 3300037471 | Bacteria | 3054 |
| 433 | Ga0395905_0096896 | 3300037471 | Bacteria | 2769 |
| 434 | Ga0395905_0106812 | 3300037471 | Unclassified | 2628 |
| 435 | Ga0395905_0106954 | 3300037471 | Bacteria | 2626 |
| 436 | Ga0395905_0147569 | 3300037471 | Bacteria | 2213 |
| 437 | Ga0395905_0152004 | 3300037471 | Bacteria | 2177 |
| 438 | Ga0395905_0183655 | 3300037471 | Bacteria | 1963 |
| 439 | Ga0395905_0188236 | 3300037471 | Bacteria | 1937 |
| 440 | Ga0395905_0202428 | 3300037471 | Unclassified | 1861 |
| 441 | Ga0395905_0700145 | 3300037471 | Bacteria | 915 |
| 442 | Ga0395905_0704959 | 3300037471 | Bacteria | 912 |
| 443 | Ga0395905_0945654 | 3300037471 | Bacteria | 765 |
| 444 | Ga0395901_0000163 | 3300038443 | Bacteria | 87103 |
| 445 | Ga0395901_0000459 | 3300038443 | Bacteria | 47200 |
| 446 | Ga0395901_0000469 | 3300038443 | Bacteria | 46905 |
| 447 | Ga0395901_0011842 | 3300038443 | Bacteria | 8842 |
| 448 | Ga0395901_0016131 | 3300038443 | Bacteria | 7609 |
| 449 | Ga0395901_0018026 | 3300038443 | Bacteria | 7206 |
| 450 | Ga0395901_0019807 | 3300038443 | Bacteria | 6881 |
| 451 | Ga0395901_0028609 | 3300038443 | Bacteria | 5731 |
| 452 | Ga0395901_0042301 | 3300038443 | Bacteria | 4723 |
| 453 | Ga0395901_0146042 | 3300038443 | Bacteria | 2486 |
| 454 | Ga0395901_0165209 | 3300038443 | Bacteria | 2324 |
| 455 | Ga0395901_0168187 | 3300038443 | Bacteria | 2301 |
| 456 | Ga0395901_0209680 | 3300038443 | Bacteria | 2040 |
| 457 | Ga0395901_0248439 | 3300038443 | Bacteria | 1854 |
| 458 | Ga0395901_0254944 | 3300038443 | Bacteria | 1827 |
| 459 | Ga0395901_0322659 | 3300038443 | Bacteria | 1597 |
| 460 | Ga0395901_0340506 | 3300038443 | Bacteria | 1549 |
| 461 | Ga0395901_0508662 | 3300038443 | Bacteria | 1225 |
| 462 | Ga0395901_1194432 | 3300038443 | Bacteria | 727 |
| 463 | Ga0436365_0822316 | 3300039437 | Bacteria | 19672 |
| 464 | Ga0439448_0034143 | 3300042005 | Bacteria | 1624 |
| 465 | Ga0439432_010307 | 3300042006 | Bacteria | 3241 |
| 466 | Ga0439449_0027842 | 3300042007 | Bacteria | 2108 |
| 467 | Ga0450898_019110 | 3300042134 | Bacteria | 1192 |
| 468 | Ga0439458_0000459 | 3300042157 | Bacteria | 10339 |
| 469 | Ga0439458_0002234 | 3300042157 | Bacteria | 4775 |
| 470 | Ga0439458_0032083 | 3300042157 | Bacteria | 1254 |
| 471 | Ga0466969_0015202 | 3300044656 | Bacteria | 4035 |
| 472 | Ga0466972_0099050 | 3300044658 | Bacteria | 1380 |
| 473 | Ga0466965_0033609 | 3300044683 | Bacteria | 2507 |
| 474 | Ga0466966_0000040 | 3300044684 | Bacteria | 97159 |
| 475 | Ga0466966_0007349 | 3300044684 | Bacteria | 7305 |
| 476 | Ga0466966_0158666 | 3300044684 | Bacteria | 1378 |
| 477 | Ga0466963_0021233 | 3300044694 | Bacteria | 4093 |
| 478 | Ga0466963_0021574 | 3300044694 | Bacteria | 4066 |
| 479 | Ga0466963_0023497 | 3300044694 | Bacteria | 3916 |
| 480 | Ga0466963_0051083 | 3300044694 | Bacteria | 2739 |
| 481 | Ga0466963_0223167 | 3300044694 | Bacteria | 1320 |
| 482 | Ga0466963_0298468 | 3300044694 | Bacteria | 1133 |
| 483 | Ga0466963_0368676 | 3300044694 | Bacteria | 1012 |
| 484 | Ga0466963_0663528 | 3300044694 | Bacteria | 736 |
| 485 | Ga0466964_0042579 | 3300044706 | Bacteria | 1840 |
| 486 | Ga0466964_0045328 | 3300044706 | Bacteria | 1789 |
| 487 | Ga0466964_0322721 | 3300044706 | Bacteria | 785 |
| 488 | Ga0466971_0005763 | 3300044719 | Bacteria | 5386 |
| 489 | Ga0466971_0115878 | 3300044719 | Bacteria | 1239 |
| 490 | Ga0466968_0006589 | 3300044735 | Bacteria | 4382 |
| 491 | Ga0466970_0024472 | 3300044765 | Bacteria | 3158 |
| 492 | Ga0466970_0063447 | 3300044765 | Bacteria | 1980 |
| 493 | Ga0466957_0009281 | 3300044842 | Bacteria | 5612 |
| 494 | Ga0466957_0050735 | 3300044842 | Bacteria | 2525 |
| 495 | Ga0466957_0093994 | 3300044842 | Bacteria | 1882 |
| 496 | Ga0466957_0095946 | 3300044842 | Bacteria | 1863 |
| 497 | Ga0466959_0072714 | 3300045049 | Bacteria | 2488 |
| 498 | Ga0466959_0082185 | 3300045049 | Bacteria | 2321 |
| 499 | Ga0466959_0102031 | 3300045049 | Bacteria | 2053 |
| 500 | Ga0466959_0214819 | 3300045049 | Bacteria | 1335 |
| 501 | Ga0466958_0041878 | 3300045836 | Bacteria | 2756 |
| 502 | Ga0466958_0049557 | 3300045836 | Bacteria | 2541 |
| 503 | Ga0466958_0079367 | 3300045836 | Bacteria | 2018 |
| 504 | Ga0466958_0198870 | 3300045836 | Bacteria | 1275 |
| 505 | Ga0466967_0016947 | 3300045976 | Bacteria | 5763 |
| 506 | Ga0466967_0028204 | 3300045976 | Bacteria | 4684 |
| 507 | Ga0466967_0041010 | 3300045976 | Bacteria | 3988 |
| 508 | Ga0466967_0050456 | 3300045976 | Bacteria | 3643 |
| 509 | Ga0466967_0072749 | 3300045976 | Bacteria | 3082 |
| 510 | Ga0466967_0082075 | 3300045976 | Bacteria | 2912 |
| 511 | Ga0466967_0157962 | 3300045976 | Bacteria | 2126 |
| 512 | Ga0466967_0403035 | 3300045976 | Bacteria | 1331 |
| 513 | Ga0466967_0513291 | 3300045976 | Bacteria | 1177 |
| 514 | Ga0466967_0950602 | 3300045976 | Bacteria | 855 |
| 515 | Ga0495663_0014977 | 3300046525 | Bacteria | 2181 |
| 516 | Ga0495663_0072875 | 3300046525 | Bacteria | 1096 |
| 517 | Ga0495669_0006784 | 3300046684 | Bacteria | 4791 |
| 518 | Ga0495677_0012201 | 3300047445 | Bacteria | 3136 |
| 519 | Ga0495677_0073677 | 3300047445 | Bacteria | 1274 |
| 520 | Ga0496100_0010059 | 3300048903 | Bacteria | 5346 |
| 521 | Ga0496100_0334487 | 3300048903 | Unclassified | 1140 |
| 522 | Ga0496101_0013569 | 3300048904 | Bacteria | 5463 |
| 523 | Ga0496101_0035442 | 3300048904 | Bacteria | 3529 |
| 524 | Ga0496102_0045755 | 3300048905 | Bacteria | 3973 |
| 525 | Ga0496103_0109966 | 3300048906 | Bacteria | 1750 |
| 526 | Ga0496104_0054465 | 3300048907 | Bacteria | 3781 |
| 527 | Ga0496105_0027615 | 3300048908 | Bacteria | 4639 |
| 528 | Ga0496105_0159157 | 3300048908 | Bacteria | 1854 |
| 529 | Ga0496106_0018119 | 3300048909 | Bacteria | 5207 |
| 530 | Ga0496106_0168887 | 3300048909 | Bacteria | 1733 |
| 531 | Ga0496107_0026049 | 3300048910 | Bacteria | 4144 |
| 532 | Ga0496107_0063821 | 3300048910 | Bacteria | 2669 |
| 533 | Ga0496107_0238067 | 3300048910 | Bacteria | 1354 |
| 534 | Ga0496108_0021534 | 3300048911 | Bacteria | 5297 |
| 535 | Ga0496108_0023791 | 3300048911 | Bacteria | 5041 |
| 536 | Ga0496109_0000584 | 3300048912 | Bacteria | 30505 |
| 537 | Ga0496109_0001226 | 3300048912 | Bacteria | 21305 |
| 538 | Ga0496109_0003874 | 3300048912 | Bacteria | 12496 |
| 539 | Ga0496109_0044034 | 3300048912 | Bacteria | 4047 |
| 540 | Ga0496109_0223369 | 3300048912 | Unclassified | 1771 |
| 541 | Ga0496109_0287808 | 3300048912 | Bacteria | 1549 |
| 542 | Ga0496110_0000437 | 3300048913 | Bacteria | 28365 |
| 543 | Ga0496110_0011575 | 3300048913 | Bacteria | 7230 |
| 544 | Ga0496110_0033525 | 3300048913 | Bacteria | 4442 |
| 545 | Ga0496110_0057646 | 3300048913 | Bacteria | 3419 |
| 546 | Ga0496110_0795116 | 3300048913 | Bacteria | 850 |
| 547 | Ga0496111_0003375 | 3300048914 | Bacteria | 9872 |
| 548 | Ga0496111_0003969 | 3300048914 | Bacteria | 9284 |
| 549 | Ga0496111_0009813 | 3300048914 | Bacteria | 6399 |
| 550 | Ga0496111_0026261 | 3300048914 | Bacteria | 4111 |
| 551 | Ga0496111_0050178 | 3300048914 | Bacteria | 3009 |
| 552 | Ga0496112_0021772 | 3300048915 | Bacteria | 6099 |
| 553 | Ga0496112_0036668 | 3300048915 | Bacteria | 4783 |
| 554 | Ga0496112_0036799 | 3300048915 | Bacteria | 4775 |
| 555 | Ga0496113_0005531 | 3300048916 | Bacteria | 7888 |
| 556 | Ga0496113_0017037 | 3300048916 | Bacteria | 5034 |
| 557 | Ga0496113_0034688 | 3300048916 | Bacteria | 3683 |
| 558 | Ga0496114_0121402 | 3300048917 | Bacteria | 2247 |
| 559 | Ga0496115_0094388 | 3300048918 | Bacteria | 2447 |
| 560 | Ga0501199_021420 | 3300049650 | Bacteria | 753 |
| 561 | Ga0501202_060838 | 3300049652 | Bacteria | 853 |
| 562 | Ga0501223_030197 | 3300049663 | Bacteria | 1054 |
| 563 | Ga0501227_070897 | 3300049665 | Bacteria | 904 |
| 564 | Ga0501262_001919 | 3300049759 | Bacteria | 2340 |
| 565 | Ga0501270_021667 | 3300049767 | Bacteria | 985 |
| 566 | nmdc:mga00v17_202506_c1 | 3300050491 | Bacteria | 1283 |
| 567 | nmdc:mga0k408_76482_c1 | 3300050493 | Bacteria | 1956 |
| 568 | Ga0466962_0010311 | 3300061719 | Bacteria | 4488 |
| 569 | Ga0466962_0116593 | 3300061719 | Bacteria | 1287 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_10016702 | Ga0105248_100167024 | 182 |
| 2 | 3300005719 | Ga0068861_100637657 | Ga0068861_1006376572 | 193 |
| 3 | 3300042157 | Ga0439458_0032083 | Ga0439458_0032083_30_668 | 193 |
| 4 | 3300005614 | Ga0068856_100368346 | Ga0068856_1003683462 | 194 |
| 5 | 3300037418 | Ga0395900_0004072 | Ga0395900_0004072_8934_9569 | 195 |
| 6 | 3300038443 | Ga0395901_0000459 | Ga0395901_0000459_39987_40622 | 195 |
| 7 | 3300037312 | Ga0395899_0045921 | Ga0395899_0045921_201_839 | 197 |
| 8 | 3300037418 | Ga0395900_0011502 | Ga0395900_0011502_5543_6181 | 197 |
| 9 | 3300037466 | Ga0395898_1040523 | Ga0395898_1040523_25_663 | 197 |
| 10 | 3300037471 | Ga0395905_0022657 | Ga0395905_0022657_1221_1859 | 197 |
| 11 | 3300038443 | Ga0395901_0508662 | Ga0395901_0508662_229_867 | 197 |
| 12 | 3300031824 | Ga0307413_10139340 | Ga0307413_101393402 | 198 |
| 13 | 3300031911 | Ga0307412_10235139 | Ga0307412_102351392 | 198 |
| 14 | 3300032002 | Ga0307416_100000663 | Ga0307416_1000006632 | 198 |
| 15 | 3300032126 | Ga0307415_100037869 | Ga0307415_1000378692 | 198 |
| 16 | 3300042006 | Ga0439432_010307 | Ga0439432_010307_685_1323 | 198 |
| 17 | 3300042007 | Ga0439449_0027842 | Ga0439449_0027842_1227_1865 | 198 |
| 18 | 3300042134 | Ga0450898_019110 | Ga0450898_019110_443_1081 | 198 |
| 19 | 3300049650 | Ga0501199_021420 | Ga0501199_021420_61_699 | 198 |
| 20 | 3300049652 | Ga0501202_060838 | Ga0501202_060838_70_708 | 198 |
| 21 | 3300049663 | Ga0501223_030197 | Ga0501223_030197_238_876 | 198 |
| 22 | 3300049665 | Ga0501227_070897 | Ga0501227_070897_227_865 | 198 |
| 23 | 3300049759 | Ga0501262_001919 | Ga0501262_001919_1487_2125 | 198 |
| 24 | 3300049767 | Ga0501270_021667 | Ga0501270_021667_316_954 | 198 |
| 25 | 3300037312 | Ga0395899_0030551 | Ga0395899_0030551_2821_3435 | 201 |
| 26 | 3300037418 | Ga0395900_0123482 | Ga0395900_0123482_773_1387 | 201 |
| 27 | 3300037466 | Ga0395898_0110076 | Ga0395898_0110076_773_1387 | 201 |
| 28 | 3300037471 | Ga0395905_0152004 | Ga0395905_0152004_1127_1741 | 201 |
| 29 | 3300038443 | Ga0395901_0322659 | Ga0395901_0322659_758_1372 | 201 |
| 30 | 3300048913 | Ga0496110_0033525 | Ga0496110_0033525_1336_1980 | 203 |
| 31 | 3300048908 | Ga0496105_0159157 | Ga0496105_0159157_27_650 | 204 |
| 32 | 3300001990 | JGI24737J22298_10013283 | JGI24737J22298_100132834 | 205 |
| 33 | 3300044684 | Ga0466966_0000040 | Ga0466966_0000040_7571_8197 | 205 |
| 34 | 3300044694 | Ga0466963_0663528 | Ga0466963_0663528_43_669 | 205 |
| 35 | 3300045836 | Ga0466958_0198870 | Ga0466958_0198870_76_702 | 205 |
| 36 | 3300048904 | Ga0496101_0013569 | Ga0496101_0013569_4825_5451 | 205 |
| 37 | 3300048906 | Ga0496103_0109966 | Ga0496103_0109966_104_730 | 205 |
| 38 | 3300002067 | JGI24735J21928_10055577 | JGI24735J21928_100555771 | 207 |
| 39 | 3300005339 | Ga0070660_100135342 | Ga0070660_1001353422 | 207 |
| 40 | 3300005457 | Ga0070662_100048600 | Ga0070662_1000486002 | 207 |
| 41 | 3300005578 | Ga0068854_100564757 | Ga0068854_1005647571 | 207 |
| 42 | 3300025919 | Ga0207657_10246610 | Ga0207657_102466102 | 207 |
| 43 | 3300025932 | Ga0207690_10011515 | Ga0207690_100115152 | 207 |
| 44 | 3300025933 | Ga0207706_10081812 | Ga0207706_100818122 | 207 |
| 45 | 3300025937 | Ga0207669_10083998 | Ga0207669_100839982 | 207 |
| 46 | 3300025981 | Ga0207640_10485470 | Ga0207640_104854702 | 207 |
| 47 | 3300050493 | nmdc:mga0k408_76482_c1 | nmdc:mga0k408_76482_c1_449_1081 | 207 |
| 48 | 3300001990 | JGI24737J22298_10006447 | JGI24737J22298_100064472 | 208 |
| 49 | 3300002075 | JGI24738J21930_10056425 | JGI24738J21930_100564251 | 208 |
| 50 | 3300005331 | Ga0070670_100013322 | Ga0070670_1000133223 | 208 |
| 51 | 3300005331 | Ga0070670_100031031 | Ga0070670_1000310313 | 208 |
| 52 | 3300005335 | Ga0070666_10003825 | Ga0070666_100038254 | 208 |
| 53 | 3300005355 | Ga0070671_100028204 | Ga0070671_1000282042 | 208 |
| 54 | 3300005355 | Ga0070671_100226948 | Ga0070671_1002269482 | 208 |
| 55 | 3300005356 | Ga0070674_100037296 | Ga0070674_1000372962 | 208 |
| 56 | 3300005364 | Ga0070673_100003023 | Ga0070673_1000030234 | 208 |
| 57 | 3300005366 | Ga0070659_100060415 | Ga0070659_1000604152 | 208 |
| 58 | 3300005367 | Ga0070667_100016340 | Ga0070667_1000163406 | 208 |
| 59 | 3300005455 | Ga0070663_100110161 | Ga0070663_1001101612 | 208 |
| 60 | 3300005455 | Ga0070663_100490480 | Ga0070663_1004904802 | 208 |
| 61 | 3300005456 | Ga0070678_100003317 | Ga0070678_1000033174 | 208 |
| 62 | 3300005456 | Ga0070678_100434170 | Ga0070678_1004341701 | 208 |
| 63 | 3300005457 | Ga0070662_100018836 | Ga0070662_1000188362 | 208 |
| 64 | 3300005466 | Ga0070685_10149712 | Ga0070685_101497122 | 208 |
| 65 | 3300005543 | Ga0070672_100028198 | Ga0070672_1000281983 | 208 |
| 66 | 3300005564 | Ga0070664_100035856 | Ga0070664_1000358562 | 208 |
| 67 | 3300005577 | Ga0068857_100021464 | Ga0068857_1000214642 | 208 |
| 68 | 3300005616 | Ga0068852_100533777 | Ga0068852_1005337772 | 208 |
| 69 | 3300005617 | Ga0068859_100108957 | Ga0068859_1001089573 | 208 |
| 70 | 3300005618 | Ga0068864_100004864 | Ga0068864_1000048643 | 208 |
| 71 | 3300005841 | Ga0068863_100011912 | Ga0068863_1000119123 | 208 |
| 72 | 3300005841 | Ga0068863_100013285 | Ga0068863_1000132854 | 208 |
| 73 | 3300005842 | Ga0068858_100008769 | Ga0068858_1000087694 | 208 |
| 74 | 3300006051 | Ga0075364_10221870 | Ga0075364_102218702 | 208 |
| 75 | 3300006358 | Ga0068871_100048304 | Ga0068871_1000483044 | 208 |
| 76 | 3300006931 | Ga0097620_100108960 | Ga0097620_1001089603 | 208 |
| 77 | 3300009177 | Ga0105248_10032724 | Ga0105248_100327244 | 208 |
| 78 | 3300013104 | Ga0157370_10003707 | Ga0157370_100037073 | 208 |
| 79 | 3300013296 | Ga0157374_10010749 | Ga0157374_100107494 | 208 |
| 80 | 3300013306 | Ga0163162_10010545 | Ga0163162_100105454 | 208 |
| 81 | 3300013308 | Ga0157375_10010265 | Ga0157375_100102653 | 208 |
| 82 | 3300014325 | Ga0163163_10028711 | Ga0163163_100287113 | 208 |
| 83 | 3300014325 | Ga0163163_10147460 | Ga0163163_101474602 | 208 |
| 84 | 3300025903 | Ga0207680_10006720 | Ga0207680_100067203 | 208 |
| 85 | 3300025909 | Ga0207705_10097861 | Ga0207705_100978612 | 208 |
| 86 | 3300025911 | Ga0207654_10636175 | Ga0207654_106361752 | 208 |
| 87 | 3300025919 | Ga0207657_10019447 | Ga0207657_100194472 | 208 |
| 88 | 3300025920 | Ga0207649_10016768 | Ga0207649_100167682 | 208 |
| 89 | 3300025920 | Ga0207649_10806246 | Ga0207649_108062461 | 208 |
| 90 | 3300025925 | Ga0207650_10084981 | Ga0207650_100849812 | 208 |
| 91 | 3300025931 | Ga0207644_10010230 | Ga0207644_100102302 | 208 |
| 92 | 3300025932 | Ga0207690_10080159 | Ga0207690_100801592 | 208 |
| 93 | 3300025933 | Ga0207706_10026200 | Ga0207706_100262003 | 208 |
| 94 | 3300025937 | Ga0207669_10145952 | Ga0207669_101459522 | 208 |
| 95 | 3300025940 | Ga0207691_10034102 | Ga0207691_100341023 | 208 |
| 96 | 3300025941 | Ga0207711_10052077 | Ga0207711_100520772 | 208 |
| 97 | 3300025941 | Ga0207711_10060642 | Ga0207711_100606422 | 208 |
| 98 | 3300025960 | Ga0207651_10000258 | Ga0207651_1000025820 | 208 |
| 99 | 3300026041 | Ga0207639_10674497 | Ga0207639_106744971 | 208 |
| 100 | 3300026067 | Ga0207678_10009292 | Ga0207678_100092927 | 208 |
| 101 | 3300026088 | Ga0207641_10007293 | Ga0207641_100072933 | 208 |
| 102 | 3300026095 | Ga0207676_10127926 | Ga0207676_101279262 | 208 |
| 103 | 3300026116 | Ga0207674_10012020 | Ga0207674_100120203 | 208 |
| 104 | 3300026121 | Ga0207683_10007506 | Ga0207683_100075063 | 208 |
| 105 | 3300026142 | Ga0207698_10311958 | Ga0207698_103119581 | 208 |
| 106 | 3300037312 | Ga0395899_0024786 | Ga0395899_0024786_1952_2587 | 208 |
| 107 | 3300037312 | Ga0395899_0186260 | Ga0395899_0186260_37_672 | 208 |
| 108 | 3300037418 | Ga0395900_0000968 | Ga0395900_0000968_6504_7139 | 208 |
| 109 | 3300037418 | Ga0395900_0062520 | Ga0395900_0062520_1252_1890 | 208 |
| 110 | 3300037418 | Ga0395900_0149247 | Ga0395900_0149247_475_1110 | 208 |
| 111 | 3300037418 | Ga0395900_0175599 | Ga0395900_0175599_222_854 | 208 |
| 112 | 3300037418 | Ga0395900_0188789 | Ga0395900_0188789_1167_1799 | 208 |
| 113 | 3300037466 | Ga0395898_0023182 | Ga0395898_0023182_4957_5592 | 208 |
| 114 | 3300037471 | Ga0395905_0000735 | Ga0395905_0000735_9673_10308 | 208 |
| 115 | 3300037471 | Ga0395905_0010337 | Ga0395905_0010337_3042_3677 | 208 |
| 116 | 3300037471 | Ga0395905_0051594 | Ga0395905_0051594_3081_3713 | 208 |
| 117 | 3300037471 | Ga0395905_0062849 | Ga0395905_0062849_45_680 | 208 |
| 118 | 3300037471 | Ga0395905_0106812 | Ga0395905_0106812_766_1401 | 208 |
| 119 | 3300037471 | Ga0395905_0106954 | Ga0395905_0106954_395_1033 | 208 |
| 120 | 3300037471 | Ga0395905_0188236 | Ga0395905_0188236_1087_1722 | 208 |
| 121 | 3300037471 | Ga0395905_0202428 | Ga0395905_0202428_537_1169 | 208 |
| 122 | 3300038443 | Ga0395901_0011842 | Ga0395901_0011842_2359_2994 | 208 |
| 123 | 3300038443 | Ga0395901_0042301 | Ga0395901_0042301_1350_1988 | 208 |
| 124 | 3300038443 | Ga0395901_0146042 | Ga0395901_0146042_141_773 | 208 |
| 125 | 3300038443 | Ga0395901_0165209 | Ga0395901_0165209_1131_1766 | 208 |
| 126 | 3300038443 | Ga0395901_0168187 | Ga0395901_0168187_542_1174 | 208 |
| 127 | 3300042157 | Ga0439458_0002234 | Ga0439458_0002234_109_741 | 208 |
| 128 | 3300044658 | Ga0466972_0099050 | Ga0466972_0099050_725_1360 | 208 |
| 129 | 3300044683 | Ga0466965_0033609 | Ga0466965_0033609_1564_2199 | 208 |
| 130 | 3300044684 | Ga0466966_0158666 | Ga0466966_0158666_624_1259 | 208 |
| 131 | 3300044694 | Ga0466963_0021233 | Ga0466963_0021233_2969_3604 | 208 |
| 132 | 3300044694 | Ga0466963_0023497 | Ga0466963_0023497_2966_3601 | 208 |
| 133 | 3300044694 | Ga0466963_0051083 | Ga0466963_0051083_1905_2540 | 208 |
| 134 | 3300044706 | Ga0466964_0042579 | Ga0466964_0042579_291_926 | 208 |
| 135 | 3300044706 | Ga0466964_0045328 | Ga0466964_0045328_495_1130 | 208 |
| 136 | 3300044719 | Ga0466971_0005763 | Ga0466971_0005763_1743_2378 | 208 |
| 137 | 3300044735 | Ga0466968_0006589 | Ga0466968_0006589_2701_3336 | 208 |
| 138 | 3300044765 | Ga0466970_0063447 | Ga0466970_0063447_832_1467 | 208 |
| 139 | 3300044842 | Ga0466957_0009281 | Ga0466957_0009281_2759_3394 | 208 |
| 140 | 3300044842 | Ga0466957_0050735 | Ga0466957_0050735_1769_2404 | 208 |
| 141 | 3300044842 | Ga0466957_0095946 | Ga0466957_0095946_44_679 | 208 |
| 142 | 3300045049 | Ga0466959_0072714 | Ga0466959_0072714_864_1499 | 208 |
| 143 | 3300045049 | Ga0466959_0102031 | Ga0466959_0102031_434_1069 | 208 |
| 144 | 3300045049 | Ga0466959_0214819 | Ga0466959_0214819_32_667 | 208 |
| 145 | 3300045836 | Ga0466958_0041878 | Ga0466958_0041878_1069_1704 | 208 |
| 146 | 3300045836 | Ga0466958_0049557 | Ga0466958_0049557_435_1070 | 208 |
| 147 | 3300045976 | Ga0466967_0016947 | Ga0466967_0016947_4577_5212 | 208 |
| 148 | 3300045976 | Ga0466967_0028204 | Ga0466967_0028204_2048_2683 | 208 |
| 149 | 3300045976 | Ga0466967_0072749 | Ga0466967_0072749_2353_2988 | 208 |
| 150 | 3300045976 | Ga0466967_0403035 | Ga0466967_0403035_622_1257 | 208 |
| 151 | 3300045976 | Ga0466967_0950602 | Ga0466967_0950602_77_712 | 208 |
| 152 | 3300047445 | Ga0495677_0073677 | Ga0495677_0073677_454_1095 | 208 |
| 153 | 3300048903 | Ga0496100_0334487 | Ga0496100_0334487_91_726 | 208 |
| 154 | 3300048904 | Ga0496101_0035442 | Ga0496101_0035442_410_1045 | 208 |
| 155 | 3300048909 | Ga0496106_0168887 | Ga0496106_0168887_19_654 | 208 |
| 156 | 3300048910 | Ga0496107_0026049 | Ga0496107_0026049_907_1542 | 208 |
| 157 | 3300048912 | Ga0496109_0000584 | Ga0496109_0000584_15669_16304 | 208 |
| 158 | 3300048913 | Ga0496110_0000437 | Ga0496110_0000437_3395_4030 | 208 |
| 159 | 3300048914 | Ga0496111_0026261 | Ga0496111_0026261_991_1626 | 208 |
| 160 | 3300048916 | Ga0496113_0017037 | Ga0496113_0017037_3371_4006 | 208 |
| 161 | 3300048917 | Ga0496114_0121402 | Ga0496114_0121402_1519_2154 | 208 |
| 162 | 3300048918 | Ga0496115_0094388 | Ga0496115_0094388_103_738 | 208 |
| 163 | 3300050491 | nmdc:mga00v17_202506_c1 | nmdc:mga00v17_202506_c1_350_985 | 208 |
| 164 | 3300061719 | Ga0466962_0010311 | Ga0466962_0010311_809_1444 | 208 |
| 165 | 3300001915 | JGI24741J21665_1001649 | JGI24741J21665_10016492 | 209 |
| 166 | 3300001976 | JGI24752J21851_1002861 | JGI24752J21851_10028612 | 209 |
| 167 | 3300001979 | JGI24740J21852_10001800 | JGI24740J21852_100018002 | 209 |
| 168 | 3300001979 | JGI24740J21852_10004494 | JGI24740J21852_100044942 | 209 |
| 169 | 3300001989 | JGI24739J22299_10005084 | JGI24739J22299_100050842 | 209 |
| 170 | 3300001989 | JGI24739J22299_10015730 | JGI24739J22299_100157302 | 209 |
| 171 | 3300001990 | JGI24737J22298_10024725 | JGI24737J22298_100247252 | 209 |
| 172 | 3300002067 | JGI24735J21928_10004612 | JGI24735J21928_100046122 | 209 |
| 173 | 3300005327 | Ga0070658_10020495 | Ga0070658_100204952 | 209 |
| 174 | 3300005327 | Ga0070658_10037980 | Ga0070658_100379804 | 209 |
| 175 | 3300005327 | Ga0070658_10072079 | Ga0070658_100720792 | 209 |
| 176 | 3300005327 | Ga0070658_10120228 | Ga0070658_101202282 | 209 |
| 177 | 3300005327 | Ga0070658_10600874 | Ga0070658_106008742 | 209 |
| 178 | 3300005328 | Ga0070676_10124561 | Ga0070676_101245612 | 209 |
| 179 | 3300005328 | Ga0070676_10154085 | Ga0070676_101540852 | 209 |
| 180 | 3300005329 | Ga0070683_100127607 | Ga0070683_1001276072 | 209 |
| 181 | 3300005331 | Ga0070670_100012741 | Ga0070670_1000127412 | 209 |
| 182 | 3300005331 | Ga0070670_100022974 | Ga0070670_1000229742 | 209 |
| 183 | 3300005331 | Ga0070670_100144982 | Ga0070670_1001449822 | 209 |
| 184 | 3300005334 | Ga0068869_100095623 | Ga0068869_1000956232 | 209 |
| 185 | 3300005335 | Ga0070666_10002484 | Ga0070666_100024842 | 209 |
| 186 | 3300005336 | Ga0070680_100009425 | Ga0070680_1000094256 | 209 |
| 187 | 3300005336 | Ga0070680_100021449 | Ga0070680_1000214497 | 209 |
| 188 | 3300005337 | Ga0070682_100129368 | Ga0070682_1001293682 | 209 |
| 189 | 3300005337 | Ga0070682_100324552 | Ga0070682_1003245521 | 209 |
| 190 | 3300005339 | Ga0070660_100071203 | Ga0070660_1000712032 | 209 |
| 191 | 3300005339 | Ga0070660_100215509 | Ga0070660_1002155092 | 209 |
| 192 | 3300005339 | Ga0070660_100571181 | Ga0070660_1005711811 | 209 |
| 193 | 3300005340 | Ga0070689_100168856 | Ga0070689_1001688562 | 209 |
| 194 | 3300005344 | Ga0070661_100006820 | Ga0070661_1000068205 | 209 |
| 195 | 3300005344 | Ga0070661_100009255 | Ga0070661_1000092552 | 209 |
| 196 | 3300005344 | Ga0070661_100009799 | Ga0070661_1000097996 | 209 |
| 197 | 3300005344 | Ga0070661_100012903 | Ga0070661_1000129033 | 209 |
| 198 | 3300005344 | Ga0070661_100057260 | Ga0070661_1000572602 | 209 |
| 199 | 3300005344 | Ga0070661_100060912 | Ga0070661_1000609123 | 209 |
| 200 | 3300005344 | Ga0070661_100109117 | Ga0070661_1001091172 | 209 |
| 201 | 3300005344 | Ga0070661_100153169 | Ga0070661_1001531692 | 209 |
| 202 | 3300005345 | Ga0070692_10019592 | Ga0070692_100195922 | 209 |
| 203 | 3300005345 | Ga0070692_10170207 | Ga0070692_101702072 | 209 |
| 204 | 3300005347 | Ga0070668_100432451 | Ga0070668_1004324512 | 209 |
| 205 | 3300005353 | Ga0070669_100018435 | Ga0070669_1000184353 | 209 |
| 206 | 3300005354 | Ga0070675_100026132 | Ga0070675_1000261323 | 209 |
| 207 | 3300005355 | Ga0070671_100010425 | Ga0070671_1000104256 | 209 |
| 208 | 3300005355 | Ga0070671_100011569 | Ga0070671_1000115694 | 209 |
| 209 | 3300005355 | Ga0070671_100020173 | Ga0070671_1000201732 | 209 |
| 210 | 3300005355 | Ga0070671_100157162 | Ga0070671_1001571622 | 209 |
| 211 | 3300005355 | Ga0070671_100247945 | Ga0070671_1002479452 | 209 |
| 212 | 3300005356 | Ga0070674_100029612 | Ga0070674_1000296121 | 209 |
| 213 | 3300005364 | Ga0070673_100014790 | Ga0070673_1000147903 | 209 |
| 214 | 3300005366 | Ga0070659_100064693 | Ga0070659_1000646932 | 209 |
| 215 | 3300005366 | Ga0070659_100136441 | Ga0070659_1001364412 | 209 |
| 216 | 3300005366 | Ga0070659_100161183 | Ga0070659_1001611832 | 209 |
| 217 | 3300005366 | Ga0070659_100328602 | Ga0070659_1003286022 | 209 |
| 218 | 3300005366 | Ga0070659_100536923 | Ga0070659_1005369232 | 209 |
| 219 | 3300005366 | Ga0070659_100768491 | Ga0070659_1007684911 | 209 |
| 220 | 3300005367 | Ga0070667_100012824 | Ga0070667_1000128243 | 209 |
| 221 | 3300005435 | Ga0070714_100015580 | Ga0070714_1000155807 | 209 |
| 222 | 3300005435 | Ga0070714_100262801 | Ga0070714_1002628012 | 209 |
| 223 | 3300005436 | Ga0070713_100177911 | Ga0070713_1001779112 | 209 |
| 224 | 3300005455 | Ga0070663_100011073 | Ga0070663_1000110732 | 209 |
| 225 | 3300005455 | Ga0070663_100034062 | Ga0070663_1000340622 | 209 |
| 226 | 3300005455 | Ga0070663_100037027 | Ga0070663_1000370272 | 209 |
| 227 | 3300005455 | Ga0070663_100043731 | Ga0070663_1000437312 | 209 |
| 228 | 3300005455 | Ga0070663_100121757 | Ga0070663_1001217572 | 209 |
| 229 | 3300005455 | Ga0070663_100157882 | Ga0070663_1001578822 | 209 |
| 230 | 3300005456 | Ga0070678_100004428 | Ga0070678_1000044285 | 209 |
| 231 | 3300005457 | Ga0070662_100014950 | Ga0070662_1000149502 | 209 |
| 232 | 3300005457 | Ga0070662_100017613 | Ga0070662_1000176134 | 209 |
| 233 | 3300005457 | Ga0070662_100051225 | Ga0070662_1000512254 | 209 |
| 234 | 3300005457 | Ga0070662_100098668 | Ga0070662_1000986683 | 209 |
| 235 | 3300005457 | Ga0070662_100146183 | Ga0070662_1001461832 | 209 |
| 236 | 3300005457 | Ga0070662_100201427 | Ga0070662_1002014272 | 209 |
| 237 | 3300005457 | Ga0070662_100411777 | Ga0070662_1004117772 | 209 |
| 238 | 3300005457 | Ga0070662_100448726 | Ga0070662_1004487261 | 209 |
| 239 | 3300005458 | Ga0070681_10073734 | Ga0070681_100737341 | 209 |
| 240 | 3300005458 | Ga0070681_10181212 | Ga0070681_101812122 | 209 |
| 241 | 3300005458 | Ga0070681_11060092 | Ga0070681_110600921 | 209 |
| 242 | 3300005459 | Ga0068867_100100887 | Ga0068867_1001008873 | 209 |
| 243 | 3300005459 | Ga0068867_100327080 | Ga0068867_1003270802 | 209 |
| 244 | 3300005530 | Ga0070679_100041792 | Ga0070679_1000417922 | 209 |
| 245 | 3300005530 | Ga0070679_100125538 | Ga0070679_1001255382 | 209 |
| 246 | 3300005530 | Ga0070679_100254041 | Ga0070679_1002540412 | 209 |
| 247 | 3300005535 | Ga0070684_100207329 | Ga0070684_1002073292 | 209 |
| 248 | 3300005535 | Ga0070684_100870474 | Ga0070684_1008704742 | 209 |
| 249 | 3300005539 | Ga0068853_100033047 | Ga0068853_1000330472 | 209 |
| 250 | 3300005539 | Ga0068853_100213421 | Ga0068853_1002134212 | 209 |
| 251 | 3300005543 | Ga0070672_100024264 | Ga0070672_1000242645 | 209 |
| 252 | 3300005543 | Ga0070672_100045534 | Ga0070672_1000455341 | 209 |
| 253 | 3300005546 | Ga0070696_100061552 | Ga0070696_1000615523 | 209 |
| 254 | 3300005546 | Ga0070696_100116734 | Ga0070696_1001167342 | 209 |
| 255 | 3300005547 | Ga0070693_100106824 | Ga0070693_1001068241 | 209 |
| 256 | 3300005547 | Ga0070693_100117425 | Ga0070693_1001174252 | 209 |
| 257 | 3300005548 | Ga0070665_100008070 | Ga0070665_1000080708 | 209 |
| 258 | 3300005563 | Ga0068855_100009828 | Ga0068855_1000098288 | 209 |
| 259 | 3300005563 | Ga0068855_100115659 | Ga0068855_1001156592 | 209 |
| 260 | 3300005563 | Ga0068855_100718810 | Ga0068855_1007188101 | 209 |
| 261 | 3300005564 | Ga0070664_100005597 | Ga0070664_1000055979 | 209 |
| 262 | 3300005564 | Ga0070664_100008653 | Ga0070664_1000086536 | 209 |
| 263 | 3300005564 | Ga0070664_100009543 | Ga0070664_1000095436 | 209 |
| 264 | 3300005564 | Ga0070664_100013227 | Ga0070664_1000132278 | 209 |
| 265 | 3300005564 | Ga0070664_100032932 | Ga0070664_1000329322 | 209 |
| 266 | 3300005564 | Ga0070664_100041113 | Ga0070664_1000411132 | 209 |
| 267 | 3300005564 | Ga0070664_100081472 | Ga0070664_1000814724 | 209 |
| 268 | 3300005564 | Ga0070664_100333713 | Ga0070664_1003337132 | 209 |
| 269 | 3300005577 | Ga0068857_100006128 | Ga0068857_1000061283 | 209 |
| 270 | 3300005577 | Ga0068857_100008558 | Ga0068857_10000855811 | 209 |
| 271 | 3300005577 | Ga0068857_100012664 | Ga0068857_1000126644 | 209 |
| 272 | 3300005577 | Ga0068857_100182370 | Ga0068857_1001823703 | 209 |
| 273 | 3300005577 | Ga0068857_100587454 | Ga0068857_1005874542 | 209 |
| 274 | 3300005578 | Ga0068854_100007270 | Ga0068854_1000072705 | 209 |
| 275 | 3300005578 | Ga0068854_100017587 | Ga0068854_1000175872 | 209 |
| 276 | 3300005578 | Ga0068854_100183029 | Ga0068854_1001830292 | 209 |
| 277 | 3300005614 | Ga0068856_100028713 | Ga0068856_1000287132 | 209 |
| 278 | 3300005614 | Ga0068856_100165438 | Ga0068856_1001654382 | 209 |
| 279 | 3300005614 | Ga0068856_100196044 | Ga0068856_1001960442 | 209 |
| 280 | 3300005614 | Ga0068856_100853588 | Ga0068856_1008535882 | 209 |
| 281 | 3300005616 | Ga0068852_100002219 | Ga0068852_10000221914 | 209 |
| 282 | 3300005616 | Ga0068852_100064809 | Ga0068852_1000648092 | 209 |
| 283 | 3300005617 | Ga0068859_100073948 | Ga0068859_1000739482 | 209 |
| 284 | 3300005617 | Ga0068859_100074124 | Ga0068859_1000741242 | 209 |
| 285 | 3300005618 | Ga0068864_100013847 | Ga0068864_1000138472 | 209 |
| 286 | 3300005618 | Ga0068864_100030627 | Ga0068864_1000306276 | 209 |
| 287 | 3300005618 | Ga0068864_100076915 | Ga0068864_1000769152 | 209 |
| 288 | 3300005618 | Ga0068864_100096414 | Ga0068864_1000964142 | 209 |
| 289 | 3300005618 | Ga0068864_100739341 | Ga0068864_1007393412 | 209 |
| 290 | 3300005834 | Ga0068851_10009898 | Ga0068851_100098983 | 209 |
| 291 | 3300005834 | Ga0068851_10040782 | Ga0068851_100407823 | 209 |
| 292 | 3300005841 | Ga0068863_100022135 | Ga0068863_1000221355 | 209 |
| 293 | 3300005841 | Ga0068863_100215496 | Ga0068863_1002154962 | 209 |
| 294 | 3300005841 | Ga0068863_100215670 | Ga0068863_1002156702 | 209 |
| 295 | 3300005842 | Ga0068858_100054707 | Ga0068858_1000547074 | 209 |
| 296 | 3300005842 | Ga0068858_100132877 | Ga0068858_1001328771 | 209 |
| 297 | 3300005843 | Ga0068860_100157128 | Ga0068860_1001571282 | 209 |
| 298 | 3300006237 | Ga0097621_100061215 | Ga0097621_1000612152 | 209 |
| 299 | 3300006358 | Ga0068871_100017299 | Ga0068871_1000172997 | 209 |
| 300 | 3300006358 | Ga0068871_100220707 | Ga0068871_1002207072 | 209 |
| 301 | 3300006844 | Ga0075428_100097508 | Ga0075428_1000975082 | 209 |
| 302 | 3300006931 | Ga0097620_100073945 | Ga0097620_1000739452 | 209 |
| 303 | 3300006931 | Ga0097620_100074122 | Ga0097620_1000741222 | 209 |
| 304 | 3300009011 | Ga0105251_10017734 | Ga0105251_100177344 | 209 |
| 305 | 3300009093 | Ga0105240_10774926 | Ga0105240_107749261 | 209 |
| 306 | 3300009147 | Ga0114129_10310521 | Ga0114129_103105212 | 209 |
| 307 | 3300009174 | Ga0105241_10549256 | Ga0105241_105492561 | 209 |
| 308 | 3300009176 | Ga0105242_11062360 | Ga0105242_110623602 | 209 |
| 309 | 3300009176 | Ga0105242_11138651 | Ga0105242_111386511 | 209 |
| 310 | 3300009177 | Ga0105248_10028813 | Ga0105248_100288137 | 209 |
| 311 | 3300009177 | Ga0105248_10059870 | Ga0105248_100598702 | 209 |
| 312 | 3300009177 | Ga0105248_10135506 | Ga0105248_101355062 | 209 |
| 313 | 3300009553 | Ga0105249_10181277 | Ga0105249_101812773 | 209 |
| 314 | 3300011119 | Ga0105246_10046324 | Ga0105246_100463244 | 209 |
| 315 | 3300011119 | Ga0105246_10215374 | Ga0105246_102153742 | 209 |
| 316 | 3300013100 | Ga0157373_10012052 | Ga0157373_100120523 | 209 |
| 317 | 3300013100 | Ga0157373_10012190 | Ga0157373_100121906 | 209 |
| 318 | 3300013100 | Ga0157373_10310852 | Ga0157373_103108522 | 209 |
| 319 | 3300013100 | Ga0157373_10576308 | Ga0157373_105763081 | 209 |
| 320 | 3300013102 | Ga0157371_10026098 | Ga0157371_100260983 | 209 |
| 321 | 3300013102 | Ga0157371_10068369 | Ga0157371_100683692 | 209 |
| 322 | 3300013102 | Ga0157371_10080793 | Ga0157371_100807932 | 209 |
| 323 | 3300013104 | Ga0157370_10056632 | Ga0157370_100566325 | 209 |
| 324 | 3300013104 | Ga0157370_10182666 | Ga0157370_101826663 | 209 |
| 325 | 3300013105 | Ga0157369_10058734 | Ga0157369_100587345 | 209 |
| 326 | 3300013105 | Ga0157369_10344494 | Ga0157369_103444941 | 209 |
| 327 | 3300013105 | Ga0157369_10357239 | Ga0157369_103572392 | 209 |
| 328 | 3300013297 | Ga0157378_10074941 | Ga0157378_100749412 | 209 |
| 329 | 3300013307 | Ga0157372_10072950 | Ga0157372_100729502 | 209 |
| 330 | 3300013307 | Ga0157372_10371810 | Ga0157372_103718102 | 209 |
| 331 | 3300013307 | Ga0157372_10460162 | Ga0157372_104601622 | 209 |
| 332 | 3300013308 | Ga0157375_10271395 | Ga0157375_102713952 | 209 |
| 333 | 3300014325 | Ga0163163_10194456 | Ga0163163_101944562 | 209 |
| 334 | 3300014968 | Ga0157379_10050074 | Ga0157379_100500742 | 209 |
| 335 | 3300025321 | Ga0207656_10027583 | Ga0207656_100275832 | 209 |
| 336 | 3300025901 | Ga0207688_10009726 | Ga0207688_100097262 | 209 |
| 337 | 3300025903 | Ga0207680_10006094 | Ga0207680_100060942 | 209 |
| 338 | 3300025904 | Ga0207647_10014284 | Ga0207647_100142842 | 209 |
| 339 | 3300025904 | Ga0207647_10044379 | Ga0207647_100443792 | 209 |
| 340 | 3300025904 | Ga0207647_10070270 | Ga0207647_100702701 | 209 |
| 341 | 3300025904 | Ga0207647_10119440 | Ga0207647_101194401 | 209 |
| 342 | 3300025904 | Ga0207647_10158747 | Ga0207647_101587472 | 209 |
| 343 | 3300025907 | Ga0207645_10051027 | Ga0207645_100510272 | 209 |
| 344 | 3300025907 | Ga0207645_10121475 | Ga0207645_101214752 | 209 |
| 345 | 3300025909 | Ga0207705_10011534 | Ga0207705_100115342 | 209 |
| 346 | 3300025909 | Ga0207705_10016171 | Ga0207705_100161712 | 209 |
| 347 | 3300025909 | Ga0207705_10045863 | Ga0207705_100458632 | 209 |
| 348 | 3300025909 | Ga0207705_10114803 | Ga0207705_101148031 | 209 |
| 349 | 3300025909 | Ga0207705_10176396 | Ga0207705_101763962 | 209 |
| 350 | 3300025909 | Ga0207705_10236209 | Ga0207705_102362092 | 209 |
| 351 | 3300025909 | Ga0207705_10507173 | Ga0207705_105071732 | 209 |
| 352 | 3300025909 | Ga0207705_10732569 | Ga0207705_107325691 | 209 |
| 353 | 3300025911 | Ga0207654_10355852 | Ga0207654_103558521 | 209 |
| 354 | 3300025911 | Ga0207654_10558903 | Ga0207654_105589031 | 209 |
| 355 | 3300025912 | Ga0207707_10086710 | Ga0207707_100867101 | 209 |
| 356 | 3300025917 | Ga0207660_10043246 | Ga0207660_100432461 | 209 |
| 357 | 3300025917 | Ga0207660_10207986 | Ga0207660_102079862 | 209 |
| 358 | 3300025917 | Ga0207660_10217143 | Ga0207660_102171432 | 209 |
| 359 | 3300025917 | Ga0207660_10288533 | Ga0207660_102885332 | 209 |
| 360 | 3300025919 | Ga0207657_10003856 | Ga0207657_1000385613 | 209 |
| 361 | 3300025919 | Ga0207657_10012876 | Ga0207657_100128766 | 209 |
| 362 | 3300025919 | Ga0207657_10020251 | Ga0207657_100202516 | 209 |
| 363 | 3300025919 | Ga0207657_10038143 | Ga0207657_100381432 | 209 |
| 364 | 3300025919 | Ga0207657_10041738 | Ga0207657_100417384 | 209 |
| 365 | 3300025919 | Ga0207657_10262904 | Ga0207657_102629041 | 209 |
| 366 | 3300025919 | Ga0207657_10461652 | Ga0207657_104616522 | 209 |
| 367 | 3300025920 | Ga0207649_10043844 | Ga0207649_100438442 | 209 |
| 368 | 3300025920 | Ga0207649_10084256 | Ga0207649_100842562 | 209 |
| 369 | 3300025920 | Ga0207649_10097318 | Ga0207649_100973183 | 209 |
| 370 | 3300025921 | Ga0207652_10017978 | Ga0207652_100179782 | 209 |
| 371 | 3300025921 | Ga0207652_10122504 | Ga0207652_101225042 | 209 |
| 372 | 3300025921 | Ga0207652_10234439 | Ga0207652_102344392 | 209 |
| 373 | 3300025923 | Ga0207681_10032525 | Ga0207681_100325252 | 209 |
| 374 | 3300025925 | Ga0207650_10019734 | Ga0207650_100197342 | 209 |
| 375 | 3300025925 | Ga0207650_10196325 | Ga0207650_101963252 | 209 |
| 376 | 3300025925 | Ga0207650_10308077 | Ga0207650_103080772 | 209 |
| 377 | 3300025929 | Ga0207664_10523552 | Ga0207664_105235522 | 209 |
| 378 | 3300025931 | Ga0207644_10002557 | Ga0207644_100025572 | 209 |
| 379 | 3300025931 | Ga0207644_10039216 | Ga0207644_100392162 | 209 |
| 380 | 3300025931 | Ga0207644_10056459 | Ga0207644_100564594 | 209 |
| 381 | 3300025931 | Ga0207644_10063269 | Ga0207644_100632692 | 209 |
| 382 | 3300025931 | Ga0207644_10092594 | Ga0207644_100925942 | 209 |
| 383 | 3300025931 | Ga0207644_10325950 | Ga0207644_103259502 | 209 |
| 384 | 3300025931 | Ga0207644_10583270 | Ga0207644_105832701 | 209 |
| 385 | 3300025932 | Ga0207690_10382429 | Ga0207690_103824292 | 209 |
| 386 | 3300025932 | Ga0207690_10848441 | Ga0207690_108484411 | 209 |
| 387 | 3300025933 | Ga0207706_10002559 | Ga0207706_1000255916 | 209 |
| 388 | 3300025933 | Ga0207706_10030010 | Ga0207706_100300102 | 209 |
| 389 | 3300025933 | Ga0207706_10054658 | Ga0207706_100546584 | 209 |
| 390 | 3300025933 | Ga0207706_10071113 | Ga0207706_100711134 | 209 |
| 391 | 3300025933 | Ga0207706_10083834 | Ga0207706_100838342 | 209 |
| 392 | 3300025933 | Ga0207706_10089090 | Ga0207706_100890902 | 209 |
| 393 | 3300025933 | Ga0207706_10243960 | Ga0207706_102439602 | 209 |
| 394 | 3300025933 | Ga0207706_10476778 | Ga0207706_104767782 | 209 |
| 395 | 3300025936 | Ga0207670_10241088 | Ga0207670_102410882 | 209 |
| 396 | 3300025937 | Ga0207669_10040752 | Ga0207669_100407521 | 209 |
| 397 | 3300025940 | Ga0207691_10020592 | Ga0207691_100205923 | 209 |
| 398 | 3300025940 | Ga0207691_10053391 | Ga0207691_100533911 | 209 |
| 399 | 3300025940 | Ga0207691_10917258 | Ga0207691_109172581 | 209 |
| 400 | 3300025941 | Ga0207711_10000123 | Ga0207711_1000012377 | 209 |
| 401 | 3300025941 | Ga0207711_10210852 | Ga0207711_102108522 | 209 |
| 402 | 3300025942 | Ga0207689_10090153 | Ga0207689_100901532 | 209 |
| 403 | 3300025942 | Ga0207689_10294449 | Ga0207689_102944492 | 209 |
| 404 | 3300025945 | Ga0207679_10014539 | Ga0207679_100145393 | 209 |
| 405 | 3300025945 | Ga0207679_10022504 | Ga0207679_100225042 | 209 |
| 406 | 3300025945 | Ga0207679_10041173 | Ga0207679_100411732 | 209 |
| 407 | 3300025945 | Ga0207679_10080448 | Ga0207679_100804482 | 209 |
| 408 | 3300025945 | Ga0207679_10203144 | Ga0207679_102031442 | 209 |
| 409 | 3300025949 | Ga0207667_10042495 | Ga0207667_100424953 | 209 |
| 410 | 3300025949 | Ga0207667_10056214 | Ga0207667_100562143 | 209 |
| 411 | 3300025960 | Ga0207651_10343595 | Ga0207651_103435952 | 209 |
| 412 | 3300025960 | Ga0207651_10502044 | Ga0207651_105020441 | 209 |
| 413 | 3300025981 | Ga0207640_10011228 | Ga0207640_100112282 | 209 |
| 414 | 3300025981 | Ga0207640_10065127 | Ga0207640_100651272 | 209 |
| 415 | 3300025981 | Ga0207640_10104068 | Ga0207640_101040682 | 209 |
| 416 | 3300025981 | Ga0207640_10289255 | Ga0207640_102892551 | 209 |
| 417 | 3300025981 | Ga0207640_10332765 | Ga0207640_103327652 | 209 |
| 418 | 3300026023 | Ga0207677_11207029 | Ga0207677_112070291 | 209 |
| 419 | 3300026035 | Ga0207703_10307353 | Ga0207703_103073532 | 209 |
| 420 | 3300026041 | Ga0207639_10065518 | Ga0207639_100655182 | 209 |
| 421 | 3300026041 | Ga0207639_10391275 | Ga0207639_103912752 | 209 |
| 422 | 3300026041 | Ga0207639_10702228 | Ga0207639_107022282 | 209 |
| 423 | 3300026067 | Ga0207678_10004043 | Ga0207678_1000404310 | 209 |
| 424 | 3300026067 | Ga0207678_10004189 | Ga0207678_1000418913 | 209 |
| 425 | 3300026067 | Ga0207678_10022133 | Ga0207678_100221332 | 209 |
| 426 | 3300026067 | Ga0207678_10031276 | Ga0207678_100312763 | 209 |
| 427 | 3300026067 | Ga0207678_10045005 | Ga0207678_100450052 | 209 |
| 428 | 3300026067 | Ga0207678_10070423 | Ga0207678_100704232 | 209 |
| 429 | 3300026067 | Ga0207678_10087283 | Ga0207678_100872834 | 209 |
| 430 | 3300026067 | Ga0207678_10158576 | Ga0207678_101585762 | 209 |
| 431 | 3300026067 | Ga0207678_10494079 | Ga0207678_104940792 | 209 |
| 432 | 3300026078 | Ga0207702_10045166 | Ga0207702_100451662 | 209 |
| 433 | 3300026078 | Ga0207702_10046685 | Ga0207702_100466852 | 209 |
| 434 | 3300026078 | Ga0207702_10167227 | Ga0207702_101672271 | 209 |
| 435 | 3300026088 | Ga0207641_10011929 | Ga0207641_100119295 | 209 |
| 436 | 3300026088 | Ga0207641_10066568 | Ga0207641_100665682 | 209 |
| 437 | 3300026088 | Ga0207641_10219091 | Ga0207641_102190912 | 209 |
| 438 | 3300026088 | Ga0207641_10261252 | Ga0207641_102612522 | 209 |
| 439 | 3300026089 | Ga0207648_10196580 | Ga0207648_101965802 | 209 |
| 440 | 3300026089 | Ga0207648_10274322 | Ga0207648_102743222 | 209 |
| 441 | 3300026089 | Ga0207648_10333654 | Ga0207648_103336541 | 209 |
| 442 | 3300026089 | Ga0207648_10423326 | Ga0207648_104233261 | 209 |
| 443 | 3300026095 | Ga0207676_10011451 | Ga0207676_100114512 | 209 |
| 444 | 3300026095 | Ga0207676_10013343 | Ga0207676_100133433 | 209 |
| 445 | 3300026095 | Ga0207676_10022532 | Ga0207676_100225324 | 209 |
| 446 | 3300026095 | Ga0207676_10079155 | Ga0207676_100791554 | 209 |
| 447 | 3300026095 | Ga0207676_10109591 | Ga0207676_101095912 | 209 |
| 448 | 3300026116 | Ga0207674_10000742 | Ga0207674_1000074233 | 209 |
| 449 | 3300026116 | Ga0207674_10002644 | Ga0207674_1000264419 | 209 |
| 450 | 3300026116 | Ga0207674_10009197 | Ga0207674_100091972 | 209 |
| 451 | 3300026116 | Ga0207674_10034906 | Ga0207674_100349062 | 209 |
| 452 | 3300026116 | Ga0207674_10531686 | Ga0207674_105316862 | 209 |
| 453 | 3300026121 | Ga0207683_10009904 | Ga0207683_100099045 | 209 |
| 454 | 3300028379 | Ga0268266_10108797 | Ga0268266_101087973 | 209 |
| 455 | 3300028380 | Ga0268265_10368543 | Ga0268265_103685432 | 209 |
| 456 | 3300028381 | Ga0268264_10036103 | Ga0268264_100361036 | 209 |
| 457 | 3300031548 | Ga0307408_100052894 | Ga0307408_1000528942 | 209 |
| 458 | 3300031731 | Ga0307405_10212389 | Ga0307405_102123892 | 209 |
| 459 | 3300031824 | Ga0307413_10029918 | Ga0307413_100299182 | 209 |
| 460 | 3300031824 | Ga0307413_10591715 | Ga0307413_105917151 | 209 |
| 461 | 3300031852 | Ga0307410_10011162 | Ga0307410_100111622 | 209 |
| 462 | 3300031852 | Ga0307410_10011551 | Ga0307410_100115512 | 209 |
| 463 | 3300031901 | Ga0307406_10495267 | Ga0307406_104952671 | 209 |
| 464 | 3300031901 | Ga0307406_10641408 | Ga0307406_106414082 | 209 |
| 465 | 3300031995 | Ga0307409_100005232 | Ga0307409_1000052323 | 209 |
| 466 | 3300032004 | Ga0307414_10024190 | Ga0307414_100241902 | 209 |
| 467 | 3300032005 | Ga0307411_10023247 | Ga0307411_100232472 | 209 |
| 468 | 3300032005 | Ga0307411_10184143 | Ga0307411_101841432 | 209 |
| 469 | 3300032126 | Ga0307415_100140339 | Ga0307415_1001403392 | 209 |
| 470 | 3300035170 | Ga0373943_0003327 | Ga0373943_0003327_1308_1955 | 209 |
| 471 | 3300035725 | Ga0373947_0051941 | Ga0373947_0051941_64_711 | 209 |
| 472 | 3300037068 | Ga0373925_0055913 | Ga0373925_0055913_1309_1956 | 209 |
| 473 | 3300037312 | Ga0395899_0000511 | Ga0395899_0000511_1028_1678 | 209 |
| 474 | 3300037312 | Ga0395899_0000618 | Ga0395899_0000618_7647_8285 | 209 |
| 475 | 3300037312 | Ga0395899_0033119 | Ga0395899_0033119_884_1522 | 209 |
| 476 | 3300037312 | Ga0395899_0437160 | Ga0395899_0437160_96_734 | 209 |
| 477 | 3300037418 | Ga0395900_0000221 | Ga0395900_0000221_55092_55730 | 209 |
| 478 | 3300037418 | Ga0395900_0000500 | Ga0395900_0000500_16491_17141 | 209 |
| 479 | 3300037418 | Ga0395900_0015114 | Ga0395900_0015114_3719_4357 | 209 |
| 480 | 3300037418 | Ga0395900_0029936 | Ga0395900_0029936_4374_5012 | 209 |
| 481 | 3300037418 | Ga0395900_0034947 | Ga0395900_0034947_2700_3338 | 209 |
| 482 | 3300037418 | Ga0395900_0059112 | Ga0395900_0059112_2081_2719 | 209 |
| 483 | 3300037418 | Ga0395900_0080612 | Ga0395900_0080612_1387_2055 | 209 |
| 484 | 3300037418 | Ga0395900_0237648 | Ga0395900_0237648_778_1416 | 209 |
| 485 | 3300037418 | Ga0395900_0800188 | Ga0395900_0800188_19_657 | 209 |
| 486 | 3300037466 | Ga0395898_0000053 | Ga0395898_0000053_223871_224509 | 209 |
| 487 | 3300037466 | Ga0395898_0001272 | Ga0395898_0001272_30110_30760 | 209 |
| 488 | 3300037466 | Ga0395898_0018979 | Ga0395898_0018979_6047_6685 | 209 |
| 489 | 3300037466 | Ga0395898_0039484 | Ga0395898_0039484_3936_4574 | 209 |
| 490 | 3300037466 | Ga0395898_0074592 | Ga0395898_0074592_886_1524 | 209 |
| 491 | 3300037466 | Ga0395898_0470447 | Ga0395898_0470447_455_1093 | 209 |
| 492 | 3300037466 | Ga0395898_0618587 | Ga0395898_0618587_204_872 | 209 |
| 493 | 3300037471 | Ga0395905_0000031 | Ga0395905_0000031_62249_62887 | 209 |
| 494 | 3300037471 | Ga0395905_0017950 | Ga0395905_0017950_4019_4657 | 209 |
| 495 | 3300037471 | Ga0395905_0021814 | Ga0395905_0021814_877_1515 | 209 |
| 496 | 3300037471 | Ga0395905_0024415 | Ga0395905_0024415_4630_5268 | 209 |
| 497 | 3300037471 | Ga0395905_0025362 | Ga0395905_0025362_3016_3663 | 209 |
| 498 | 3300037471 | Ga0395905_0045903 | Ga0395905_0045903_84_722 | 209 |
| 499 | 3300037471 | Ga0395905_0066518 | Ga0395905_0066518_2321_2959 | 209 |
| 500 | 3300037471 | Ga0395905_0073352 | Ga0395905_0073352_1950_2588 | 209 |
| 501 | 3300037471 | Ga0395905_0080406 | Ga0395905_0080406_234_872 | 209 |
| 502 | 3300037471 | Ga0395905_0096896 | Ga0395905_0096896_930_1568 | 209 |
| 503 | 3300037471 | Ga0395905_0147569 | Ga0395905_0147569_742_1380 | 209 |
| 504 | 3300037471 | Ga0395905_0183655 | Ga0395905_0183655_514_1152 | 209 |
| 505 | 3300037471 | Ga0395905_0700145 | Ga0395905_0700145_190_828 | 209 |
| 506 | 3300037471 | Ga0395905_0704959 | Ga0395905_0704959_195_863 | 209 |
| 507 | 3300037471 | Ga0395905_0945654 | Ga0395905_0945654_100_738 | 209 |
| 508 | 3300038443 | Ga0395901_0000163 | Ga0395901_0000163_23065_23703 | 209 |
| 509 | 3300038443 | Ga0395901_0000469 | Ga0395901_0000469_16499_17149 | 209 |
| 510 | 3300038443 | Ga0395901_0016131 | Ga0395901_0016131_3993_4631 | 209 |
| 511 | 3300038443 | Ga0395901_0018026 | Ga0395901_0018026_4875_5513 | 209 |
| 512 | 3300038443 | Ga0395901_0019807 | Ga0395901_0019807_2833_3480 | 209 |
| 513 | 3300038443 | Ga0395901_0028609 | Ga0395901_0028609_784_1422 | 209 |
| 514 | 3300038443 | Ga0395901_0209680 | Ga0395901_0209680_560_1198 | 209 |
| 515 | 3300038443 | Ga0395901_0248439 | Ga0395901_0248439_963_1601 | 209 |
| 516 | 3300038443 | Ga0395901_0254944 | Ga0395901_0254944_959_1627 | 209 |
| 517 | 3300038443 | Ga0395901_0340506 | Ga0395901_0340506_128_766 | 209 |
| 518 | 3300038443 | Ga0395901_1194432 | Ga0395901_1194432_68_706 | 209 |
| 519 | 3300039437 | Ga0436365_0822316 | Ga0436365_0822316_13853_14491 | 209 |
| 520 | 3300042005 | Ga0439448_0034143 | Ga0439448_0034143_585_1223 | 209 |
| 521 | 3300042157 | Ga0439458_0000459 | Ga0439458_0000459_4772_5410 | 209 |
| 522 | 3300044656 | Ga0466969_0015202 | Ga0466969_0015202_3301_3939 | 209 |
| 523 | 3300044684 | Ga0466966_0007349 | Ga0466966_0007349_4029_4667 | 209 |
| 524 | 3300044694 | Ga0466963_0021574 | Ga0466963_0021574_1961_2605 | 209 |
| 525 | 3300044694 | Ga0466963_0223167 | Ga0466963_0223167_553_1251 | 209 |
| 526 | 3300044694 | Ga0466963_0298468 | Ga0466963_0298468_313_951 | 209 |
| 527 | 3300044694 | Ga0466963_0368676 | Ga0466963_0368676_342_980 | 209 |
| 528 | 3300044706 | Ga0466964_0322721 | Ga0466964_0322721_96_740 | 209 |
| 529 | 3300044719 | Ga0466971_0115878 | Ga0466971_0115878_359_997 | 209 |
| 530 | 3300044765 | Ga0466970_0024472 | Ga0466970_0024472_291_929 | 209 |
| 531 | 3300044842 | Ga0466957_0093994 | Ga0466957_0093994_514_1152 | 209 |
| 532 | 3300045049 | Ga0466959_0082185 | Ga0466959_0082185_1162_1800 | 209 |
| 533 | 3300045836 | Ga0466958_0079367 | Ga0466958_0079367_1301_1939 | 209 |
| 534 | 3300045976 | Ga0466967_0041010 | Ga0466967_0041010_873_1517 | 209 |
| 535 | 3300045976 | Ga0466967_0050456 | Ga0466967_0050456_383_1081 | 209 |
| 536 | 3300045976 | Ga0466967_0082075 | Ga0466967_0082075_1725_2369 | 209 |
| 537 | 3300045976 | Ga0466967_0157962 | Ga0466967_0157962_1108_1746 | 209 |
| 538 | 3300045976 | Ga0466967_0513291 | Ga0466967_0513291_167_805 | 209 |
| 539 | 3300046525 | Ga0495663_0014977 | Ga0495663_0014977_929_1567 | 209 |
| 540 | 3300046525 | Ga0495663_0072875 | Ga0495663_0072875_299_937 | 209 |
| 541 | 3300046684 | Ga0495669_0006784 | Ga0495669_0006784_2092_2730 | 209 |
| 542 | 3300047445 | Ga0495677_0012201 | Ga0495677_0012201_1143_1781 | 209 |
| 543 | 3300048903 | Ga0496100_0010059 | Ga0496100_0010059_4114_4758 | 209 |
| 544 | 3300048905 | Ga0496102_0045755 | Ga0496102_0045755_1266_1904 | 209 |
| 545 | 3300048907 | Ga0496104_0054465 | Ga0496104_0054465_2066_2704 | 209 |
| 546 | 3300048908 | Ga0496105_0027615 | Ga0496105_0027615_1091_1738 | 209 |
| 547 | 3300048909 | Ga0496106_0018119 | Ga0496106_0018119_2709_3353 | 209 |
| 548 | 3300048910 | Ga0496107_0063821 | Ga0496107_0063821_91_729 | 209 |
| 549 | 3300048910 | Ga0496107_0238067 | Ga0496107_0238067_310_954 | 209 |
| 550 | 3300048911 | Ga0496108_0021534 | Ga0496108_0021534_2914_3561 | 209 |
| 551 | 3300048911 | Ga0496108_0023791 | Ga0496108_0023791_4368_5012 | 209 |
| 552 | 3300048912 | Ga0496109_0001226 | Ga0496109_0001226_16415_17059 | 209 |
| 553 | 3300048912 | Ga0496109_0003874 | Ga0496109_0003874_5473_6120 | 209 |
| 554 | 3300048912 | Ga0496109_0044034 | Ga0496109_0044034_2790_3428 | 209 |
| 555 | 3300048912 | Ga0496109_0223369 | Ga0496109_0223369_651_1289 | 209 |
| 556 | 3300048912 | Ga0496109_0287808 | Ga0496109_0287808_547_1245 | 209 |
| 557 | 3300048913 | Ga0496110_0011575 | Ga0496110_0011575_4128_4775 | 209 |
| 558 | 3300048913 | Ga0496110_0057646 | Ga0496110_0057646_990_1628 | 209 |
| 559 | 3300048913 | Ga0496110_0795116 | Ga0496110_0795116_78_716 | 209 |
| 560 | 3300048914 | Ga0496111_0003375 | Ga0496111_0003375_4532_5179 | 209 |
| 561 | 3300048914 | Ga0496111_0003969 | Ga0496111_0003969_3689_4333 | 209 |
| 562 | 3300048914 | Ga0496111_0009813 | Ga0496111_0009813_3971_4609 | 209 |
| 563 | 3300048914 | Ga0496111_0050178 | Ga0496111_0050178_444_1082 | 209 |
| 564 | 3300048915 | Ga0496112_0021772 | Ga0496112_0021772_1653_2297 | 209 |
| 565 | 3300048915 | Ga0496112_0036668 | Ga0496112_0036668_2835_3473 | 209 |
| 566 | 3300048915 | Ga0496112_0036799 | Ga0496112_0036799_799_1437 | 209 |
| 567 | 3300048916 | Ga0496113_0005531 | Ga0496113_0005531_3686_4333 | 209 |
| 568 | 3300048916 | Ga0496113_0034688 | Ga0496113_0034688_30_668 | 209 |
| 569 | 3300061719 | Ga0466962_0116593 | Ga0466962_0116593_65_703 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zui-assembly1.cif.gz_A | crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid | 0.8654 | 25 | 96 |
| 4pxi-assembly1.cif.gz_A | elucidation of the structural and functional mechanism of action of the tetr family protein, cprb from s. coelicolor a3(2) | 0.6343 | 21 | 163 |
| 4pxi-assembly1.cif.gz_D | elucidation of the structural and functional mechanism of action of the tetr family protein, cprb from s. coelicolor a3(2) | 0.6272 | 24 | 174 |
| 3pas-assembly1.cif.gz_A | crystal structure of a tetr family transcription regulator (maqu_1417) from marinobacter aquaeolei vt8 at 1.90 a resolution | 0.6215 | 21 | 174 |
| 1ui5-assembly1.cif.gz_A | crystal structure of gamma-butyrolactone receptor (arpa like protein) | 0.6195 | 21 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5gpaB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 1.003 | 27 | 67 | 1.10.10.60 |
| 3whcD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9995 | 25 | 67 | 1.10.10.60 |
| 5gp9B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9977 | 27 | 67 | 1.10.10.60 |
| 6azhB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9917 | 28 | 71 | 1.10.10.60 |
| 2wv1B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9917 | 23 | 59 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259HH19-F1-model_v4 | TetR family transcriptional regulator | 0.9432 | 10 | 112 |
GO:0000976
GO:0003700 |
| AF-A0A7V9DIR6-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.925 | 16 | 119 |
GO:0000976
GO:0003700 |
| AF-A0A7V9IWJ0-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.8894 | 15 | 121 |
GO:0000976
GO:0003700 |
| AF-A0A524KFS5-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.8881 | 21 | 126 |
GO:0000976
GO:0003700 |
| AF-A0A2N2LHZ8-F1-model_v4 | HTH tetR-type domain-containing protein | 0.8846 | 23 | 121 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar