F464695

General Info

Members Datasets Scaffolds Average Seq Length
569 252 1138 459

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100130856|Ga0070683_1001308562
Length 490
Sequence MPLLSSPSPSIAVRALRRGRHAASAGPPPMKVGFVTLGCDKNTVDTERYLAQLADRGAEYTGDLAEAEVIVVNTCGFIDAAKKESLDAIVEAGRMKDEGRCQAVVAVGCMVQRHRDELVEALPEVDLFLGSSEMDRLLPELEARGLIDDQPVIHPGVRLFTGDNPHIRYLKVSEGCDHGCAFCAIPLMRGKHRSFALDELIREAQLLEAQGAREVNLVAQDLAHYGRDRRDGFTLPELLEALVRETSIPWLRMLYLYSSGITPRLLEVVAREPRILPYLDMPMQHASDAVLARMRRPERQRTIRDRVXXXXEVVPDIAIRTTCIVGFPGETDEDFTQLMEFLEEIQFERVGAFTYSPQEGTRAAAMIDDVPESLKRERLERLMDLQRQITAERYERFLGRTARAMIDRVADGEAQARTVWQADDVDGVTLVDGAESLTPGTIIDAVIEGVEEDVDFRASLLRVVDRVGASGAPRRRVLPVMGTTIGSFGR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.41
Rhizosphere 98.07
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100130856 3300005329 Bacteria 2375
2 Ga0065715_10113160 3300005293 Bacteria 2501
3 Ga0065715_10114887 3300005293 Bacteria 2427
4 Ga0065707_10146122 3300005295 Bacteria 1712
5 Ga0070658_10000462 3300005327 Bacteria 35192
6 Ga0070658_10000643 3300005327 Bacteria 30139
7 Ga0070658_10010396 3300005327 Bacteria 7462
8 Ga0070658_10163218 3300005327 Bacteria 1870
9 Ga0070676_10004464 3300005328 Bacteria 7363
10 Ga0070676_10008319 3300005328 Bacteria 5590
11 Ga0070676_10011893 3300005328 Bacteria 4741
12 Ga0070683_100001277 3300005329 Bacteria 19144
13 Ga0070683_100002152 3300005329 Bacteria 15575
14 Ga0070683_100004172 3300005329 Bacteria 11837
15 Ga0070683_100006638 3300005329 Bacteria 9715
16 Ga0070683_100013547 3300005329 Bacteria 7116
17 Ga0070683_100024237 3300005329 Bacteria 5433
18 Ga0070683_100033835 3300005329 Bacteria 4664
19 Ga0070683_100056553 3300005329 Bacteria 3643
20 Ga0070690_100013595 3300005330 Bacteria 4814
21 Ga0070690_100014582 3300005330 Bacteria 4664
22 Ga0070670_100018242 3300005331 Bacteria 6021
23 Ga0070670_100023705 3300005331 Bacteria 5282
24 Ga0070670_100036585 3300005331 Bacteria 4224
25 Ga0070670_100098075 3300005331 Bacteria 2521
26 Ga0068869_100005888 3300005334 Bacteria 7743
27 Ga0070680_100003233 3300005336 Bacteria 12125
28 Ga0070680_100006572 3300005336 Bacteria 8842
29 Ga0070680_100007386 3300005336 Bacteria 8387
30 Ga0070680_100011660 3300005336 Bacteria 6811
31 Ga0070680_100198821 3300005336 Bacteria 1690
32 Ga0070682_100002205 3300005337 Bacteria 10797
33 Ga0070682_100010116 3300005337 Bacteria 5347
34 Ga0070660_100001501 3300005339 Bacteria 15990
35 Ga0070691_10065658 3300005341 Bacteria 1753
36 Ga0070687_100001648 3300005343 Bacteria 7983
37 Ga0070661_100004878 3300005344 Bacteria 9238
38 Ga0070661_100010649 3300005344 Bacteria 6399
39 Ga0070661_100029442 3300005344 Bacteria 3963
40 Ga0070661_100074858 3300005344 Bacteria 2494
41 Ga0070692_10001546 3300005345 Bacteria 8453
42 Ga0070692_10075144 3300005345 Bacteria 1809
43 Ga0070668_100000578 3300005347 Bacteria 24594
44 Ga0070668_100005648 3300005347 Bacteria 9270
45 Ga0070668_100019016 3300005347 Bacteria 5163
46 Ga0070668_100036909 3300005347 Bacteria 3730
47 Ga0070668_100065055 3300005347 Bacteria 2828
48 Ga0070669_100003488 3300005353 Bacteria 11338
49 Ga0070669_100068749 3300005353 Bacteria 2615
50 Ga0070675_100004354 3300005354 Bacteria 10793
51 Ga0070675_100039786 3300005354 Bacteria 3837
52 Ga0070675_100104310 3300005354 Bacteria 2392
53 Ga0070674_100094251 3300005356 Bacteria 2168
54 Ga0070673_100056335 3300005364 Bacteria 3101
55 Ga0070673_100099062 3300005364 Bacteria 2397
56 Ga0070659_100003040 3300005366 Bacteria 11931
57 Ga0070659_100007173 3300005366 Bacteria 8088
58 Ga0070659_100025677 3300005366 Bacteria 4528
59 Ga0070659_100066433 3300005366 Bacteria 2857
60 Ga0070714_100004979 3300005435 Bacteria 10099
61 Ga0070714_100030965 3300005435 Bacteria 4458
62 Ga0070714_100035857 3300005435 Bacteria 4158
63 Ga0070713_100004104 3300005436 Bacteria 9705
64 Ga0070713_100096378 3300005436 Bacteria 2554
65 Ga0070701_10048016 3300005438 Bacteria 2201
66 Ga0070700_100026161 3300005441 Bacteria 3443
67 Ga0070694_100088618 3300005444 Bacteria 2167
68 Ga0070708_100000006 3300005445 Bacteria 150596
69 Ga0070708_100000202 3300005445 Bacteria 43614
70 Ga0070708_100038164 3300005445 Bacteria 4196
71 Ga0070663_100012749 3300005455 Bacteria 5330
72 Ga0070662_100012428 3300005457 Bacteria 5647
73 Ga0070681_10001331 3300005458 Bacteria 21599
74 Ga0070681_10002813 3300005458 Bacteria 16066
75 Ga0070681_10006390 3300005458 Bacteria 11461
76 Ga0070681_10037568 3300005458 Bacteria 4859
77 Ga0070681_10056458 3300005458 Bacteria 3907
78 Ga0070681_10059412 3300005458 Bacteria 3803
79 Ga0070681_10076944 3300005458 Bacteria 3294
80 Ga0070681_10141337 3300005458 Bacteria 2337
81 Ga0070681_10212126 3300005458 Bacteria 1852
82 Ga0068867_100117829 3300005459 Bacteria 2048
83 Ga0070685_10015830 3300005466 Bacteria 4010
84 Ga0070685_10023865 3300005466 Bacteria 3352
85 Ga0070706_100059962 3300005467 Bacteria 3512
86 Ga0070707_100003691 3300005468 Bacteria 14446
87 Ga0070698_100007769 3300005471 Bacteria 11607
88 Ga0070698_100035440 3300005471 Bacteria 5160
89 Ga0070699_100031001 3300005518 Bacteria 4617
90 Ga0070679_100001079 3300005530 Bacteria 23810
91 Ga0070679_100003303 3300005530 Bacteria 14766
92 Ga0070679_100003685 3300005530 Bacteria 14033
93 Ga0070679_100007922 3300005530 Bacteria 9969
94 Ga0070679_100012337 3300005530 Bacteria 8161
95 Ga0070679_100069254 3300005530 Bacteria 3519
96 Ga0070679_100106675 3300005530 Bacteria 2787
97 Ga0070684_100007651 3300005535 Bacteria 8422
98 Ga0070684_100011336 3300005535 Bacteria 7099
99 Ga0070684_100016128 3300005535 Bacteria 6103
100 Ga0070684_100030157 3300005535 Bacteria 4606
101 Ga0070684_100056498 3300005535 Bacteria 3426
102 Ga0070684_100094607 3300005535 Bacteria 2661
103 Ga0068853_100010729 3300005539 Bacteria 7419
104 Ga0068853_100057558 3300005539 Bacteria 3355
105 Ga0068853_100082510 3300005539 Bacteria 2816
106 Ga0068853_100227616 3300005539 Bacteria 1705
107 Ga0070672_100022113 3300005543 Bacteria 4664
108 Ga0070695_100009627 3300005545 Bacteria 5755
109 Ga0070696_100001866 3300005546 Bacteria 13828
110 Ga0070696_100002018 3300005546 Bacteria 13316
111 Ga0070693_100003134 3300005547 Bacteria 7676
112 Ga0070693_100079530 3300005547 Bacteria 1951
113 Ga0070665_100101893 3300005548 Bacteria 2875
114 Ga0068855_100013872 3300005563 Bacteria 9717
115 Ga0068855_100023214 3300005563 Bacteria 7431
116 Ga0068855_100053182 3300005563 Bacteria 4765
117 Ga0068855_100054479 3300005563 Bacteria 4701
118 Ga0068855_100155011 3300005563 Bacteria 2603
119 Ga0070664_100002710 3300005564 Bacteria 14298
120 Ga0070664_100004337 3300005564 Bacteria 11403
121 Ga0070664_100013870 3300005564 Bacteria 6570
122 Ga0070664_100016575 3300005564 Bacteria 6043
123 Ga0070664_100041646 3300005564 Bacteria 3876
124 Ga0070664_100146063 3300005564 Unclassified 2086
125 Ga0068857_100002009 3300005577 Bacteria 16498
126 Ga0068857_100003195 3300005577 Bacteria 13587
127 Ga0068857_100040808 3300005577 Bacteria 4114
128 Ga0068854_100014309 3300005578 Bacteria 5228
129 Ga0068856_100011027 3300005614 Bacteria 8778
130 Ga0068856_100023393 3300005614 Bacteria 6007
131 Ga0070702_100006017 3300005615 Bacteria 5711
132 Ga0068852_100007326 3300005616 Bacteria 8049
133 Ga0068852_100007447 3300005616 Bacteria 7988
134 Ga0068852_100025003 3300005616 Bacteria 4833
135 Ga0068852_100028942 3300005616 Bacteria 4543
136 Ga0068852_100045422 3300005616 Bacteria 3736
137 Ga0068859_100005678 3300005617 Bacteria 12697
138 Ga0068859_100006024 3300005617 Bacteria 12314
139 Ga0068864_100006837 3300005618 Bacteria 9344
140 Ga0068864_100013565 3300005618 Bacteria 6756
141 Ga0068866_10039026 3300005718 Bacteria 2342
142 Ga0068861_100003195 3300005719 Bacteria 10838
143 Ga0068851_10003195 3300005834 Bacteria 7267
144 Ga0068870_10011948 3300005840 Bacteria 4042
145 Ga0068870_10019045 3300005840 Bacteria 3324
146 Ga0068870_10062812 3300005840 Bacteria 2002
147 Ga0068870_10107521 3300005840 Bacteria 1587
148 Ga0068863_100009289 3300005841 Bacteria 9592
149 Ga0068863_100019005 3300005841 Bacteria 6576
150 Ga0068860_100020239 3300005843 Bacteria 6448
151 Ga0068860_100045743 3300005843 Bacteria 4173
152 Ga0068860_100049875 3300005843 Bacteria 3986
153 Ga0068862_100000229 3300005844 Bacteria 62419
154 Ga0081539_10000075 3300005985 Bacteria 229419
155 Ga0070717_10006388 3300006028 Bacteria 8663
156 Ga0070716_100001053 3300006173 Bacteria 12088
157 Ga0070712_100006896 3300006175 Bacteria 7079
158 Ga0070712_100059086 3300006175 Bacteria 2699
159 Ga0097621_100128042 3300006237 Bacteria 2158
160 Ga0068871_100005381 3300006358 Bacteria 8969
161 Ga0075430_100000977 3300006846 Bacteria 22548
162 Ga0075430_100015852 3300006846 Bacteria 6419
163 Ga0075430_100022088 3300006846 Bacteria 5409
164 Ga0075430_100145575 3300006846 Bacteria 1973
165 Ga0075431_100006199 3300006847 Bacteria 11872
166 Ga0075431_100032767 3300006847 Bacteria 5356
167 Ga0075431_100050429 3300006847 Bacteria 4292
168 Ga0075431_100101864 3300006847 Bacteria 2963
169 Ga0075433_10012623 3300006852 Bacteria 6833
170 Ga0075434_100016143 3300006871 Bacteria 7175
171 Ga0068865_100004160 3300006881 Bacteria 8705
172 Ga0075436_100007237 3300006914 Bacteria 7595
173 Ga0075436_100051249 3300006914 Bacteria 2849
174 Ga0097620_100005678 3300006931 Bacteria 12697
175 Ga0097620_100006024 3300006931 Bacteria 12314
176 Ga0075435_100053705 3300007076 Bacteria 3250
177 Ga0105240_10006565 3300009093 Bacteria 17080
178 Ga0105240_10012967 3300009093 Bacteria 11481
179 Ga0105240_10236794 3300009093 Bacteria 2118
180 Ga0111539_10040141 3300009094 Bacteria 5636
181 Ga0111539_10069724 3300009094 Bacteria 4151
182 Ga0111539_10094743 3300009094 Bacteria 3508
183 Ga0105245_10003976 3300009098 Bacteria 13147
184 Ga0105245_10012685 3300009098 Bacteria 7338
185 Ga0114129_10229938 3300009147 Bacteria 2498
186 Ga0114129_10393933 3300009147 Bacteria 1826
187 Ga0105241_10000038 3300009174 Bacteria 115211
188 Ga0105241_10026047 3300009174 Bacteria 4350
189 Ga0105242_10006958 3300009176 Bacteria 8729
190 Ga0105242_10067884 3300009176 Bacteria 2949
191 Ga0105242_10083977 3300009176 Bacteria 2667
192 Ga0105248_10012428 3300009177 Bacteria 9390
193 Ga0105248_10019003 3300009177 Bacteria 7597
194 Ga0105248_10031446 3300009177 Bacteria 5933
195 Ga0105248_10038227 3300009177 Bacteria 5371
196 Ga0105248_10122910 3300009177 Bacteria 2928
197 Ga0105248_10170267 3300009177 Bacteria 2454
198 Ga0105248_10271606 3300009177 Bacteria 1909
199 Ga0105237_10015149 3300009545 Bacteria 8034
200 Ga0105237_10180778 3300009545 Bacteria 2109
201 Ga0105238_10050739 3300009551 Bacteria 4175
202 Ga0105238_10076612 3300009551 Bacteria 3336
203 Ga0105249_10000179 3300009553 Bacteria 74358
204 Ga0105249_10000500 3300009553 Bacteria 36221
205 Ga0105249_10003579 3300009553 Bacteria 13446
206 Ga0105239_10023553 3300010375 Bacteria 6782
207 Ga0105239_10052123 3300010375 Bacteria 4486
208 Ga0105246_10086211 3300011119 Bacteria 2251
209 Ga0157373_10001342 3300013100 Bacteria 18845
210 Ga0157373_10011992 3300013100 Bacteria 6369
211 Ga0157373_10023727 3300013100 Bacteria 4445
212 Ga0157371_10011387 3300013102 Bacteria 6859
213 Ga0157371_10023593 3300013102 Bacteria 4499
214 Ga0157370_10019623 3300013104 Bacteria 6772
215 Ga0157370_10048869 3300013104 Bacteria 4052
216 Ga0157370_10099118 3300013104 Bacteria 2731
217 Ga0157369_10027603 3300013105 Bacteria 6290
218 Ga0157369_10039361 3300013105 Bacteria 5167
219 Ga0157369_10061678 3300013105 Bacteria 4041
220 Ga0157369_10152391 3300013105 Bacteria 2443
221 Ga0157369_10214971 3300013105 Bacteria 2014
222 Ga0163162_10044213 3300013306 Bacteria 4460
223 Ga0163162_10137837 3300013306 Bacteria 2551
224 Ga0163162_10270335 3300013306 Bacteria 1831
225 Ga0163162_10458649 3300013306 Bacteria 1406
226 Ga0157372_10001286 3300013307 Bacteria 27102
227 Ga0157372_10002576 3300013307 Bacteria 19635
228 Ga0157372_10005828 3300013307 Bacteria 13122
229 Ga0157372_10009880 3300013307 Bacteria 10150
230 Ga0157372_10012303 3300013307 Bacteria 9119
231 Ga0157372_10027594 3300013307 Bacteria 6186
232 Ga0157372_10030129 3300013307 Bacteria 5933
233 Ga0157372_10033951 3300013307 Bacteria 5606
234 Ga0157372_10154127 3300013307 Bacteria 2653
235 Ga0157372_10236922 3300013307 Bacteria 2117
236 Ga0157375_10010511 3300013308 Bacteria 8149
237 Ga0157375_10016870 3300013308 Bacteria 6575
238 Ga0157375_10017716 3300013308 Bacteria 6438
239 Ga0157375_10250313 3300013308 Bacteria 1932
240 Ga0157380_10030101 3300014326 Bacteria 4155
241 Ga0157377_10003710 3300014745 Bacteria 6932
242 Ga0157377_10008915 3300014745 Bacteria 4908
243 Ga0157379_10002157 3300014968 Bacteria 16336
244 Ga0157376_10298664 3300014969 Bacteria 1524
245 Ga0213876_10009860 3300021384 Bacteria 5140
246 Ga0207697_10001512 3300025315 Bacteria 12626
247 Ga0207656_10010370 3300025321 Bacteria 3490
248 Ga0207642_10013625 3300025899 Bacteria 2973
249 Ga0207642_10029588 3300025899 Bacteria 2270
250 Ga0207645_10006218 3300025907 Bacteria 8579
251 Ga0207645_10024968 3300025907 Bacteria 3871
252 Ga0207643_10032392 3300025908 Bacteria 2919
253 Ga0207643_10033139 3300025908 Bacteria 2890
254 Ga0207705_10001633 3300025909 Bacteria 17792
255 Ga0207705_10034143 3300025909 Bacteria 3636
256 Ga0207705_10106991 3300025909 Bacteria 2063
257 Ga0207654_10000036 3300025911 Bacteria 110335
258 Ga0207707_10000957 3300025912 Bacteria 27832
259 Ga0207707_10001498 3300025912 Bacteria 21543
260 Ga0207707_10011179 3300025912 Bacteria 7808
261 Ga0207707_10027829 3300025912 Bacteria 4942
262 Ga0207707_10091597 3300025912 Bacteria 2657
263 Ga0207707_10101291 3300025912 Bacteria 2517
264 Ga0207707_10122354 3300025912 Bacteria 2275
265 Ga0207695_10003752 3300025913 Bacteria 21114
266 Ga0207695_10021373 3300025913 Bacteria 7384
267 Ga0207695_10039186 3300025913 Bacteria 5095
268 Ga0207695_10052770 3300025913 Bacteria 4257
269 Ga0207695_10116142 3300025913 Bacteria 2650
270 Ga0207671_10029367 3300025914 Bacteria 4105
271 Ga0207693_10003221 3300025915 Bacteria 14009
272 Ga0207693_10007952 3300025915 Bacteria 8713
273 Ga0207663_10073805 3300025916 Bacteria 2209
274 Ga0207660_10000620 3300025917 Bacteria 23948
275 Ga0207660_10033881 3300025917 Bacteria 3536
276 Ga0207660_10087126 3300025917 Bacteria 2307
277 Ga0207660_10182699 3300025917 Bacteria 1629
278 Ga0207662_10001085 3300025918 Bacteria 12796
279 Ga0207662_10004243 3300025918 Bacteria 7517
280 Ga0207657_10003815 3300025919 Bacteria 16020
281 Ga0207657_10025799 3300025919 Bacteria 5413
282 Ga0207657_10034431 3300025919 Bacteria 4554
283 Ga0207649_10001716 3300025920 Bacteria 12604
284 Ga0207649_10005307 3300025920 Bacteria 6974
285 Ga0207649_10015233 3300025920 Bacteria 4319
286 Ga0207649_10027026 3300025920 Bacteria 3363
287 Ga0207652_10001152 3300025921 Bacteria 23796
288 Ga0207652_10004025 3300025921 Bacteria 12003
289 Ga0207652_10011150 3300025921 Bacteria 7246
290 Ga0207652_10013923 3300025921 Bacteria 6511
291 Ga0207652_10014395 3300025921 Bacteria 6409
292 Ga0207652_10024381 3300025921 Bacteria 5018
293 Ga0207652_10067373 3300025921 Bacteria 3104
294 Ga0207652_10190563 3300025921 Bacteria 1844
295 Ga0207681_10003650 3300025923 Bacteria 9569
296 Ga0207694_10093006 3300025924 Bacteria 2381
297 Ga0207650_10036440 3300025925 Bacteria 3579
298 Ga0207650_10101467 3300025925 Bacteria 2216
299 Ga0207659_10002479 3300025926 Bacteria 11000
300 Ga0207659_10064158 3300025926 Bacteria 2657
301 Ga0207659_10098101 3300025926 Bacteria 2203
302 Ga0207687_10039886 3300025927 Bacteria 3217
303 Ga0207664_10039777 3300025929 Bacteria 3651
304 Ga0207664_10107922 3300025929 Bacteria 2310
305 Ga0207664_10144268 3300025929 Bacteria 2017
306 Ga0207644_10087321 3300025931 Bacteria 2318
307 Ga0207644_10171536 3300025931 Bacteria 1694
308 Ga0207706_10000199 3300025933 Bacteria 65959
309 Ga0207706_10003868 3300025933 Bacteria 14250
310 Ga0207686_10013300 3300025934 Bacteria 4552
311 Ga0207686_10029057 3300025934 Bacteria 3257
312 Ga0207670_10152969 3300025936 Bacteria 1714
313 Ga0207669_10026750 3300025937 Bacteria 3145
314 Ga0207669_10066685 3300025937 Bacteria 2239
315 Ga0207665_10019109 3300025939 Bacteria 4502
316 Ga0207665_10097260 3300025939 Bacteria 2049
317 Ga0207691_10000514 3300025940 Bacteria 38482
318 Ga0207691_10029116 3300025940 Bacteria 5166
319 Ga0207691_10180901 3300025940 Bacteria 1842
320 Ga0207711_10012767 3300025941 Bacteria 6978
321 Ga0207711_10164940 3300025941 Bacteria 2008
322 Ga0207711_10231020 3300025941 Bacteria 1694
323 Ga0207689_10001988 3300025942 Bacteria 19303
324 Ga0207689_10003773 3300025942 Bacteria 13802
325 Ga0207661_10000618 3300025944 Bacteria 22824
326 Ga0207661_10006737 3300025944 Bacteria 8131
327 Ga0207661_10007188 3300025944 Bacteria 7910
328 Ga0207661_10017755 3300025944 Bacteria 5272
329 Ga0207661_10053990 3300025944 Bacteria 3218
330 Ga0207661_10089978 3300025944 Bacteria 2555
331 Ga0207661_10091256 3300025944 Bacteria 2538
332 Ga0207679_10000894 3300025945 Bacteria 19011
333 Ga0207679_10001743 3300025945 Bacteria 13548
334 Ga0207679_10007799 3300025945 Bacteria 6803
335 Ga0207679_10008383 3300025945 Bacteria 6582
336 Ga0207679_10024762 3300025945 Bacteria 4118
337 Ga0207679_10091880 3300025945 Bacteria 2350
338 Ga0207679_10101049 3300025945 Bacteria 2255
339 Ga0207667_10011681 3300025949 Bacteria 10188
340 Ga0207667_10021354 3300025949 Bacteria 7175
341 Ga0207667_10146116 3300025949 Bacteria 2434
342 Ga0207651_10045741 3300025960 Bacteria 2938
343 Ga0207712_10000233 3300025961 Bacteria 54527
344 Ga0207712_10000714 3300025961 Bacteria 25596
345 Ga0207712_10007627 3300025961 Bacteria 6840
346 Ga0207668_10024900 3300025972 Bacteria 3868
347 Ga0207668_10051516 3300025972 Bacteria 2844
348 Ga0207668_10053752 3300025972 Bacteria 2792
349 Ga0207640_10017133 3300025981 Bacteria 4232
350 Ga0207640_10018961 3300025981 Bacteria 4053
351 Ga0207640_10123780 3300025981 Bacteria 1858
352 Ga0207677_10028123 3300026023 Bacteria 3551
353 Ga0207703_10008961 3300026035 Bacteria 7883
354 Ga0207639_10084020 3300026041 Bacteria 2528
355 Ga0207639_10200260 3300026041 Bacteria 1712
356 Ga0207678_10000341 3300026067 Bacteria 42113
357 Ga0207678_10007947 3300026067 Bacteria 9357
358 Ga0207678_10106984 3300026067 Bacteria 2386
359 Ga0207702_10005922 3300026078 Bacteria 10620
360 Ga0207702_10210826 3300026078 Bacteria 1806
361 Ga0207641_10032742 3300026088 Bacteria 4317
362 Ga0207648_10100739 3300026089 Bacteria 2531
363 Ga0207648_10150545 3300026089 Bacteria 2053
364 Ga0207676_10002473 3300026095 Bacteria 13178
365 Ga0207676_10197155 3300026095 Bacteria 1776
366 Ga0207674_10000463 3300026116 Bacteria 53204
367 Ga0207674_10004300 3300026116 Bacteria 17180
368 Ga0207674_10005170 3300026116 Bacteria 15551
369 Ga0207674_10013642 3300026116 Bacteria 8999
370 Ga0207674_10016308 3300026116 Bacteria 8137
371 Ga0207674_10127013 3300026116 Bacteria 2516
372 Ga0207675_100000590 3300026118 Bacteria 35537
373 Ga0207675_100077601 3300026118 Bacteria 3112
374 Ga0207683_10209684 3300026121 Bacteria 1773
375 Ga0207698_10015018 3300026142 Bacteria 5171
376 Ga0207698_10088519 3300026142 Bacteria 2525
377 Ga0209998_10000853 3300027717 Bacteria 7846
378 Ga0268266_10087207 3300028379 Bacteria 2730
379 Ga0268265_10000907 3300028380 Bacteria 27403
380 Ga0268265_10052777 3300028380 Bacteria 3077
381 Ga0268264_10039097 3300028381 Bacteria 3919
382 Ga0268264_10048054 3300028381 Bacteria 3549
383 Ga0265332_10002433 3300031238 Bacteria 9496
384 Ga0265327_10043131 3300031251 Bacteria 2416
385 Ga0307408_100007533 3300031548 Bacteria 7196
386 Ga0307408_100016964 3300031548 Bacteria 4869
387 Ga0307408_100017128 3300031548 Bacteria 4848
388 Ga0307408_100028697 3300031548 Bacteria 3848
389 Ga0307408_100102228 3300031548 Bacteria 2186
390 Ga0265314_10004623 3300031711 Bacteria 12678
391 Ga0307405_10001007 3300031731 Bacteria 11367
392 Ga0307405_10001440 3300031731 Bacteria 10016
393 Ga0307405_10031437 3300031731 Bacteria 3125
394 Ga0307413_10000476 3300031824 Bacteria 13075
395 Ga0307413_10002777 3300031824 Bacteria 7217
396 Ga0307410_10001560 3300031852 Bacteria 10462
397 Ga0307410_10003916 3300031852 Bacteria 7578
398 Ga0307410_10014840 3300031852 Bacteria 4599
399 Ga0307410_10090725 3300031852 Bacteria 2168
400 Ga0307406_10001480 3300031901 Bacteria 12968
401 Ga0307406_10008088 3300031901 Bacteria 5858
402 Ga0307406_10020789 3300031901 Bacteria 3872
403 Ga0307406_10032917 3300031901 Bacteria 3168
404 Ga0307406_10073924 3300031901 Bacteria 2243
405 Ga0307406_10161601 3300031901 Bacteria 1611
406 Ga0307407_10018984 3300031903 Bacteria 3491
407 Ga0307407_10025752 3300031903 Bacteria 3105
408 Ga0307407_10072870 3300031903 Bacteria 2050
409 Ga0307412_10000752 3300031911 Bacteria 18803
410 Ga0307412_10015205 3300031911 Bacteria 4555
411 Ga0307412_10028413 3300031911 Bacteria 3498
412 Ga0307409_100005172 3300031995 Bacteria 7458
413 Ga0307409_100031695 3300031995 Bacteria 3820
414 Ga0307416_100003902 3300032002 Bacteria 8878
415 Ga0307416_100004019 3300032002 Bacteria 8781
416 Ga0307416_100018108 3300032002 Bacteria 4952
417 Ga0307416_100047719 3300032002 Bacteria 3392
418 Ga0307416_100051428 3300032002 Bacteria 3291
419 Ga0307416_100065165 3300032002 Bacteria 2992
420 Ga0307414_10001645 3300032004 Bacteria 11627
421 Ga0307414_10011603 3300032004 Bacteria 5175
422 Ga0307411_10000921 3300032005 Bacteria 11186
423 Ga0307411_10002803 3300032005 Bacteria 7851
424 Ga0307411_10006388 3300032005 Bacteria 5896
425 Ga0307415_100002359 3300032126 Bacteria 9392
426 Ga0307415_100004502 3300032126 Bacteria 7243
427 Ga0307415_100144729 3300032126 Bacteria 1820
428 Ga0373926_0006539 3300035083 Bacteria 3869
429 Ga0373934_0000377 3300035086 Bacteria 15599
430 Ga0373934_0004850 3300035086 Bacteria 4979
431 Ga0373944_0008037 3300035089 Bacteria 2845
432 Ga0373945_0004640 3300035116 Bacteria 4378
433 Ga0373954_0020756 3300035118 Bacteria 2973
434 Ga0373943_0002779 3300035170 Bacteria 7965
435 Ga0373955_0000409 3300035172 Bacteria 18249
436 Ga0373955_0005526 3300035172 Bacteria 5684
437 Ga0373955_0013544 3300035172 Bacteria 3947
438 Ga0373942_0008869 3300035207 Bacteria 2349
439 Ga0373935_0009017 3300035692 Bacteria 5967
440 Ga0373935_0051745 3300035692 Bacteria 2609
441 Ga0373927_0001092 3300035695 Bacteria 20629
442 Ga0373927_0053189 3300035695 Bacteria 2619
443 Ga0373933_0000834 3300035724 Bacteria 18838
444 Ga0373933_0011960 3300035724 Bacteria 4791
445 Ga0373933_0064107 3300035724 Bacteria 2222
446 Ga0373937_0000144 3300036401 Bacteria 68655
447 Ga0373937_0000650 3300036401 Bacteria 30511
448 Ga0373937_0124728 3300036401 Bacteria 2402
449 Ga0373925_0100497 3300037068 Bacteria 2223
450 Ga0395899_0120223 3300037312 Bacteria 1882
451 Ga0395905_0010711 3300037471 Bacteria 8893
452 Ga0395905_0176956 3300037471 Bacteria 2003
453 Ga0436365_0569538 3300039437 Bacteria 13116
454 Ga0436365_1907909 3300039437 Bacteria 6542
455 Ga0451577_0008421 3300042876 Bacteria 10038
456 Ga0451577_0069671 3300042876 Bacteria 3136
457 Ga0466966_0033611 3300044684 Bacteria 3320
458 Ga0453684_0002951 3300044712 Bacteria 39892
459 Ga0453684_0126724 3300044712 Bacteria 3071
460 Ga0453684_0164808 3300044712 Bacteria 2617
461 Ga0466959_0044024 3300045049 Bacteria 3289
462 Ga0466959_0077789 3300045049 Bacteria 2393
463 Ga0451576_0084068 3300045051 Bacteria 3311
464 Ga0451576_0149298 3300045051 Bacteria 2437
465 Ga0495592_0015783 3300046454 Bacteria 5730
466 Ga0495629_0007942 3300046459 Bacteria 7807
467 Ga0495629_0021458 3300046459 Bacteria 4609
468 Ga0495651_0003205 3300046462 Bacteria 12574
469 Ga0495651_0046230 3300046462 Bacteria 3369
470 Ga0495653_0003219 3300046463 Bacteria 13083
471 Ga0495653_0029844 3300046463 Bacteria 4347
472 Ga0495580_0002763 3300046472 Bacteria 15119
473 Ga0495639_0000725 3300046475 Bacteria 15099
474 Ga0495639_0014602 3300046475 Bacteria 3402
475 Ga0495664_0021864 3300046477 Bacteria 3698
476 Ga0495594_0014026 3300046499 Bacteria 4196
477 Ga0495594_0055895 3300046499 Bacteria 2177
478 Ga0495608_0002834 3300046511 Bacteria 12422
479 Ga0495618_0028219 3300046514 Bacteria 3498
480 Ga0495628_0014648 3300046516 Bacteria 6567
481 Ga0495630_0019015 3300046517 Bacteria 5049
482 Ga0495652_0007605 3300046529 Bacteria 9983
483 Ga0495652_0008810 3300046529 Bacteria 9184
484 Ga0495665_0001236 3300046531 Bacteria 13638
485 Ga0495665_0006089 3300046531 Bacteria 6509
486 Ga0495587_0000166 3300046536 Bacteria 47900
487 Ga0495587_0002958 3300046536 Bacteria 11361
488 Ga0495587_0033572 3300046536 Bacteria 3097
489 Ga0495587_0041632 3300046536 Bacteria 2740
490 Ga0495621_0002972 3300046539 Bacteria 4625
491 Ga0495645_0000326 3300046543 Bacteria 33842
492 Ga0495645_0001095 3300046543 Bacteria 18351
493 Ga0495645_0002080 3300046543 Bacteria 13611
494 Ga0495645_0106789 3300046543 Bacteria 1985
495 Ga0495667_0000758 3300046559 Bacteria 20776
496 Ga0495667_0004762 3300046559 Bacteria 9179
497 Ga0495667_0006909 3300046559 Bacteria 7698
498 Ga0495667_0017545 3300046559 Bacteria 4834
499 Ga0495635_0000671 3300046663 Bacteria 22005
500 Ga0495588_0000440 3300046674 Bacteria 21166
501 Ga0495657_0006588 3300046675 Bacteria 9070
502 Ga0495599_0009143 3300046678 Bacteria 6044
503 Ga0495599_0012828 3300046678 Bacteria 5172
504 Ga0495623_0000690 3300046679 Bacteria 22439
505 Ga0495623_0002178 3300046679 Bacteria 13059
506 Ga0495646_0010820 3300046680 Bacteria 5796
507 Ga0495647_0095217 3300046681 Unclassified 1226
508 Ga0495658_0000813 3300046683 Bacteria 16762
509 Ga0495658_0088552 3300046683 Bacteria 1830
510 Ga0495613_0015694 3300046689 Bacteria 5637
511 Ga0495613_0088644 3300046689 Bacteria 2242
512 Ga0495600_0011091 3300046809 Bacteria 5608
513 Ga0495581_0014913 3300047315 Bacteria 4507
514 Ga0495581_0051125 3300047315 Bacteria 2387
515 Ga0495581_0081904 3300047315 Bacteria 1869
516 Ga0495604_0000528 3300047317 Bacteria 33758
517 Ga0495604_0040571 3300047317 Bacteria 3654
518 Ga0495604_0090691 3300047317 Bacteria 2269
519 Ga0495672_0018440 3300047320 Bacteria 4631
520 Ga0495680_0004366 3300047322 Bacteria 13545
521 Ga0495675_0025399 3300047444 Bacteria 3777
522 Ga0495675_0055924 3300047444 Bacteria 2502
523 Ga0495684_0001711 3300047471 Bacteria 17655
524 Ga0495684_0005623 3300047471 Bacteria 9771
525 Ga0495684_0088250 3300047471 Bacteria 2350
526 Ga0495602_0000999 3300048088 Bacteria 27489
527 Ga0495602_0077031 3300048088 Bacteria 2823
528 Ga0495614_0000208 3300048089 Bacteria 22720
529 Ga0496105_0056785 3300048908 Bacteria 3232
530 Ga0496108_0036830 3300048911 Bacteria 4072
531 Ga0496112_0005153 3300048915 Bacteria 11241
532 Ga0496113_0011152 3300048916 Bacteria 5980
533 Ga0496113_0020739 3300048916 Bacteria 4626
534 Ga0496114_0067154 3300048917 Bacteria 3008
535 Ga0496115_0003337 3300048918 Bacteria 11517
536 Ga0496115_0055997 3300048918 Bacteria 3169
537 Ga0501033_0052032 3300049570 Bacteria 3035
538 Ga0501034_0185751 3300049571 Bacteria 2042
539 Ga0501037_0060399 3300049573 Bacteria 2765
540 Ga0501041_0064719 3300049577 Bacteria 2239
541 Ga0501043_0064560 3300049579 Bacteria 2875
542 Ga0501043_0082240 3300049579 Bacteria 2531
543 Ga0501043_0174518 3300049579 Bacteria 1676
544 Ga0501047_0010587 3300049581 Bacteria 8723
545 Ga0501070_0004188 3300049586 Bacteria 12419
546 Ga0501233_000726 3300049668 Bacteria 5467
547 Ga0501235_002966 3300049669 Bacteria 3657
548 Ga0501035_0091683 3300049822 Bacteria 2674
549 Ga0501044_0005033 3300049823 Bacteria 14758
550 nmdc:mga09592_45403_c1 3300050508 Bacteria 3701
551 nmdc:mga0qj67_134660_c1 3300050509 Bacteria 2002
552 nmdc:mga0qj67_23764_c1 3300050509 Bacteria 4719
553 nmdc:mga0qj67_7025_c1 3300050509 Bacteria 8300
554 nmdc:mga06r32_181891_c1 3300050510 Bacteria 2088
555 nmdc:mga06r32_208377_c1 3300050510 Bacteria 1943
556 nmdc:mga06r32_211846_c1 3300050510 Bacteria 1925
557 nmdc:mga06r32_42670_c1 3300050510 Bacteria 4314
558 nmdc:mga06r32_69456_c1 3300050510 Bacteria 3405
559 nmdc:mga0n895_22608_c1 3300050512 Bacteria 5898
560 nmdc:mga0n895_288269_c1 3300050512 Bacteria 1664
561 nmdc:mga0n895_46853_c1 3300050512 Bacteria 4225
562 nmdc:mga08x19_21178_c1 3300050514 Bacteria 4009
563 nmdc:mga08x19_90851_c1 3300050514 Bacteria 2015
564 nmdc:mga0a205_25235_c2 3300050515 Bacteria 2796
565 Ga0495601_0002258 3300053077 Bacteria 10864
566 Ga0495612_0005723 3300053078 Bacteria 5133
567 Ga0495612_0027939 3300053078 Bacteria 2270
568 Ga0495619_0001963 3300053085 Bacteria 13717
569 Ga0501082_0125107 3300060353 Bacteria 2230
570 Ga0070683_100130856
571 Ga0065715_10113160
572 Ga0065715_10114887
573 Ga0065707_10146122
574 Ga0070658_10000462
575 Ga0070658_10000643
576 Ga0070658_10010396
577 Ga0070658_10163218
578 Ga0070676_10004464
579 Ga0070676_10008319
580 Ga0070676_10011893
581 Ga0070683_100001277
582 Ga0070683_100002152
583 Ga0070683_100004172
584 Ga0070683_100006638
585 Ga0070683_100013547
586 Ga0070683_100024237
587 Ga0070683_100033835
588 Ga0070683_100056553
589 Ga0070690_100013595
590 Ga0070690_100014582
591 Ga0070670_100018242
592 Ga0070670_100023705
593 Ga0070670_100036585
594 Ga0070670_100098075
595 Ga0068869_100005888
596 Ga0070680_100003233
597 Ga0070680_100006572
598 Ga0070680_100007386
599 Ga0070680_100011660
600 Ga0070680_100198821
601 Ga0070682_100002205
602 Ga0070682_100010116
603 Ga0070660_100001501
604 Ga0070691_10065658
605 Ga0070687_100001648
606 Ga0070661_100004878
607 Ga0070661_100010649
608 Ga0070661_100029442
609 Ga0070661_100074858
610 Ga0070692_10001546
611 Ga0070692_10075144
612 Ga0070668_100000578
613 Ga0070668_100005648
614 Ga0070668_100019016
615 Ga0070668_100036909
616 Ga0070668_100065055
617 Ga0070669_100003488
618 Ga0070669_100068749
619 Ga0070675_100004354
620 Ga0070675_100039786
621 Ga0070675_100104310
622 Ga0070674_100094251
623 Ga0070673_100056335
624 Ga0070673_100099062
625 Ga0070659_100003040
626 Ga0070659_100007173
627 Ga0070659_100025677
628 Ga0070659_100066433
629 Ga0070714_100004979
630 Ga0070714_100030965
631 Ga0070714_100035857
632 Ga0070713_100004104
633 Ga0070713_100096378
634 Ga0070701_10048016
635 Ga0070700_100026161
636 Ga0070694_100088618
637 Ga0070708_100000006
638 Ga0070708_100000202
639 Ga0070708_100038164
640 Ga0070663_100012749
641 Ga0070662_100012428
642 Ga0070681_10001331
643 Ga0070681_10002813
644 Ga0070681_10006390
645 Ga0070681_10037568
646 Ga0070681_10056458
647 Ga0070681_10059412
648 Ga0070681_10076944
649 Ga0070681_10141337
650 Ga0070681_10212126
651 Ga0068867_100117829
652 Ga0070685_10015830
653 Ga0070685_10023865
654 Ga0070706_100059962
655 Ga0070707_100003691
656 Ga0070698_100007769
657 Ga0070698_100035440
658 Ga0070699_100031001
659 Ga0070679_100001079
660 Ga0070679_100003303
661 Ga0070679_100003685
662 Ga0070679_100007922
663 Ga0070679_100012337
664 Ga0070679_100069254
665 Ga0070679_100106675
666 Ga0070684_100007651
667 Ga0070684_100011336
668 Ga0070684_100016128
669 Ga0070684_100030157
670 Ga0070684_100056498
671 Ga0070684_100094607
672 Ga0068853_100010729
673 Ga0068853_100057558
674 Ga0068853_100082510
675 Ga0068853_100227616
676 Ga0070672_100022113
677 Ga0070695_100009627
678 Ga0070696_100001866
679 Ga0070696_100002018
680 Ga0070693_100003134
681 Ga0070693_100079530
682 Ga0070665_100101893
683 Ga0068855_100013872
684 Ga0068855_100023214
685 Ga0068855_100053182
686 Ga0068855_100054479
687 Ga0068855_100155011
688 Ga0070664_100002710
689 Ga0070664_100004337
690 Ga0070664_100013870
691 Ga0070664_100016575
692 Ga0070664_100041646
693 Ga0070664_100146063
694 Ga0068857_100002009
695 Ga0068857_100003195
696 Ga0068857_100040808
697 Ga0068854_100014309
698 Ga0068856_100011027
699 Ga0068856_100023393
700 Ga0070702_100006017
701 Ga0068852_100007326
702 Ga0068852_100007447
703 Ga0068852_100025003
704 Ga0068852_100028942
705 Ga0068852_100045422
706 Ga0068859_100005678
707 Ga0068859_100006024
708 Ga0068864_100006837
709 Ga0068864_100013565
710 Ga0068866_10039026
711 Ga0068861_100003195
712 Ga0068851_10003195
713 Ga0068870_10011948
714 Ga0068870_10019045
715 Ga0068870_10062812
716 Ga0068870_10107521
717 Ga0068863_100009289
718 Ga0068863_100019005
719 Ga0068860_100020239
720 Ga0068860_100045743
721 Ga0068860_100049875
722 Ga0068862_100000229
723 Ga0081539_10000075
724 Ga0070717_10006388
725 Ga0070716_100001053
726 Ga0070712_100006896
727 Ga0070712_100059086
728 Ga0097621_100128042
729 Ga0068871_100005381
730 Ga0075430_100000977
731 Ga0075430_100015852
732 Ga0075430_100022088
733 Ga0075430_100145575
734 Ga0075431_100006199
735 Ga0075431_100032767
736 Ga0075431_100050429
737 Ga0075431_100101864
738 Ga0075433_10012623
739 Ga0075434_100016143
740 Ga0068865_100004160
741 Ga0075436_100007237
742 Ga0075436_100051249
743 Ga0097620_100005678
744 Ga0097620_100006024
745 Ga0075435_100053705
746 Ga0105240_10006565
747 Ga0105240_10012967
748 Ga0105240_10236794
749 Ga0111539_10040141
750 Ga0111539_10069724
751 Ga0111539_10094743
752 Ga0105245_10003976
753 Ga0105245_10012685
754 Ga0114129_10229938
755 Ga0114129_10393933
756 Ga0105241_10000038
757 Ga0105241_10026047
758 Ga0105242_10006958
759 Ga0105242_10067884
760 Ga0105242_10083977
761 Ga0105248_10012428
762 Ga0105248_10019003
763 Ga0105248_10031446
764 Ga0105248_10038227
765 Ga0105248_10122910
766 Ga0105248_10170267
767 Ga0105248_10271606
768 Ga0105237_10015149
769 Ga0105237_10180778
770 Ga0105238_10050739
771 Ga0105238_10076612
772 Ga0105249_10000179
773 Ga0105249_10000500
774 Ga0105249_10003579
775 Ga0105239_10023553
776 Ga0105239_10052123
777 Ga0105246_10086211
778 Ga0157373_10001342
779 Ga0157373_10011992
780 Ga0157373_10023727
781 Ga0157371_10011387
782 Ga0157371_10023593
783 Ga0157370_10019623
784 Ga0157370_10048869
785 Ga0157370_10099118
786 Ga0157369_10027603
787 Ga0157369_10039361
788 Ga0157369_10061678
789 Ga0157369_10152391
790 Ga0157369_10214971
791 Ga0163162_10044213
792 Ga0163162_10137837
793 Ga0163162_10270335
794 Ga0163162_10458649
795 Ga0157372_10001286
796 Ga0157372_10002576
797 Ga0157372_10005828
798 Ga0157372_10009880
799 Ga0157372_10012303
800 Ga0157372_10027594
801 Ga0157372_10030129
802 Ga0157372_10033951
803 Ga0157372_10154127
804 Ga0157372_10236922
805 Ga0157375_10010511
806 Ga0157375_10016870
807 Ga0157375_10017716
808 Ga0157375_10250313
809 Ga0157380_10030101
810 Ga0157377_10003710
811 Ga0157377_10008915
812 Ga0157379_10002157
813 Ga0157376_10298664
814 Ga0213876_10009860
815 Ga0207697_10001512
816 Ga0207656_10010370
817 Ga0207642_10013625
818 Ga0207642_10029588
819 Ga0207645_10006218
820 Ga0207645_10024968
821 Ga0207643_10032392
822 Ga0207643_10033139
823 Ga0207705_10001633
824 Ga0207705_10034143
825 Ga0207705_10106991
826 Ga0207654_10000036
827 Ga0207707_10000957
828 Ga0207707_10001498
829 Ga0207707_10011179
830 Ga0207707_10027829
831 Ga0207707_10091597
832 Ga0207707_10101291
833 Ga0207707_10122354
834 Ga0207695_10003752
835 Ga0207695_10021373
836 Ga0207695_10039186
837 Ga0207695_10052770
838 Ga0207695_10116142
839 Ga0207671_10029367
840 Ga0207693_10003221
841 Ga0207693_10007952
842 Ga0207663_10073805
843 Ga0207660_10000620
844 Ga0207660_10033881
845 Ga0207660_10087126
846 Ga0207660_10182699
847 Ga0207662_10001085
848 Ga0207662_10004243
849 Ga0207657_10003815
850 Ga0207657_10025799
851 Ga0207657_10034431
852 Ga0207649_10001716
853 Ga0207649_10005307
854 Ga0207649_10015233
855 Ga0207649_10027026
856 Ga0207652_10001152
857 Ga0207652_10004025
858 Ga0207652_10011150
859 Ga0207652_10013923
860 Ga0207652_10014395
861 Ga0207652_10024381
862 Ga0207652_10067373
863 Ga0207652_10190563
864 Ga0207681_10003650
865 Ga0207694_10093006
866 Ga0207650_10036440
867 Ga0207650_10101467
868 Ga0207659_10002479
869 Ga0207659_10064158
870 Ga0207659_10098101
871 Ga0207687_10039886
872 Ga0207664_10039777
873 Ga0207664_10107922
874 Ga0207664_10144268
875 Ga0207644_10087321
876 Ga0207644_10171536
877 Ga0207706_10000199
878 Ga0207706_10003868
879 Ga0207686_10013300
880 Ga0207686_10029057
881 Ga0207670_10152969
882 Ga0207669_10026750
883 Ga0207669_10066685
884 Ga0207665_10019109
885 Ga0207665_10097260
886 Ga0207691_10000514
887 Ga0207691_10029116
888 Ga0207691_10180901
889 Ga0207711_10012767
890 Ga0207711_10164940
891 Ga0207711_10231020
892 Ga0207689_10001988
893 Ga0207689_10003773
894 Ga0207661_10000618
895 Ga0207661_10006737
896 Ga0207661_10007188
897 Ga0207661_10017755
898 Ga0207661_10053990
899 Ga0207661_10089978
900 Ga0207661_10091256
901 Ga0207679_10000894
902 Ga0207679_10001743
903 Ga0207679_10007799
904 Ga0207679_10008383
905 Ga0207679_10024762
906 Ga0207679_10091880
907 Ga0207679_10101049
908 Ga0207667_10011681
909 Ga0207667_10021354
910 Ga0207667_10146116
911 Ga0207651_10045741
912 Ga0207712_10000233
913 Ga0207712_10000714
914 Ga0207712_10007627
915 Ga0207668_10024900
916 Ga0207668_10051516
917 Ga0207668_10053752
918 Ga0207640_10017133
919 Ga0207640_10018961
920 Ga0207640_10123780
921 Ga0207677_10028123
922 Ga0207703_10008961
923 Ga0207639_10084020
924 Ga0207639_10200260
925 Ga0207678_10000341
926 Ga0207678_10007947
927 Ga0207678_10106984
928 Ga0207702_10005922
929 Ga0207702_10210826
930 Ga0207641_10032742
931 Ga0207648_10100739
932 Ga0207648_10150545
933 Ga0207676_10002473
934 Ga0207676_10197155
935 Ga0207674_10000463
936 Ga0207674_10004300
937 Ga0207674_10005170
938 Ga0207674_10013642
939 Ga0207674_10016308
940 Ga0207674_10127013
941 Ga0207675_100000590
942 Ga0207675_100077601
943 Ga0207683_10209684
944 Ga0207698_10015018
945 Ga0207698_10088519
946 Ga0209998_10000853
947 Ga0268266_10087207
948 Ga0268265_10000907
949 Ga0268265_10052777
950 Ga0268264_10039097
951 Ga0268264_10048054
952 Ga0265332_10002433
953 Ga0265327_10043131
954 Ga0307408_100007533
955 Ga0307408_100016964
956 Ga0307408_100017128
957 Ga0307408_100028697
958 Ga0307408_100102228
959 Ga0265314_10004623
960 Ga0307405_10001007
961 Ga0307405_10001440
962 Ga0307405_10031437
963 Ga0307413_10000476
964 Ga0307413_10002777
965 Ga0307410_10001560
966 Ga0307410_10003916
967 Ga0307410_10014840
968 Ga0307410_10090725
969 Ga0307406_10001480
970 Ga0307406_10008088
971 Ga0307406_10020789
972 Ga0307406_10032917
973 Ga0307406_10073924
974 Ga0307406_10161601
975 Ga0307407_10018984
976 Ga0307407_10025752
977 Ga0307407_10072870
978 Ga0307412_10000752
979 Ga0307412_10015205
980 Ga0307412_10028413
981 Ga0307409_100005172
982 Ga0307409_100031695
983 Ga0307416_100003902
984 Ga0307416_100004019
985 Ga0307416_100018108
986 Ga0307416_100047719
987 Ga0307416_100051428
988 Ga0307416_100065165
989 Ga0307414_10001645
990 Ga0307414_10011603
991 Ga0307411_10000921
992 Ga0307411_10002803
993 Ga0307411_10006388
994 Ga0307415_100002359
995 Ga0307415_100004502
996 Ga0307415_100144729
997 Ga0373926_0006539
998 Ga0373934_0000377
999 Ga0373934_0004850
1000 Ga0373944_0008037
1001 Ga0373945_0004640
1002 Ga0373954_0020756
1003 Ga0373943_0002779
1004 Ga0373955_0000409
1005 Ga0373955_0005526
1006 Ga0373955_0013544
1007 Ga0373942_0008869
1008 Ga0373935_0009017
1009 Ga0373935_0051745
1010 Ga0373927_0001092
1011 Ga0373927_0053189
1012 Ga0373933_0000834
1013 Ga0373933_0011960
1014 Ga0373933_0064107
1015 Ga0373937_0000144
1016 Ga0373937_0000650
1017 Ga0373937_0124728
1018 Ga0373925_0100497
1019 Ga0395899_0120223
1020 Ga0395905_0010711
1021 Ga0395905_0176956
1022 Ga0436365_0569538
1023 Ga0436365_1907909
1024 Ga0451577_0008421
1025 Ga0451577_0069671
1026 Ga0466966_0033611
1027 Ga0453684_0002951
1028 Ga0453684_0126724
1029 Ga0453684_0164808
1030 Ga0466959_0044024
1031 Ga0466959_0077789
1032 Ga0451576_0084068
1033 Ga0451576_0149298
1034 Ga0495592_0015783
1035 Ga0495629_0007942
1036 Ga0495629_0021458
1037 Ga0495651_0003205
1038 Ga0495651_0046230
1039 Ga0495653_0003219
1040 Ga0495653_0029844
1041 Ga0495580_0002763
1042 Ga0495639_0000725
1043 Ga0495639_0014602
1044 Ga0495664_0021864
1045 Ga0495594_0014026
1046 Ga0495594_0055895
1047 Ga0495608_0002834
1048 Ga0495618_0028219
1049 Ga0495628_0014648
1050 Ga0495630_0019015
1051 Ga0495652_0007605
1052 Ga0495652_0008810
1053 Ga0495665_0001236
1054 Ga0495665_0006089
1055 Ga0495587_0000166
1056 Ga0495587_0002958
1057 Ga0495587_0033572
1058 Ga0495587_0041632
1059 Ga0495621_0002972
1060 Ga0495645_0000326
1061 Ga0495645_0001095
1062 Ga0495645_0002080
1063 Ga0495645_0106789
1064 Ga0495667_0000758
1065 Ga0495667_0004762
1066 Ga0495667_0006909
1067 Ga0495667_0017545
1068 Ga0495635_0000671
1069 Ga0495588_0000440
1070 Ga0495657_0006588
1071 Ga0495599_0009143
1072 Ga0495599_0012828
1073 Ga0495623_0000690
1074 Ga0495623_0002178
1075 Ga0495646_0010820
1076 Ga0495647_0095217
1077 Ga0495658_0000813
1078 Ga0495658_0088552
1079 Ga0495613_0015694
1080 Ga0495613_0088644
1081 Ga0495600_0011091
1082 Ga0495581_0014913
1083 Ga0495581_0051125
1084 Ga0495581_0081904
1085 Ga0495604_0000528
1086 Ga0495604_0040571
1087 Ga0495604_0090691
1088 Ga0495672_0018440
1089 Ga0495680_0004366
1090 Ga0495675_0025399
1091 Ga0495675_0055924
1092 Ga0495684_0001711
1093 Ga0495684_0005623
1094 Ga0495684_0088250
1095 Ga0495602_0000999
1096 Ga0495602_0077031
1097 Ga0495614_0000208
1098 Ga0496105_0056785
1099 Ga0496108_0036830
1100 Ga0496112_0005153
1101 Ga0496113_0011152
1102 Ga0496113_0020739
1103 Ga0496114_0067154
1104 Ga0496115_0003337
1105 Ga0496115_0055997
1106 Ga0501033_0052032
1107 Ga0501034_0185751
1108 Ga0501037_0060399
1109 Ga0501041_0064719
1110 Ga0501043_0064560
1111 Ga0501043_0082240
1112 Ga0501043_0174518
1113 Ga0501047_0010587
1114 Ga0501070_0004188
1115 Ga0501233_000726
1116 Ga0501235_002966
1117 Ga0501035_0091683
1118 Ga0501044_0005033
1119 nmdc:mga09592_45403_c1
1120 nmdc:mga0qj67_134660_c1
1121 nmdc:mga0qj67_23764_c1
1122 nmdc:mga0qj67_7025_c1
1123 nmdc:mga06r32_181891_c1
1124 nmdc:mga06r32_208377_c1
1125 nmdc:mga06r32_211846_c1
1126 nmdc:mga06r32_42670_c1
1127 nmdc:mga06r32_69456_c1
1128 nmdc:mga0n895_22608_c1
1129 nmdc:mga0n895_288269_c1
1130 nmdc:mga0n895_46853_c1
1131 nmdc:mga08x19_21178_c1
1132 nmdc:mga08x19_90851_c1
1133 nmdc:mga0a205_25235_c2
1134 Ga0495601_0002258
1135 Ga0495612_0005723
1136 Ga0495612_0027939
1137 Ga0495619_0001963
1138 Ga0501082_0125107

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00919

UPF0004

Uncharacterized protein family UPF0004

31

130

0.97

PF18693

TRAM_2

TRAM domain

398

460

0.93

PF04055

Radical_SAM

Radical SAM superfamily

170

342

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9448 137 432
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9383 133 432
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.935 133 432
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9347 137 432
4jc0-assembly2.cif.gz_B crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77 0.9131 4 432
ID Description Score Start End Superfamily
4jc0B03 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9691 251 364 3.30.750.200
af_F1LV76_14_128_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9586 250 357 3.30.750.200
af_A0A0R0IRV7_127_250_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9396 242 354 3.30.750.200
2qgqC01 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9375 136 369 3.80.30.20
af_Q2FXZ6_140_373_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.932 137 364 3.80.30.20
ID Description Score Start End GO Terms
AF-A0A2M7XLY8-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9912 259 356 GO:0005829
GO:0035597
GO:0051539
AF-A0A831P1S6-F1-model_v4 30S ribosomal protein S12 methylthiotransferase RimO 0.9786 2 102 GO:0005829
GO:0005840
GO:0035599
GO:0046872
GO:0051539
AF-A0A355UA07-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9741 221 363 GO:0005829
GO:0035597
GO:0046872
GO:0051539
AF-X1T5A3-F1-model_v4 Radical SAM core domain-containing protein 0.9719 167 338 GO:0035598
GO:0051536
AF-A0A357D051-F1-model_v4 30S ribosomal protein S12 methylthiotransferase RimO 0.9709 217 309 GO:0005829
GO:0005840
GO:0035599
GO:0051539

Map