F464607

General Info

Members Datasets Scaffolds Average Seq Length
568 218 568 248

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100006709|Ga0068856_1000067097
Length 295
Sequence MNPLRRSRRSLRRLDCACSQIHCVSYTYQLQRISLEPAARLAFGPSRHMRTLQTVEISKSYSGRRVVDNVTVRVGQGEVVGLLGPNGAGKTTSFYIIVGLISPESGEVLLDGKSITPLPMYQRARRGVSYLPQEPSVFRKLSVEDNLMAILQTLPLNGRERRERMNVLIEDMGLETVRHSKGYMLSGGERRRVEIARSLVLQPDFILLDEPFSGIDPIQVLELQRIIGDLKRKGIGILVTDHNVRETLAVTDRAYIISSGRIFRAGSPESLGNDPEVRRIYLGENFYFPPVLAGQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 0.7
Rhizosphere 92.96
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100000008 3300005329 Bacteria 329206
2 Ga0070683_100001900 3300005329 Bacteria 16333
3 Ga0070683_100014842 3300005329 Bacteria 6829
4 Ga0070683_100037407 3300005329 Bacteria 4443
5 Ga0070683_100079582 3300005329 Bacteria 3067
6 Ga0070683_100225677 3300005329 Bacteria 1780
7 Ga0070683_100482516 3300005329 Bacteria 1184
8 Ga0068869_100052850 3300005334 Bacteria 2951
9 Ga0068869_100226762 3300005334 Bacteria 1483
10 Ga0070666_10055652 3300005335 Bacteria 2670
11 Ga0070666_10331947 3300005335 Bacteria 1086
12 Ga0070680_100000677 3300005336 Bacteria 23667
13 Ga0070680_100260766 3300005336 Bacteria 1466
14 Ga0070680_100314890 3300005336 Bacteria 1328
15 Ga0070660_100009046 3300005339 Bacteria 6989
16 Ga0070660_100026524 3300005339 Bacteria 4314
17 Ga0070660_100061874 3300005339 Bacteria 2907
18 Ga0070660_100140177 3300005339 Bacteria 1939
19 Ga0070691_10015204 3300005341 Bacteria 3536
20 Ga0070687_100478053 3300005343 Bacteria 834
21 Ga0070661_100038345 3300005344 Bacteria 3488
22 Ga0070668_100178369 3300005347 Bacteria 1734
23 Ga0070669_100380405 3300005353 Bacteria 1151
24 Ga0070674_100036703 3300005356 Bacteria 3292
25 Ga0070673_100011878 3300005364 Bacteria 5962
26 Ga0070673_100145132 3300005364 Bacteria 2006
27 Ga0070673_100447870 3300005364 Bacteria 1161
28 Ga0070659_100065655 3300005366 Bacteria 2874
29 Ga0070667_100436781 3300005367 Bacteria 1195
30 Ga0070709_10106055 3300005434 Bacteria 1881
31 Ga0070714_100002199 3300005435 Bacteria 14362
32 Ga0070714_100066908 3300005435 Bacteria 3097
33 Ga0070714_100119549 3300005435 Bacteria 2342
34 Ga0070714_100517729 3300005435 Bacteria 1139
35 Ga0070714_100569380 3300005435 Bacteria 1086
36 Ga0070713_100003787 3300005436 Bacteria 10015
37 Ga0070713_100007840 3300005436 Bacteria 7528
38 Ga0070713_100148944 3300005436 Bacteria 2080
39 Ga0070713_100174044 3300005436 Bacteria 1930
40 Ga0070713_100316474 3300005436 Unclassified 1440
41 Ga0070701_10103267 3300005438 Bacteria 1582
42 Ga0070711_100007987 3300005439 Bacteria 6459
43 Ga0070711_100010318 3300005439 Bacteria 5778
44 Ga0070711_100048495 3300005439 Bacteria 2905
45 Ga0070711_100125161 3300005439 Bacteria 1907
46 Ga0070705_100099200 3300005440 Bacteria 1835
47 Ga0070681_10007191 3300005458 Bacteria 10848
48 Ga0070681_10017934 3300005458 Bacteria 7076
49 Ga0070681_10081737 3300005458 Bacteria 3187
50 Ga0070681_10145649 3300005458 Bacteria 2298
51 Ga0070681_10228452 3300005458 Bacteria 1775
52 Ga0068867_100269336 3300005459 Bacteria 1392
53 Ga0070679_100028687 3300005530 Bacteria 5489
54 Ga0070679_100116873 3300005530 Bacteria 2652
55 Ga0070679_100162172 3300005530 Bacteria 2210
56 Ga0070679_100569882 3300005530 Bacteria 1076
57 Ga0070679_100781188 3300005530 Bacteria 898
58 Ga0070684_100000002 3300005535 Bacteria 257669
59 Ga0070684_100003837 3300005535 Bacteria 11361
60 Ga0070684_100022567 3300005535 Bacteria 5252
61 Ga0070684_100074730 3300005535 Bacteria 2988
62 Ga0070684_100571768 3300005535 Bacteria 1050
63 Ga0070686_100177528 3300005544 Bacteria 1511
64 Ga0070695_100177298 3300005545 Bacteria 1508
65 Ga0070695_100257203 3300005545 Bacteria 1274
66 Ga0070665_100085135 3300005548 Bacteria 3167
67 Ga0070665_100261525 3300005548 Bacteria 1732
68 Ga0070665_100291856 3300005548 Bacteria 1633
69 Ga0070665_100395535 3300005548 Bacteria 1390
70 Ga0070665_100510306 3300005548 Bacteria 1214
71 Ga0068855_100009996 3300005563 Bacteria 11432
72 Ga0068855_100015477 3300005563 Bacteria 9183
73 Ga0068855_100016105 3300005563 Bacteria 8989
74 Ga0068855_100017428 3300005563 Bacteria 8640
75 Ga0068855_100060397 3300005563 Bacteria 4433
76 Ga0068855_100063730 3300005563 Bacteria 4300
77 Ga0068855_100103223 3300005563 Bacteria 3281
78 Ga0068855_100162916 3300005563 Bacteria 2530
79 Ga0068855_100174102 3300005563 Bacteria 2436
80 Ga0068855_100296764 3300005563 Bacteria 1790
81 Ga0068855_100724929 3300005563 Bacteria 1062
82 Ga0068857_100003127 3300005577 Bacteria 13693
83 Ga0068857_100110224 3300005577 Bacteria 2473
84 Ga0068854_100138297 3300005578 Bacteria 1866
85 Ga0068856_100005417 3300005614 Bacteria 12572
86 Ga0068856_100006709 3300005614 Bacteria 11280
87 Ga0068856_100016973 3300005614 Bacteria 7057
88 Ga0068856_100053461 3300005614 Bacteria 3982
89 Ga0068856_100058410 3300005614 Bacteria 3809
90 Ga0068856_100118342 3300005614 Bacteria 2650
91 Ga0068856_100422736 3300005614 Bacteria 1352
92 Ga0068852_100008659 3300005616 Bacteria 7518
93 Ga0068852_100060397 3300005616 Bacteria 3290
94 Ga0068852_100282565 3300005616 Bacteria 1600
95 Ga0068859_100055438 3300005617 Bacteria 3989
96 Ga0068859_100199818 3300005617 Bacteria 2084
97 Ga0068859_100370362 3300005617 Bacteria 1528
98 Ga0068859_100997121 3300005617 Bacteria 920
99 Ga0068864_100223655 3300005618 Bacteria 1737
100 Ga0068866_10006279 3300005718 Bacteria 4946
101 Ga0068861_100874459 3300005719 Bacteria 849
102 Ga0068863_100091762 3300005841 Bacteria 2880
103 Ga0068863_100259366 3300005841 Bacteria 1680
104 Ga0068863_100297219 3300005841 Bacteria 1566
105 Ga0068858_100038124 3300005842 Bacteria 4457
106 Ga0068858_100054904 3300005842 Bacteria 3683
107 Ga0068858_100107109 3300005842 Bacteria 2609
108 Ga0068858_100250634 3300005842 Bacteria 1682
109 Ga0068860_100005181 3300005843 Bacteria 13253
110 Ga0068860_100323128 3300005843 Bacteria 1515
111 Ga0081455_10043488 3300005937 Bacteria 3928
112 Ga0070717_10009055 3300006028 Bacteria 7473
113 Ga0070717_10016370 3300006028 Bacteria 5749
114 Ga0070717_10037014 3300006028 Bacteria 3960
115 Ga0070717_10270977 3300006028 Bacteria 1504
116 Ga0070712_100435498 3300006175 Bacteria 1089
117 Ga0097621_100076451 3300006237 Bacteria 2778
118 Ga0097621_100153476 3300006237 Bacteria 1976
119 Ga0068871_100029962 3300006358 Bacteria 4280
120 Ga0068871_100053583 3300006358 Bacteria 3270
121 Ga0068871_100197464 3300006358 Bacteria 1736
122 Ga0068871_100542794 3300006358 Bacteria 1052
123 Ga0075430_100069294 3300006846 Bacteria 2959
124 Ga0075429_100372687 3300006880 Bacteria 1250
125 Ga0075436_100021873 3300006914 Bacteria 4391
126 Ga0097620_100055437 3300006931 Bacteria 3989
127 Ga0097620_100199802 3300006931 Bacteria 2084
128 Ga0097620_100370327 3300006931 Bacteria 1528
129 Ga0097620_100996879 3300006931 Bacteria 920
130 Ga0105240_10000429 3300009093 Bacteria 77882
131 Ga0105240_10005328 3300009093 Bacteria 19189
132 Ga0105240_10007071 3300009093 Bacteria 16360
133 Ga0105240_10008797 3300009093 Bacteria 14382
134 Ga0105240_10014961 3300009093 Bacteria 10571
135 Ga0105240_10016627 3300009093 Bacteria 9950
136 Ga0105240_10034152 3300009093 Bacteria 6564
137 Ga0105240_10034531 3300009093 Bacteria 6522
138 Ga0105240_10186563 3300009093 Bacteria 2442
139 Ga0105240_10318326 3300009093 Bacteria 1774
140 Ga0105240_10814909 3300009093 Bacteria 1010
141 Ga0105240_10906886 3300009093 Bacteria 948
142 Ga0105245_10000273 3300009098 Bacteria 49064
143 Ga0105245_10000579 3300009098 Bacteria 33283
144 Ga0105245_10017701 3300009098 Bacteria 6221
145 Ga0105245_10087169 3300009098 Bacteria 2865
146 Ga0105245_10106423 3300009098 Bacteria 2602
147 Ga0105245_10135244 3300009098 Bacteria 2316
148 Ga0105245_10360468 3300009098 Bacteria 1443
149 Ga0105245_11009608 3300009098 Bacteria 877
150 Ga0105243_10040207 3300009148 Bacteria 3650
151 Ga0105243_10056235 3300009148 Bacteria 3128
152 Ga0105243_10477788 3300009148 Bacteria 1175
153 Ga0105241_10000998 3300009174 Bacteria 21446
154 Ga0105241_10067848 3300009174 Bacteria 2762
155 Ga0105241_10264084 3300009174 Bacteria 1464
156 Ga0105242_10344456 3300009176 Bacteria 1374
157 Ga0105242_10405537 3300009176 Bacteria 1273
158 Ga0105248_10031133 3300009177 Bacteria 5963
159 Ga0105248_10031794 3300009177 Bacteria 5897
160 Ga0105248_10102595 3300009177 Bacteria 3224
161 Ga0105248_10145239 3300009177 Bacteria 2677
162 Ga0105248_10670202 3300009177 Bacteria 1170
163 Ga0105248_11211217 3300009177 Bacteria 854
164 Ga0105237_10001090 3300009545 Bacteria 36343
165 Ga0105237_10002784 3300009545 Bacteria 21245
166 Ga0105237_10015615 3300009545 Bacteria 7894
167 Ga0105237_10034802 3300009545 Bacteria 5097
168 Ga0105237_10147837 3300009545 Bacteria 2345
169 Ga0105237_10181006 3300009545 Bacteria 2108
170 Ga0105237_10218788 3300009545 Bacteria 1905
171 Ga0105237_10379661 3300009545 Bacteria 1418
172 Ga0105238_10003080 3300009551 Bacteria 16631
173 Ga0105238_10011625 3300009551 Bacteria 8868
174 Ga0105238_10034169 3300009551 Bacteria 5174
175 Ga0105238_10060312 3300009551 Bacteria 3798
176 Ga0105238_10145966 3300009551 Bacteria 2342
177 Ga0105238_10238310 3300009551 Bacteria 1796
178 Ga0105238_10465429 3300009551 Bacteria 1262
179 Ga0105249_10019639 3300009553 Bacteria 6031
180 Ga0105249_10055098 3300009553 Bacteria 3636
181 Ga0105239_10002592 3300010375 Bacteria 22902
182 Ga0105239_10009694 3300010375 Bacteria 10829
183 Ga0105239_10049742 3300010375 Bacteria 4596
184 Ga0105239_10197565 3300010375 Bacteria 2253
185 Ga0105239_10197879 3300010375 Bacteria 2251
186 Ga0105239_10249964 3300010375 Bacteria 1991
187 Ga0105246_10011848 3300011119 Bacteria 5422
188 Ga0105246_10125648 3300011119 Bacteria 1908
189 Ga0105246_10668816 3300011119 Bacteria 906
190 Ga0157371_10013037 3300013102 Bacteria 6330
191 Ga0157371_10165120 3300013102 Bacteria 1581
192 Ga0157370_10012939 3300013104 Bacteria 8626
193 Ga0157370_10019317 3300013104 Bacteria 6840
194 Ga0157370_10020902 3300013104 Bacteria 6529
195 Ga0157370_10098514 3300013104 Bacteria 2741
196 Ga0157370_10103094 3300013104 Bacteria 2671
197 Ga0157370_10237655 3300013104 Bacteria 1686
198 Ga0157370_10267985 3300013104 Bacteria 1578
199 Ga0157369_10002698 3300013105 Bacteria 21162
200 Ga0157369_10009582 3300013105 Bacteria 11075
201 Ga0157369_10023045 3300013105 Bacteria 6940
202 Ga0157369_10025896 3300013105 Bacteria 6508
203 Ga0157369_10038177 3300013105 Bacteria 5252
204 Ga0157369_10155578 3300013105 Bacteria 2415
205 Ga0157369_10177348 3300013105 Bacteria 2243
206 Ga0157369_10202587 3300013105 Bacteria 2082
207 Ga0157369_10223578 3300013105 Bacteria 1970
208 Ga0157369_10412880 3300013105 Bacteria 1400
209 Ga0157369_10483695 3300013105 Bacteria 1281
210 Ga0157369_10728272 3300013105 Bacteria 1021
211 Ga0157374_10016687 3300013296 Bacteria 6460
212 Ga0157374_10049371 3300013296 Bacteria 3908
213 Ga0157374_10061073 3300013296 Bacteria 3529
214 Ga0157374_10218861 3300013296 Bacteria 1868
215 Ga0157374_10407343 3300013296 Bacteria 1357
216 Ga0157374_10487470 3300013296 Bacteria 1236
217 Ga0157374_10617527 3300013296 Bacteria 1095
218 Ga0163162_10124350 3300013306 Bacteria 2685
219 Ga0163162_10148226 3300013306 Bacteria 2463
220 Ga0163162_10905617 3300013306 Bacteria 995
221 Ga0157372_10004812 3300013307 Bacteria 14350
222 Ga0157372_10029757 3300013307 Bacteria 5968
223 Ga0157372_10074425 3300013307 Bacteria 3830
224 Ga0157372_10086820 3300013307 Bacteria 3549
225 Ga0157372_10117799 3300013307 Bacteria 3046
226 Ga0157372_10777737 3300013307 Bacteria 1113
227 Ga0157375_10026447 3300013308 Bacteria 5408
228 Ga0157375_10059048 3300013308 Bacteria 3798
229 Ga0157375_10885082 3300013308 Bacteria 1038
230 Ga0163163_10011072 3300014325 Bacteria 8160
231 Ga0163163_10022012 3300014325 Bacteria 6027
232 Ga0163163_10074254 3300014325 Bacteria 3392
233 Ga0163163_10375595 3300014325 Bacteria 1479
234 Ga0157380_10628249 3300014326 Bacteria 1067
235 Ga0157377_10322409 3300014745 Bacteria 1027
236 Ga0157379_10563167 3300014968 Bacteria 1061
237 Ga0157376_10021715 3300014969 Bacteria 4989
238 Ga0157376_10075195 3300014969 Bacteria 2882
239 Ga0157376_10104900 3300014969 Bacteria 2478
240 Ga0157376_10111498 3300014969 Bacteria 2408
241 Ga0157376_10130430 3300014969 Bacteria 2242
242 Ga0213874_10007461 3300021377 Bacteria 2626
243 Ga0213874_10048568 3300021377 Bacteria 1295
244 Ga0213876_10002768 3300021384 Bacteria 10215
245 Ga0213876_10018059 3300021384 Bacteria 3722
246 Ga0213876_10028854 3300021384 Bacteria 2926
247 Ga0213875_10000005 3300021388 Bacteria 595146
248 Ga0213875_10001437 3300021388 Bacteria 15432
249 Ga0213875_10015098 3300021388 Bacteria 3761
250 Ga0213875_10120416 3300021388 Bacteria 1226
251 Ga0213875_10170015 3300021388 Bacteria 1023
252 Ga0213871_10000712 3300021441 Bacteria 4865
253 Ga0224712_10002414 3300022467 Bacteria 4606
254 Ga0207642_10128705 3300025899 Bacteria 1318
255 Ga0207680_10209631 3300025903 Bacteria 1332
256 Ga0207680_10401492 3300025903 Bacteria 969
257 Ga0207699_10114365 3300025906 Bacteria 1735
258 Ga0207705_10008718 3300025909 Bacteria 7391
259 Ga0207684_10447695 3300025910 Bacteria 1109
260 Ga0207654_10004981 3300025911 Bacteria 6715
261 Ga0207707_10007218 3300025912 Bacteria 9671
262 Ga0207707_10013512 3300025912 Bacteria 7116
263 Ga0207707_10065395 3300025912 Bacteria 3168
264 Ga0207707_10116451 3300025912 Bacteria 2335
265 Ga0207707_10143814 3300025912 Bacteria 2085
266 Ga0207707_10262808 3300025912 Bacteria 1497
267 Ga0207707_10471341 3300025912 Bacteria 1073
268 Ga0207695_10000470 3300025913 Bacteria 87551
269 Ga0207695_10006140 3300025913 Bacteria 15663
270 Ga0207695_10010697 3300025913 Bacteria 11204
271 Ga0207695_10013497 3300025913 Bacteria 9738
272 Ga0207695_10029996 3300025913 Bacteria 5997
273 Ga0207695_10101832 3300025913 Bacteria 2866
274 Ga0207695_10106495 3300025913 Bacteria 2790
275 Ga0207695_10107150 3300025913 Bacteria 2780
276 Ga0207695_10115620 3300025913 Bacteria 2657
277 Ga0207695_10419691 3300025913 Bacteria 1222
278 Ga0207695_10662935 3300025913 Bacteria 924
279 Ga0207671_10019415 3300025914 Bacteria 5196
280 Ga0207671_10024035 3300025914 Bacteria 4587
281 Ga0207671_10037511 3300025914 Bacteria 3594
282 Ga0207671_10046774 3300025914 Bacteria 3202
283 Ga0207671_10167956 3300025914 Bacteria 1702
284 Ga0207671_10431260 3300025914 Bacteria 1049
285 Ga0207663_10018362 3300025916 Bacteria 3919
286 Ga0207663_10100162 3300025916 Bacteria 1944
287 Ga0207663_10157929 3300025916 Bacteria 1597
288 Ga0207660_10004761 3300025917 Bacteria 8837
289 Ga0207657_10075609 3300025919 Bacteria 2842
290 Ga0207657_10216636 3300025919 Bacteria 1535
291 Ga0207649_10231426 3300025920 Bacteria 1322
292 Ga0207649_10264256 3300025920 Bacteria 1245
293 Ga0207652_10021834 3300025921 Bacteria 5287
294 Ga0207652_10074284 3300025921 Bacteria 2960
295 Ga0207652_10078855 3300025921 Bacteria 2877
296 Ga0207652_10455037 3300025921 Bacteria 1154
297 Ga0207652_10473225 3300025921 Bacteria 1129
298 Ga0207652_10478558 3300025921 Bacteria 1122
299 Ga0207652_10816101 3300025921 Bacteria 828
300 Ga0207694_10000818 3300025924 Bacteria 27805
301 Ga0207694_10004826 3300025924 Bacteria 10464
302 Ga0207694_10046209 3300025924 Bacteria 3365
303 Ga0207694_10254046 3300025924 Bacteria 1439
304 Ga0207659_10300554 3300025926 Bacteria 1318
305 Ga0207687_10001280 3300025927 Bacteria 17197
306 Ga0207687_10002559 3300025927 Bacteria 12356
307 Ga0207700_10002212 3300025928 Bacteria 11163
308 Ga0207700_10013778 3300025928 Bacteria 5275
309 Ga0207700_10048398 3300025928 Bacteria 3157
310 Ga0207700_10075163 3300025928 Bacteria 2617
311 Ga0207700_10149760 3300025928 Bacteria 1927
312 Ga0207700_10157584 3300025928 Bacteria 1883
313 Ga0207664_10012730 3300025929 Bacteria 6021
314 Ga0207664_10048554 3300025929 Bacteria 3338
315 Ga0207664_10061059 3300025929 Bacteria 3006
316 Ga0207664_10084911 3300025929 Unclassified 2583
317 Ga0207644_10017405 3300025931 Bacteria 4852
318 Ga0207690_10083038 3300025932 Bacteria 2242
319 Ga0207690_10091253 3300025932 Bacteria 2153
320 Ga0207686_10018506 3300025934 Bacteria 3946
321 Ga0207686_10214714 3300025934 Bacteria 1385
322 Ga0207686_10459567 3300025934 Bacteria 981
323 Ga0207709_10092935 3300025935 Bacteria 1976
324 Ga0207670_10229833 3300025936 Bacteria 1424
325 Ga0207670_10355753 3300025936 Bacteria 1161
326 Ga0207669_10191094 3300025937 Bacteria 1477
327 Ga0207704_10504794 3300025938 Bacteria 975
328 Ga0207711_10010087 3300025941 Bacteria 7852
329 Ga0207711_10013977 3300025941 Bacteria 6668
330 Ga0207711_10081728 3300025941 Bacteria 2824
331 Ga0207711_10194994 3300025941 Bacteria 1847
332 Ga0207711_10309856 3300025941 Bacteria 1457
333 Ga0207689_10036394 3300025942 Bacteria 4087
334 Ga0207689_10160536 3300025942 Bacteria 1852
335 Ga0207661_10000008 3300025944 Bacteria 451211
336 Ga0207661_10001072 3300025944 Bacteria 18217
337 Ga0207661_10045157 3300025944 Bacteria 3485
338 Ga0207661_10059944 3300025944 Bacteria 3068
339 Ga0207661_10090459 3300025944 Bacteria 2548
340 Ga0207661_10146882 3300025944 Bacteria 2035
341 Ga0207661_10321415 3300025944 Bacteria 1391
342 Ga0207661_10414219 3300025944 Bacteria 1223
343 Ga0207679_10392782 3300025945 Bacteria 1219
344 Ga0207667_10000145 3300025949 Bacteria 107389
345 Ga0207667_10000290 3300025949 Bacteria 69361
346 Ga0207667_10011688 3300025949 Bacteria 10186
347 Ga0207667_10127407 3300025949 Bacteria 2622
348 Ga0207667_10155824 3300025949 Bacteria 2350
349 Ga0207667_10192928 3300025949 Bacteria 2090
350 Ga0207667_10304703 3300025949 Bacteria 1628
351 Ga0207667_10712431 3300025949 Bacteria 1005
352 Ga0207667_10963294 3300025949 Bacteria 842
353 Ga0207651_10043438 3300025960 Bacteria 3000
354 Ga0207651_10117804 3300025960 Bacteria 2007
355 Ga0207651_10363526 3300025960 Bacteria 1222
356 Ga0207712_10010922 3300025961 Bacteria 5779
357 Ga0207658_10357577 3300025986 Bacteria 1273
358 Ga0207703_10006989 3300026035 Bacteria 8981
359 Ga0207703_10055253 3300026035 Bacteria 3230
360 Ga0207639_10035064 3300026041 Bacteria 3712
361 Ga0207702_10002090 3300026078 Bacteria 19275
362 Ga0207702_10028242 3300026078 Bacteria 4662
363 Ga0207702_10034359 3300026078 Bacteria 4238
364 Ga0207702_10413295 3300026078 Bacteria 1303
365 Ga0207641_10454559 3300026088 Bacteria 1238
366 Ga0207641_10909892 3300026088 Bacteria 874
367 Ga0207648_10141179 3300026089 Bacteria 2123
368 Ga0207648_10169932 3300026089 Bacteria 1927
369 Ga0207676_10259825 3300026095 Bacteria 1567
370 Ga0207674_10000264 3300026116 Bacteria 65695
371 Ga0207674_10001670 3300026116 Bacteria 28551
372 Ga0207698_10129290 3300026142 Bacteria 2155
373 Ga0268266_10023283 3300028379 Bacteria 5274
374 Ga0268266_10226307 3300028379 Bacteria 1721
375 Ga0268266_10419840 3300028379 Bacteria 1267
376 Ga0268264_10014792 3300028381 Bacteria 6409
377 Ga0268264_10522362 3300028381 Bacteria 1161
378 Ga0265323_10000261 3300028653 Bacteria 30888
379 Ga0265338_10096059 3300028800 Bacteria 2433
380 Ga0265338_10217341 3300028800 Bacteria 1430
381 Ga0265325_10004637 3300031241 Bacteria 8628
382 Ga0265325_10052299 3300031241 Bacteria 2098
383 Ga0265316_10006280 3300031344 Bacteria 11383
384 Ga0265313_10003281 3300031595 Bacteria 13290
385 Ga0265314_10001266 3300031711 Bacteria 28791
386 Ga0265314_10005327 3300031711 Bacteria 11638
387 Ga0265314_10015999 3300031711 Bacteria 5938
388 Ga0265342_10078980 3300031712 Bacteria 1904
389 Ga0373953_0085580 3300035117 Bacteria 1315
390 Ga0373954_0006574 3300035118 Bacteria 5070
391 Ga0373954_0036060 3300035118 Bacteria 2294
392 Ga0373954_0045734 3300035118 Bacteria 2045
393 Ga0373954_0202731 3300035118 Bacteria 975
394 Ga0373956_0048036 3300035119 Bacteria 1911
395 Ga0373956_0099721 3300035119 Bacteria 1346
396 Ga0373957_0024235 3300035120 Bacteria 2178
397 Ga0373955_0009957 3300035172 Bacteria 4473
398 Ga0373955_0067763 3300035172 Bacteria 1987
399 Ga0373955_0110042 3300035172 Bacteria 1592
400 Ga0373924_0167911 3300035410 Bacteria 964
401 Ga0373935_0047100 3300035692 Unclassified 2725
402 Ga0373935_0131017 3300035692 Bacteria 1685
403 Ga0373935_0131484 3300035692 Bacteria 1682
404 Ga0373935_0184925 3300035692 Bacteria 1432
405 Ga0373927_0003403 3300035695 Bacteria 11443
406 Ga0373927_0026658 3300035695 Bacteria 3777
407 Ga0373927_0227621 3300035695 Bacteria 1225
408 Ga0373933_0021198 3300035724 Bacteria 3689
409 Ga0373933_0050067 3300035724 Bacteria 2492
410 Ga0373947_0001364 3300035725 Bacteria 15014
411 Ga0373947_0155910 3300035725 Bacteria 1474
412 Ga0373947_0263598 3300035725 Unclassified 1142
413 Ga0373947_0338650 3300035725 Bacteria 1008
414 Ga0373937_0001893 3300036401 Bacteria 17557
415 Ga0373937_0020624 3300036401 Bacteria 5908
416 Ga0373937_0046600 3300036401 Bacteria 3965
417 Ga0373937_0084416 3300036401 Bacteria 2938
418 Ga0373937_0393444 3300036401 Unclassified 1315
419 Ga0316584_0254296 3300036712 Bacteria 1283
420 Ga0373925_0001414 3300037068 Bacteria 20838
421 Ga0373925_0053958 3300037068 Bacteria 3006
422 Ga0373925_0080751 3300037068 Bacteria 2472
423 Ga0373925_0553994 3300037068 Bacteria 946
424 Ga0395900_0113016 3300037418 Bacteria 2788
425 Ga0395898_0056747 3300037466 Bacteria 3817
426 Ga0436364_0051577 3300037853 Bacteria 4362
427 Ga0436364_0059099 3300037853 Bacteria 8032
428 Ga0436364_0157811 3300037853 Bacteria 430293
429 Ga0436364_0203770 3300037853 Bacteria 5968
430 Ga0436364_0362008 3300037853 Bacteria 3917
431 Ga0436364_0475118 3300037853 Bacteria 1996
432 Ga0436364_0602759 3300037853 Bacteria 6558
433 Ga0436364_0657729 3300037853 Bacteria 1521
434 Ga0436364_0851706 3300037853 Bacteria 1108
435 Ga0436364_0909379 3300037853 Bacteria 1095
436 Ga0436364_0934794 3300037853 Bacteria 1571
437 Ga0436364_1409641 3300037853 Bacteria 4411
438 Ga0436364_1556058 3300037853 Bacteria 18341
439 Ga0436365_0096934 3300039437 Bacteria 2609
440 Ga0436365_0157338 3300039437 Bacteria 1275
441 Ga0436365_0288035 3300039437 Bacteria 1169
442 Ga0436365_0491703 3300039437 Bacteria 2831
443 Ga0436365_0617682 3300039437 Bacteria 10340
444 Ga0436365_0761153 3300039437 Bacteria 3697
445 Ga0436365_0860671 3300039437 Bacteria 10150
446 Ga0436365_1105269 3300039437 Bacteria 7072
447 Ga0436365_1821431 3300039437 Bacteria 1579
448 Ga0436360_0318029 3300039438 Bacteria 5276
449 Ga0436360_0701333 3300039438 Bacteria 3452
450 Ga0436361_0233351 3300039447 Bacteria 63019
451 Ga0436363_0618120 3300039450 Bacteria 12910
452 Ga0436363_0647949 3300039450 Bacteria 2751
453 Ga0436363_1203601 3300039450 Bacteria 5897
454 Ga0436362_0592346 3300039453 Bacteria 1106
455 Ga0436362_0620224 3300039453 Bacteria 3388
456 Ga0436362_0851569 3300039453 Bacteria 2160
457 Ga0453683_0000676 3300044673 Bacteria 36239
458 Ga0466963_0234277 3300044694 Bacteria 1287
459 Ga0453684_0175287 3300044712 Bacteria 2523
460 Ga0451576_0172357 3300045051 Bacteria 2259
461 Ga0451576_0235447 3300045051 Bacteria 1912
462 Ga0451576_0331392 3300045051 Bacteria 1593
463 Ga0451576_0383525 3300045051 Bacteria 1473
464 Ga0466958_0138432 3300045836 Bacteria 1532
465 Ga0466958_0385170 3300045836 Bacteria 904
466 Ga0495592_0163620 3300046454 Bacteria 1529
467 Ga0495651_0402539 3300046462 Bacteria 893
468 Ga0495580_0011195 3300046472 Bacteria 6946
469 Ga0495580_0014222 3300046472 Bacteria 6042
470 Ga0495580_0034199 3300046472 Bacteria 3659
471 Ga0495580_0038940 3300046472 Bacteria 3402
472 Ga0495580_0102050 3300046472 Bacteria 1995
473 Ga0495580_0225716 3300046472 Bacteria 1286
474 Ga0495580_0254849 3300046472 Bacteria 1201
475 Ga0495580_0394050 3300046472 Bacteria 934
476 Ga0495580_0428837 3300046472 Bacteria 889
477 Ga0495580_0509813 3300046472 Unclassified 802
478 Ga0495582_0163420 3300046473 Bacteria 1267
479 Ga0495608_0102751 3300046511 Bacteria 1842
480 Ga0495630_0137815 3300046517 Bacteria 1855
481 Ga0495652_0101144 3300046529 Bacteria 2337
482 Ga0495665_0042286 3300046531 Bacteria 2426
483 Ga0495586_0052466 3300046535 Bacteria 2208
484 Ga0495587_0000640 3300046536 Bacteria 23483
485 Ga0495587_0027794 3300046536 Bacteria 3444
486 Ga0495645_0049288 3300046543 Bacteria 3067
487 Ga0495667_0214137 3300046559 Bacteria 1231
488 Ga0495667_0454334 3300046559 Bacteria 805
489 Ga0495635_0103696 3300046663 Bacteria 1944
490 Ga0495657_0137483 3300046675 Bacteria 1526
491 Ga0495623_0067839 3300046679 Bacteria 2226
492 Ga0495623_0175255 3300046679 Bacteria 1250
493 Ga0495658_0357782 3300046683 Bacteria 928
494 Ga0495600_0157501 3300046809 Bacteria 1469
495 Ga0495636_0016181 3300047318 Bacteria 2977
496 Ga0495674_0080987 3300047319 Bacteria 2786
497 Ga0495674_0113073 3300047319 Bacteria 2300
498 Ga0495674_0206844 3300047319 Bacteria 1627
499 Ga0495674_0412953 3300047319 Bacteria 1088
500 Ga0495676_0364015 3300047321 Bacteria 965
501 Ga0495680_0059445 3300047322 Bacteria 2951
502 Ga0495675_0200158 3300047444 Bacteria 1216
503 Ga0495684_0008927 3300047471 Bacteria 7744
504 Ga0495684_0030460 3300047471 Bacteria 4143
505 Ga0495684_0031272 3300047471 Bacteria 4087
506 Ga0495684_0032701 3300047471 Bacteria 3995
507 Ga0495684_0049869 3300047471 Bacteria 3198
508 Ga0495602_0007373 3300048088 Bacteria 11517
509 Ga0495602_0143065 3300048088 Bacteria 1891
510 Ga0495602_0337095 3300048088 Bacteria 1092
511 Ga0496102_0675129 3300048905 Bacteria 956
512 Ga0496104_0290375 3300048907 Unclassified 1548
513 Ga0496108_0682848 3300048911 Bacteria 891
514 Ga0496115_0093629 3300048918 Bacteria 2457
515 Ga0501031_0002163 3300049568 Bacteria 12402
516 Ga0501033_0027878 3300049570 Bacteria 4244
517 Ga0501034_0008169 3300049571 Bacteria 11098
518 Ga0501034_0037104 3300049571 Bacteria 4934
519 Ga0501036_0000255 3300049572 Bacteria 36165
520 Ga0501037_0029347 3300049573 Bacteria 4063
521 Ga0501038_0001681 3300049574 Bacteria 20492
522 Ga0501039_0032376 3300049575 Bacteria 4030
523 Ga0501040_0471575 3300049576 Bacteria 904
524 Ga0501042_0119259 3300049578 Bacteria 1899
525 Ga0501043_0238048 3300049579 Bacteria 1404
526 Ga0501046_0012015 3300049580 Bacteria 7386
527 Ga0501046_0129826 3300049580 Bacteria 1912
528 Ga0501047_0005379 3300049581 Bacteria 12036
529 Ga0501047_0104999 3300049581 Bacteria 2705
530 Ga0501047_0393686 3300049581 Bacteria 1219
531 Ga0501048_0010139 3300049582 Bacteria 7047
532 Ga0501048_0552841 3300049582 Bacteria 826
533 Ga0501068_0004494 3300049584 Bacteria 7592
534 Ga0501069_0003875 3300049585 Bacteria 7708
535 Ga0501070_0029721 3300049586 Bacteria 4579
536 Ga0501070_0090854 3300049586 Bacteria 2527
537 Ga0501072_0000250 3300049588 Bacteria 39677
538 Ga0501073_0009030 3300049589 Bacteria 7358
539 Ga0501073_0109147 3300049589 Bacteria 1920
540 Ga0501074_0004552 3300049590 Bacteria 9924
541 Ga0501075_0221346 3300049591 Bacteria 1444
542 Ga0501076_0507005 3300049592 Bacteria 994
543 Ga0501077_0005572 3300049593 Bacteria 7667
544 Ga0501217_103991 3300049661 Bacteria 810
545 Ga0501257_041642 3300049686 Bacteria 1129
546 Ga0501079_0010908 3300049741 Bacteria 6921
547 Ga0501080_0001964 3300049742 Bacteria 17742
548 Ga0501080_0172422 3300049742 Bacteria 1995
549 Ga0501083_0011177 3300049744 Bacteria 6297
550 Ga0501083_0013381 3300049744 Bacteria 5735
551 Ga0501035_0010163 3300049822 Bacteria 8734
552 Ga0501035_0056092 3300049822 Bacteria 3517
553 Ga0501035_0335447 3300049822 Bacteria 1268
554 Ga0501044_0002393 3300049823 Bacteria 21384
555 Ga0501044_0021570 3300049823 Bacteria 6868
556 Ga0501044_0044948 3300049823 Bacteria 4579
557 nmdc:mga09592_346529_c1 3300050508 Bacteria 1286
558 nmdc:mga0qj67_97961_c1 3300050509 Bacteria 2362
559 nmdc:mga08y16_251203_c1 3300050511 Bacteria 1827
560 nmdc:mga08y16_390678_c1 3300050511 Bacteria 1425
561 nmdc:mga08x19_1108_c1 3300050514 Bacteria 16801
562 nmdc:mga08x19_157824_c1 3300050514 Bacteria 1539
563 Ga0495601_0052290 3300053077 Bacteria 2579
564 Ga0500568_0006476 3300053139 Bacteria 5871
565 Ga0501084_0000893 3300054114 Bacteria 23072
566 Ga0501082_0000283 3300060353 Bacteria 44708
567 Ga0501082_0062309 3300060353 Bacteria 3210
568 Ga0501082_0216336 3300060353 Bacteria 1667

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10106423 Ga0105245_101064232 194
2 3300035725 Ga0373947_0338650 Ga0373947_0338650_68_760 203
3 3300009093 Ga0105240_10016627 Ga0105240_100166273 209
4 3300013104 Ga0157370_10020902 Ga0157370_100209025 209
5 3300025913 Ga0207695_10106495 Ga0207695_101064952 209
6 3300025949 Ga0207667_10127407 Ga0207667_101274072 209
7 3300005548 Ga0070665_100395535 Ga0070665_1003955352 210
8 3300009176 Ga0105242_10344456 Ga0105242_103444561 210
9 3300013296 Ga0157374_10407343 Ga0157374_104073432 210
10 3300013306 Ga0163162_10905617 Ga0163162_109056171 210
11 3300025934 Ga0207686_10214714 Ga0207686_102147141 210
12 3300028379 Ga0268266_10419840 Ga0268266_104198402 210
13 3300006028 Ga0070717_10037014 Ga0070717_100370144 226
14 3300021388 Ga0213875_10001437 Ga0213875_100014379 226
15 3300035118 Ga0373954_0006574 Ga0373954_0006574_1342_2115 226
16 3300035119 Ga0373956_0099721 Ga0373956_0099721_561_1334 226
17 3300035692 Ga0373935_0184925 Ga0373935_0184925_501_1274 226
18 3300035695 Ga0373927_0026658 Ga0373927_0026658_2194_2967 226
19 3300036401 Ga0373937_0084416 Ga0373937_0084416_881_1654 226
20 3300037068 Ga0373925_0080751 Ga0373925_0080751_272_1045 226
21 3300046472 Ga0495580_0034199 Ga0495580_0034199_2023_2796 226
22 3300047319 Ga0495674_0113073 Ga0495674_0113073_740_1513 226
23 3300047471 Ga0495684_0008927 Ga0495684_0008927_109_882 226
24 3300005563 Ga0068855_100016105 Ga0068855_1000161052 227
25 3300005614 Ga0068856_100058410 Ga0068856_1000584105 227
26 3300009551 Ga0105238_10034169 Ga0105238_100341692 227
27 3300013105 Ga0157369_10202587 Ga0157369_102025872 227
28 3300025920 Ga0207649_10231426 Ga0207649_102314262 227
29 3300026078 Ga0207702_10413295 Ga0207702_104132952 227
30 3300026142 Ga0207698_10129290 Ga0207698_101292902 227
31 3300028381 Ga0268264_10522362 Ga0268264_105223622 227
32 3300031711 Ga0265314_10005327 Ga0265314_100053272 227
33 3300039453 Ga0436362_0851569 Ga0436362_0851569_716_1474 227
34 3300009148 Ga0105243_10477788 Ga0105243_104777882 228
35 3300039447 Ga0436361_0233351 Ga0436361_0233351_58445_59185 234
36 3300005329 Ga0070683_100014842 Ga0070683_1000148422 235
37 3300005535 Ga0070684_100074730 Ga0070684_1000747303 235
38 3300006358 Ga0068871_100029962 Ga0068871_1000299623 235
39 3300009098 Ga0105245_10135244 Ga0105245_101352444 235
40 3300014325 Ga0163163_10011072 Ga0163163_100110722 235
41 3300025944 Ga0207661_10045157 Ga0207661_100451572 235
42 3300005336 Ga0070680_100314890 Ga0070680_1003148901 236
43 3300005458 Ga0070681_10007191 Ga0070681_100071916 236
44 3300005530 Ga0070679_100569882 Ga0070679_1005698821 236
45 3300021384 Ga0213876_10018059 Ga0213876_100180593 236
46 3300025912 Ga0207707_10013512 Ga0207707_100135126 236
47 3300025921 Ga0207652_10473225 Ga0207652_104732251 236
48 3300035692 Ga0373935_0131484 Ga0373935_0131484_355_1095 236
49 3300037853 Ga0436364_0851706 Ga0436364_0851706_43_765 236
50 3300039437 Ga0436365_1105269 Ga0436365_1105269_598_1320 236
51 3300039450 Ga0436363_0618120 Ga0436363_0618120_2225_2947 236
52 3300021388 Ga0213875_10000005 Ga0213875_10000005257 239
53 3300037853 Ga0436364_0157811 Ga0436364_0157811_292850_293593 239
54 3300005347 Ga0070668_100178369 Ga0070668_1001783692 240
55 3300005436 Ga0070713_100174044 Ga0070713_1001740441 240
56 3300005440 Ga0070705_100099200 Ga0070705_1000992002 240
57 3300005563 Ga0068855_100724929 Ga0068855_1007249292 240
58 3300005617 Ga0068859_100370362 Ga0068859_1003703622 240
59 3300005842 Ga0068858_100054904 Ga0068858_1000549044 240
60 3300006931 Ga0097620_100370327 Ga0097620_1003703272 240
61 3300013306 Ga0163162_10148226 Ga0163162_101482264 240
62 3300014326 Ga0157380_10628249 Ga0157380_106282492 240
63 3300025906 Ga0207699_10114365 Ga0207699_101143652 240
64 3300025910 Ga0207684_10447695 Ga0207684_104476952 240
65 3300025921 Ga0207652_10478558 Ga0207652_104785582 240
66 3300026035 Ga0207703_10055253 Ga0207703_100552533 240
67 3300031344 Ga0265316_10006280 Ga0265316_100062805 240
68 3300031711 Ga0265314_10015999 Ga0265314_100159994 240
69 3300031712 Ga0265342_10078980 Ga0265342_100789802 240
70 3300044673 Ga0453683_0000676 Ga0453683_0000676_30192_30929 240
71 3300045051 Ga0451576_0172357 Ga0451576_0172357_956_1699 240
72 3300045051 Ga0451576_0235447 Ga0451576_0235447_1127_1882 240
73 3300046472 Ga0495580_0038940 Ga0495580_0038940_351_1088 240
74 3300047319 Ga0495674_0412953 Ga0495674_0412953_231_953 240
75 3300047444 Ga0495675_0200158 Ga0495675_0200158_166_888 240
76 3300049744 Ga0501083_0013381 Ga0501083_0013381_2398_3123 240
77 3300005439 Ga0070711_100125161 Ga0070711_1001251612 241
78 3300005458 Ga0070681_10145649 Ga0070681_101456492 241
79 3300005530 Ga0070679_100116873 Ga0070679_1001168732 241
80 3300005545 Ga0070695_100257203 Ga0070695_1002572032 241
81 3300005719 Ga0068861_100874459 Ga0068861_1008744591 241
82 3300006914 Ga0075436_100021873 Ga0075436_1000218732 241
83 3300009174 Ga0105241_10264084 Ga0105241_102640842 241
84 3300009545 Ga0105237_10034802 Ga0105237_100348022 241
85 3300025912 Ga0207707_10143814 Ga0207707_101438142 241
86 3300025914 Ga0207671_10024035 Ga0207671_100240355 241
87 3300025916 Ga0207663_10100162 Ga0207663_101001622 241
88 3300025921 Ga0207652_10455037 Ga0207652_104550372 241
89 3300031241 Ga0265325_10004637 Ga0265325_100046376 241
90 3300035172 Ga0373955_0009957 Ga0373955_0009957_3671_4417 241
91 3300035695 Ga0373927_0003403 Ga0373927_0003403_1680_2429 241
92 3300035695 Ga0373927_0227621 Ga0373927_0227621_158_916 241
93 3300046472 Ga0495580_0225716 Ga0495580_0225716_282_1028 241
94 3300046531 Ga0495665_0042286 Ga0495665_0042286_1325_2071 241
95 3300050514 nmdc:mga08x19_1108_c1 nmdc:mga08x19_1108_c1_1833_2582 241
96 3300050514 nmdc:mga08x19_157824_c1 nmdc:mga08x19_157824_c1_245_991 241
97 3300053139 Ga0500568_0006476 Ga0500568_0006476_34_759 241
98 3300005329 Ga0070683_100000008 Ga0070683_10000000870 242
99 3300005329 Ga0070683_100001900 Ga0070683_10000190016 242
100 3300005329 Ga0070683_100037407 Ga0070683_1000374074 242
101 3300005329 Ga0070683_100079582 Ga0070683_1000795824 242
102 3300005329 Ga0070683_100225677 Ga0070683_1002256771 242
103 3300005329 Ga0070683_100482516 Ga0070683_1004825162 242
104 3300005334 Ga0068869_100052850 Ga0068869_1000528502 242
105 3300005334 Ga0068869_100226762 Ga0068869_1002267621 242
106 3300005335 Ga0070666_10055652 Ga0070666_100556524 242
107 3300005335 Ga0070666_10331947 Ga0070666_103319471 242
108 3300005336 Ga0070680_100000677 Ga0070680_10000067711 242
109 3300005336 Ga0070680_100260766 Ga0070680_1002607662 242
110 3300005339 Ga0070660_100009046 Ga0070660_1000090463 242
111 3300005339 Ga0070660_100026524 Ga0070660_1000265242 242
112 3300005339 Ga0070660_100061874 Ga0070660_1000618743 242
113 3300005339 Ga0070660_100140177 Ga0070660_1001401772 242
114 3300005341 Ga0070691_10015204 Ga0070691_100152042 242
115 3300005343 Ga0070687_100478053 Ga0070687_1004780531 242
116 3300005344 Ga0070661_100038345 Ga0070661_1000383452 242
117 3300005353 Ga0070669_100380405 Ga0070669_1003804052 242
118 3300005356 Ga0070674_100036703 Ga0070674_1000367032 242
119 3300005364 Ga0070673_100011878 Ga0070673_1000118782 242
120 3300005364 Ga0070673_100145132 Ga0070673_1001451322 242
121 3300005364 Ga0070673_100447870 Ga0070673_1004478701 242
122 3300005366 Ga0070659_100065655 Ga0070659_1000656554 242
123 3300005367 Ga0070667_100436781 Ga0070667_1004367812 242
124 3300005434 Ga0070709_10106055 Ga0070709_101060552 242
125 3300005435 Ga0070714_100002199 Ga0070714_1000021998 242
126 3300005435 Ga0070714_100066908 Ga0070714_1000669082 242
127 3300005435 Ga0070714_100119549 Ga0070714_1001195492 242
128 3300005435 Ga0070714_100517729 Ga0070714_1005177291 242
129 3300005435 Ga0070714_100569380 Ga0070714_1005693802 242
130 3300005436 Ga0070713_100003787 Ga0070713_1000037876 242
131 3300005436 Ga0070713_100007840 Ga0070713_1000078408 242
132 3300005436 Ga0070713_100148944 Ga0070713_1001489442 242
133 3300005436 Ga0070713_100316474 Ga0070713_1003164742 242
134 3300005438 Ga0070701_10103267 Ga0070701_101032672 242
135 3300005439 Ga0070711_100007987 Ga0070711_1000079874 242
136 3300005439 Ga0070711_100010318 Ga0070711_1000103185 242
137 3300005439 Ga0070711_100048495 Ga0070711_1000484952 242
138 3300005458 Ga0070681_10017934 Ga0070681_100179343 242
139 3300005458 Ga0070681_10081737 Ga0070681_100817372 242
140 3300005458 Ga0070681_10228452 Ga0070681_102284521 242
141 3300005459 Ga0068867_100269336 Ga0068867_1002693361 242
142 3300005530 Ga0070679_100028687 Ga0070679_1000286874 242
143 3300005530 Ga0070679_100162172 Ga0070679_1001621722 242
144 3300005530 Ga0070679_100781188 Ga0070679_1007811882 242
145 3300005535 Ga0070684_100000002 Ga0070684_10000000260 242
146 3300005535 Ga0070684_100003837 Ga0070684_1000038379 242
147 3300005535 Ga0070684_100022567 Ga0070684_1000225673 242
148 3300005535 Ga0070684_100571768 Ga0070684_1005717682 242
149 3300005544 Ga0070686_100177528 Ga0070686_1001775282 242
150 3300005545 Ga0070695_100177298 Ga0070695_1001772982 242
151 3300005548 Ga0070665_100085135 Ga0070665_1000851352 242
152 3300005548 Ga0070665_100261525 Ga0070665_1002615251 242
153 3300005548 Ga0070665_100291856 Ga0070665_1002918562 242
154 3300005548 Ga0070665_100510306 Ga0070665_1005103062 242
155 3300005563 Ga0068855_100009996 Ga0068855_1000099963 242
156 3300005563 Ga0068855_100015477 Ga0068855_1000154773 242
157 3300005563 Ga0068855_100017428 Ga0068855_1000174288 242
158 3300005563 Ga0068855_100060397 Ga0068855_1000603973 242
159 3300005563 Ga0068855_100063730 Ga0068855_1000637302 242
160 3300005563 Ga0068855_100103223 Ga0068855_1001032232 242
161 3300005563 Ga0068855_100162916 Ga0068855_1001629162 242
162 3300005563 Ga0068855_100174102 Ga0068855_1001741022 242
163 3300005563 Ga0068855_100296764 Ga0068855_1002967642 242
164 3300005577 Ga0068857_100003127 Ga0068857_1000031275 242
165 3300005577 Ga0068857_100110224 Ga0068857_1001102242 242
166 3300005578 Ga0068854_100138297 Ga0068854_1001382972 242
167 3300005614 Ga0068856_100005417 Ga0068856_10000541710 242
168 3300005614 Ga0068856_100006709 Ga0068856_1000067097 242
169 3300005614 Ga0068856_100016973 Ga0068856_1000169734 242
170 3300005614 Ga0068856_100053461 Ga0068856_1000534613 242
171 3300005614 Ga0068856_100118342 Ga0068856_1001183422 242
172 3300005614 Ga0068856_100422736 Ga0068856_1004227362 242
173 3300005616 Ga0068852_100008659 Ga0068852_1000086593 242
174 3300005616 Ga0068852_100060397 Ga0068852_1000603973 242
175 3300005616 Ga0068852_100282565 Ga0068852_1002825651 242
176 3300005617 Ga0068859_100055438 Ga0068859_1000554382 242
177 3300005617 Ga0068859_100199818 Ga0068859_1001998182 242
178 3300005617 Ga0068859_100997121 Ga0068859_1009971212 242
179 3300005618 Ga0068864_100223655 Ga0068864_1002236552 242
180 3300005718 Ga0068866_10006279 Ga0068866_100062792 242
181 3300005841 Ga0068863_100091762 Ga0068863_1000917623 242
182 3300005841 Ga0068863_100259366 Ga0068863_1002593662 242
183 3300005841 Ga0068863_100297219 Ga0068863_1002972192 242
184 3300005842 Ga0068858_100038124 Ga0068858_1000381242 242
185 3300005842 Ga0068858_100107109 Ga0068858_1001071092 242
186 3300005842 Ga0068858_100250634 Ga0068858_1002506342 242
187 3300005843 Ga0068860_100005181 Ga0068860_1000051813 242
188 3300005843 Ga0068860_100323128 Ga0068860_1003231282 242
189 3300005937 Ga0081455_10043488 Ga0081455_100434882 242
190 3300006028 Ga0070717_10009055 Ga0070717_100090554 242
191 3300006028 Ga0070717_10016370 Ga0070717_100163704 242
192 3300006028 Ga0070717_10270977 Ga0070717_102709772 242
193 3300006175 Ga0070712_100435498 Ga0070712_1004354982 242
194 3300006237 Ga0097621_100076451 Ga0097621_1000764514 242
195 3300006237 Ga0097621_100153476 Ga0097621_1001534762 242
196 3300006358 Ga0068871_100053583 Ga0068871_1000535832 242
197 3300006358 Ga0068871_100197464 Ga0068871_1001974642 242
198 3300006358 Ga0068871_100542794 Ga0068871_1005427942 242
199 3300006846 Ga0075430_100069294 Ga0075430_1000692941 242
200 3300006880 Ga0075429_100372687 Ga0075429_1003726872 242
201 3300006931 Ga0097620_100055437 Ga0097620_1000554372 242
202 3300006931 Ga0097620_100199802 Ga0097620_1001998022 242
203 3300006931 Ga0097620_100996879 Ga0097620_1009968792 242
204 3300009093 Ga0105240_10000429 Ga0105240_1000042916 242
205 3300009093 Ga0105240_10005328 Ga0105240_100053284 242
206 3300009093 Ga0105240_10007071 Ga0105240_1000707115 242
207 3300009093 Ga0105240_10008797 Ga0105240_100087973 242
208 3300009093 Ga0105240_10014961 Ga0105240_100149615 242
209 3300009093 Ga0105240_10034152 Ga0105240_100341529 242
210 3300009093 Ga0105240_10034531 Ga0105240_100345313 242
211 3300009093 Ga0105240_10186563 Ga0105240_101865632 242
212 3300009093 Ga0105240_10318326 Ga0105240_103183262 242
213 3300009093 Ga0105240_10814909 Ga0105240_108149091 242
214 3300009093 Ga0105240_10906886 Ga0105240_109068862 242
215 3300009098 Ga0105245_10000273 Ga0105245_1000027339 242
216 3300009098 Ga0105245_10000579 Ga0105245_1000057924 242
217 3300009098 Ga0105245_10017701 Ga0105245_100177013 242
218 3300009098 Ga0105245_10087169 Ga0105245_100871692 242
219 3300009098 Ga0105245_10360468 Ga0105245_103604681 242
220 3300009098 Ga0105245_11009608 Ga0105245_110096082 242
221 3300009148 Ga0105243_10040207 Ga0105243_100402073 242
222 3300009148 Ga0105243_10056235 Ga0105243_100562354 242
223 3300009174 Ga0105241_10000998 Ga0105241_100009983 242
224 3300009174 Ga0105241_10067848 Ga0105241_100678483 242
225 3300009176 Ga0105242_10405537 Ga0105242_104055372 242
226 3300009177 Ga0105248_10031133 Ga0105248_100311334 242
227 3300009177 Ga0105248_10031794 Ga0105248_100317944 242
228 3300009177 Ga0105248_10102595 Ga0105248_101025954 242
229 3300009177 Ga0105248_10145239 Ga0105248_101452391 242
230 3300009177 Ga0105248_10670202 Ga0105248_106702021 242
231 3300009177 Ga0105248_11211217 Ga0105248_112112172 242
232 3300009545 Ga0105237_10001090 Ga0105237_1000109018 242
233 3300009545 Ga0105237_10002784 Ga0105237_1000278414 242
234 3300009545 Ga0105237_10015615 Ga0105237_100156156 242
235 3300009545 Ga0105237_10147837 Ga0105237_101478372 242
236 3300009545 Ga0105237_10181006 Ga0105237_101810062 242
237 3300009545 Ga0105237_10218788 Ga0105237_102187882 242
238 3300009545 Ga0105237_10379661 Ga0105237_103796612 242
239 3300009551 Ga0105238_10003080 Ga0105238_100030809 242
240 3300009551 Ga0105238_10011625 Ga0105238_100116255 242
241 3300009551 Ga0105238_10060312 Ga0105238_100603122 242
242 3300009551 Ga0105238_10145966 Ga0105238_101459662 242
243 3300009551 Ga0105238_10238310 Ga0105238_102383102 242
244 3300009551 Ga0105238_10465429 Ga0105238_104654292 242
245 3300009553 Ga0105249_10019639 Ga0105249_100196393 242
246 3300009553 Ga0105249_10055098 Ga0105249_100550982 242
247 3300010375 Ga0105239_10002592 Ga0105239_1000259216 242
248 3300010375 Ga0105239_10009694 Ga0105239_100096941 242
249 3300010375 Ga0105239_10049742 Ga0105239_100497423 242
250 3300010375 Ga0105239_10197565 Ga0105239_101975653 242
251 3300010375 Ga0105239_10197879 Ga0105239_101978792 242
252 3300010375 Ga0105239_10249964 Ga0105239_102499642 242
253 3300011119 Ga0105246_10011848 Ga0105246_100118482 242
254 3300011119 Ga0105246_10125648 Ga0105246_101256482 242
255 3300011119 Ga0105246_10668816 Ga0105246_106688161 242
256 3300013102 Ga0157371_10013037 Ga0157371_100130377 242
257 3300013102 Ga0157371_10165120 Ga0157371_101651202 242
258 3300013104 Ga0157370_10012939 Ga0157370_100129398 242
259 3300013104 Ga0157370_10019317 Ga0157370_100193175 242
260 3300013104 Ga0157370_10098514 Ga0157370_100985143 242
261 3300013104 Ga0157370_10103094 Ga0157370_101030942 242
262 3300013104 Ga0157370_10237655 Ga0157370_102376552 242
263 3300013104 Ga0157370_10267985 Ga0157370_102679852 242
264 3300013105 Ga0157369_10002698 Ga0157369_1000269816 242
265 3300013105 Ga0157369_10009582 Ga0157369_100095823 242
266 3300013105 Ga0157369_10023045 Ga0157369_100230452 242
267 3300013105 Ga0157369_10025896 Ga0157369_100258962 242
268 3300013105 Ga0157369_10038177 Ga0157369_100381773 242
269 3300013105 Ga0157369_10155578 Ga0157369_101555782 242
270 3300013105 Ga0157369_10177348 Ga0157369_101773482 242
271 3300013105 Ga0157369_10223578 Ga0157369_102235781 242
272 3300013105 Ga0157369_10412880 Ga0157369_104128801 242
273 3300013105 Ga0157369_10483695 Ga0157369_104836951 242
274 3300013105 Ga0157369_10728272 Ga0157369_107282722 242
275 3300013296 Ga0157374_10016687 Ga0157374_100166875 242
276 3300013296 Ga0157374_10049371 Ga0157374_100493713 242
277 3300013296 Ga0157374_10061073 Ga0157374_100610734 242
278 3300013296 Ga0157374_10218861 Ga0157374_102188612 242
279 3300013296 Ga0157374_10487470 Ga0157374_104874702 242
280 3300013296 Ga0157374_10617527 Ga0157374_106175271 242
281 3300013306 Ga0163162_10124350 Ga0163162_101243502 242
282 3300013307 Ga0157372_10004812 Ga0157372_1000481214 242
283 3300013307 Ga0157372_10029757 Ga0157372_100297574 242
284 3300013307 Ga0157372_10074425 Ga0157372_100744254 242
285 3300013307 Ga0157372_10086820 Ga0157372_100868202 242
286 3300013307 Ga0157372_10117799 Ga0157372_101177992 242
287 3300013307 Ga0157372_10777737 Ga0157372_107777372 242
288 3300013308 Ga0157375_10026447 Ga0157375_100264472 242
289 3300013308 Ga0157375_10059048 Ga0157375_100590483 242
290 3300013308 Ga0157375_10885082 Ga0157375_108850822 242
291 3300014325 Ga0163163_10022012 Ga0163163_100220122 242
292 3300014325 Ga0163163_10074254 Ga0163163_100742542 242
293 3300014325 Ga0163163_10375595 Ga0163163_103755952 242
294 3300014745 Ga0157377_10322409 Ga0157377_103224092 242
295 3300014968 Ga0157379_10563167 Ga0157379_105631672 242
296 3300014969 Ga0157376_10021715 Ga0157376_100217153 242
297 3300014969 Ga0157376_10075195 Ga0157376_100751954 242
298 3300014969 Ga0157376_10104900 Ga0157376_101049003 242
299 3300014969 Ga0157376_10111498 Ga0157376_101114982 242
300 3300014969 Ga0157376_10130430 Ga0157376_101304302 242
301 3300021377 Ga0213874_10007461 Ga0213874_100074612 242
302 3300021377 Ga0213874_10048568 Ga0213874_100485682 242
303 3300021384 Ga0213876_10002768 Ga0213876_100027685 242
304 3300021384 Ga0213876_10028854 Ga0213876_100288541 242
305 3300021388 Ga0213875_10015098 Ga0213875_100150984 242
306 3300021388 Ga0213875_10120416 Ga0213875_101204161 242
307 3300021388 Ga0213875_10170015 Ga0213875_101700152 242
308 3300021441 Ga0213871_10000712 Ga0213871_100007122 242
309 3300022467 Ga0224712_10002414 Ga0224712_100024143 242
310 3300025899 Ga0207642_10128705 Ga0207642_101287052 242
311 3300025903 Ga0207680_10209631 Ga0207680_102096312 242
312 3300025903 Ga0207680_10401492 Ga0207680_104014922 242
313 3300025909 Ga0207705_10008718 Ga0207705_100087186 242
314 3300025911 Ga0207654_10004981 Ga0207654_100049813 242
315 3300025912 Ga0207707_10007218 Ga0207707_100072187 242
316 3300025912 Ga0207707_10065395 Ga0207707_100653952 242
317 3300025912 Ga0207707_10116451 Ga0207707_101164511 242
318 3300025912 Ga0207707_10262808 Ga0207707_102628082 242
319 3300025912 Ga0207707_10471341 Ga0207707_104713412 242
320 3300025913 Ga0207695_10000470 Ga0207695_1000047025 242
321 3300025913 Ga0207695_10006140 Ga0207695_100061403 242
322 3300025913 Ga0207695_10010697 Ga0207695_100106977 242
323 3300025913 Ga0207695_10013497 Ga0207695_100134974 242
324 3300025913 Ga0207695_10029996 Ga0207695_100299962 242
325 3300025913 Ga0207695_10101832 Ga0207695_101018322 242
326 3300025913 Ga0207695_10107150 Ga0207695_101071503 242
327 3300025913 Ga0207695_10115620 Ga0207695_101156202 242
328 3300025913 Ga0207695_10419691 Ga0207695_104196912 242
329 3300025913 Ga0207695_10662935 Ga0207695_106629351 242
330 3300025914 Ga0207671_10019415 Ga0207671_100194152 242
331 3300025914 Ga0207671_10037511 Ga0207671_100375111 242
332 3300025914 Ga0207671_10046774 Ga0207671_100467742 242
333 3300025914 Ga0207671_10167956 Ga0207671_101679563 242
334 3300025914 Ga0207671_10431260 Ga0207671_104312602 242
335 3300025916 Ga0207663_10018362 Ga0207663_100183623 242
336 3300025916 Ga0207663_10157929 Ga0207663_101579292 242
337 3300025917 Ga0207660_10004761 Ga0207660_1000476110 242
338 3300025919 Ga0207657_10075609 Ga0207657_100756092 242
339 3300025919 Ga0207657_10216636 Ga0207657_102166362 242
340 3300025920 Ga0207649_10264256 Ga0207649_102642562 242
341 3300025921 Ga0207652_10021834 Ga0207652_100218343 242
342 3300025921 Ga0207652_10074284 Ga0207652_100742842 242
343 3300025921 Ga0207652_10078855 Ga0207652_100788552 242
344 3300025921 Ga0207652_10816101 Ga0207652_108161011 242
345 3300025924 Ga0207694_10000818 Ga0207694_1000081814 242
346 3300025924 Ga0207694_10004826 Ga0207694_100048269 242
347 3300025924 Ga0207694_10046209 Ga0207694_100462092 242
348 3300025924 Ga0207694_10254046 Ga0207694_102540462 242
349 3300025926 Ga0207659_10300554 Ga0207659_103005542 242
350 3300025927 Ga0207687_10001280 Ga0207687_100012809 242
351 3300025927 Ga0207687_10002559 Ga0207687_100025599 242
352 3300025928 Ga0207700_10002212 Ga0207700_100022125 242
353 3300025928 Ga0207700_10013778 Ga0207700_100137781 242
354 3300025928 Ga0207700_10048398 Ga0207700_100483982 242
355 3300025928 Ga0207700_10075163 Ga0207700_100751631 242
356 3300025928 Ga0207700_10149760 Ga0207700_101497602 242
357 3300025928 Ga0207700_10157584 Ga0207700_101575842 242
358 3300025929 Ga0207664_10012730 Ga0207664_100127306 242
359 3300025929 Ga0207664_10048554 Ga0207664_100485541 242
360 3300025929 Ga0207664_10061059 Ga0207664_100610592 242
361 3300025929 Ga0207664_10084911 Ga0207664_100849112 242
362 3300025931 Ga0207644_10017405 Ga0207644_100174051 242
363 3300025932 Ga0207690_10083038 Ga0207690_100830382 242
364 3300025932 Ga0207690_10091253 Ga0207690_100912531 242
365 3300025934 Ga0207686_10018506 Ga0207686_100185062 242
366 3300025934 Ga0207686_10459567 Ga0207686_104595672 242
367 3300025935 Ga0207709_10092935 Ga0207709_100929352 242
368 3300025936 Ga0207670_10229833 Ga0207670_102298332 242
369 3300025936 Ga0207670_10355753 Ga0207670_103557532 242
370 3300025937 Ga0207669_10191094 Ga0207669_101910942 242
371 3300025938 Ga0207704_10504794 Ga0207704_105047942 242
372 3300025941 Ga0207711_10010087 Ga0207711_100100879 242
373 3300025941 Ga0207711_10013977 Ga0207711_100139772 242
374 3300025941 Ga0207711_10081728 Ga0207711_100817282 242
375 3300025941 Ga0207711_10194994 Ga0207711_101949942 242
376 3300025941 Ga0207711_10309856 Ga0207711_103098561 242
377 3300025942 Ga0207689_10036394 Ga0207689_100363942 242
378 3300025942 Ga0207689_10160536 Ga0207689_101605362 242
379 3300025944 Ga0207661_10000008 Ga0207661_1000000870 242
380 3300025944 Ga0207661_10001072 Ga0207661_1000107217 242
381 3300025944 Ga0207661_10059944 Ga0207661_100599444 242
382 3300025944 Ga0207661_10090459 Ga0207661_100904592 242
383 3300025944 Ga0207661_10146882 Ga0207661_101468823 242
384 3300025944 Ga0207661_10321415 Ga0207661_103214152 242
385 3300025944 Ga0207661_10414219 Ga0207661_104142192 242
386 3300025945 Ga0207679_10392782 Ga0207679_103927822 242
387 3300025949 Ga0207667_10000145 Ga0207667_1000014599 242
388 3300025949 Ga0207667_10000290 Ga0207667_1000029039 242
389 3300025949 Ga0207667_10011688 Ga0207667_1001168810 242
390 3300025949 Ga0207667_10155824 Ga0207667_101558242 242
391 3300025949 Ga0207667_10192928 Ga0207667_101929282 242
392 3300025949 Ga0207667_10304703 Ga0207667_103047032 242
393 3300025949 Ga0207667_10712431 Ga0207667_107124312 242
394 3300025949 Ga0207667_10963294 Ga0207667_109632941 242
395 3300025960 Ga0207651_10043438 Ga0207651_100434382 242
396 3300025960 Ga0207651_10117804 Ga0207651_101178042 242
397 3300025960 Ga0207651_10363526 Ga0207651_103635262 242
398 3300025961 Ga0207712_10010922 Ga0207712_100109222 242
399 3300025986 Ga0207658_10357577 Ga0207658_103575772 242
400 3300026035 Ga0207703_10006989 Ga0207703_100069895 242
401 3300026041 Ga0207639_10035064 Ga0207639_100350642 242
402 3300026078 Ga0207702_10002090 Ga0207702_100020903 242
403 3300026078 Ga0207702_10028242 Ga0207702_100282422 242
404 3300026078 Ga0207702_10034359 Ga0207702_100343592 242
405 3300026088 Ga0207641_10454559 Ga0207641_104545592 242
406 3300026088 Ga0207641_10909892 Ga0207641_109098922 242
407 3300026089 Ga0207648_10141179 Ga0207648_101411791 242
408 3300026089 Ga0207648_10169932 Ga0207648_101699322 242
409 3300026095 Ga0207676_10259825 Ga0207676_102598252 242
410 3300026116 Ga0207674_10000264 Ga0207674_1000026475 242
411 3300026116 Ga0207674_10001670 Ga0207674_1000167029 242
412 3300028379 Ga0268266_10023283 Ga0268266_100232833 242
413 3300028379 Ga0268266_10226307 Ga0268266_102263072 242
414 3300028381 Ga0268264_10014792 Ga0268264_100147922 242
415 3300028653 Ga0265323_10000261 Ga0265323_1000026121 242
416 3300028800 Ga0265338_10096059 Ga0265338_100960592 242
417 3300028800 Ga0265338_10217341 Ga0265338_102173412 242
418 3300031241 Ga0265325_10052299 Ga0265325_100522992 242
419 3300031595 Ga0265313_10003281 Ga0265313_100032818 242
420 3300031711 Ga0265314_10001266 Ga0265314_1000126612 242
421 3300035117 Ga0373953_0085580 Ga0373953_0085580_201_965 242
422 3300035118 Ga0373954_0036060 Ga0373954_0036060_319_1083 242
423 3300035118 Ga0373954_0045734 Ga0373954_0045734_15_779 242
424 3300035118 Ga0373954_0202731 Ga0373954_0202731_200_928 242
425 3300035119 Ga0373956_0048036 Ga0373956_0048036_1135_1899 242
426 3300035120 Ga0373957_0024235 Ga0373957_0024235_727_1491 242
427 3300035172 Ga0373955_0067763 Ga0373955_0067763_898_1662 242
428 3300035172 Ga0373955_0110042 Ga0373955_0110042_807_1556 242
429 3300035410 Ga0373924_0167911 Ga0373924_0167911_163_942 242
430 3300035692 Ga0373935_0047100 Ga0373935_0047100_1120_1860 242
431 3300035692 Ga0373935_0131017 Ga0373935_0131017_825_1589 242
432 3300035724 Ga0373933_0021198 Ga0373933_0021198_509_1273 242
433 3300035724 Ga0373933_0050067 Ga0373933_0050067_1562_2311 242
434 3300035725 Ga0373947_0001364 Ga0373947_0001364_13893_14633 242
435 3300035725 Ga0373947_0155910 Ga0373947_0155910_280_1038 242
436 3300035725 Ga0373947_0263598 Ga0373947_0263598_200_940 242
437 3300036401 Ga0373937_0001893 Ga0373937_0001893_12853_13617 242
438 3300036401 Ga0373937_0020624 Ga0373937_0020624_3182_3961 242
439 3300036401 Ga0373937_0046600 Ga0373937_0046600_2769_3518 242
440 3300036401 Ga0373937_0393444 Ga0373937_0393444_34_774 242
441 3300036712 Ga0316584_0254296 Ga0316584_0254296_369_1139 242
442 3300037068 Ga0373925_0001414 Ga0373925_0001414_2822_3562 242
443 3300037068 Ga0373925_0053958 Ga0373925_0053958_1306_2064 242
444 3300037068 Ga0373925_0553994 Ga0373925_0553994_86_814 242
445 3300037418 Ga0395900_0113016 Ga0395900_0113016_316_1056 242
446 3300037466 Ga0395898_0056747 Ga0395898_0056747_2290_3021 242
447 3300037853 Ga0436364_0051577 Ga0436364_0051577_3552_4310 242
448 3300037853 Ga0436364_0059099 Ga0436364_0059099_212_952 242
449 3300037853 Ga0436364_0203770 Ga0436364_0203770_1736_2494 242
450 3300037853 Ga0436364_0362008 Ga0436364_0362008_2991_3731 242
451 3300037853 Ga0436364_0475118 Ga0436364_0475118_557_1336 242
452 3300037853 Ga0436364_0602759 Ga0436364_0602759_2849_3607 242
453 3300037853 Ga0436364_0657729 Ga0436364_0657729_54_782 242
454 3300037853 Ga0436364_0909379 Ga0436364_0909379_276_1049 242
455 3300037853 Ga0436364_0934794 Ga0436364_0934794_266_1024 242
456 3300037853 Ga0436364_1409641 Ga0436364_1409641_2986_3735 242
457 3300037853 Ga0436364_1556058 Ga0436364_1556058_2505_3263 242
458 3300039437 Ga0436365_0096934 Ga0436365_0096934_1093_1851 242
459 3300039437 Ga0436365_0157338 Ga0436365_0157338_434_1222 242
460 3300039437 Ga0436365_0288035 Ga0436365_0288035_171_899 242
461 3300039437 Ga0436365_0491703 Ga0436365_0491703_1132_1911 242
462 3300039437 Ga0436365_0617682 Ga0436365_0617682_6678_7418 242
463 3300039437 Ga0436365_0761153 Ga0436365_0761153_1179_1937 242
464 3300039437 Ga0436365_0860671 Ga0436365_0860671_7182_7970 242
465 3300039437 Ga0436365_1821431 Ga0436365_1821431_717_1475 242
466 3300039438 Ga0436360_0318029 Ga0436360_0318029_4417_5157 242
467 3300039438 Ga0436360_0701333 Ga0436360_0701333_1337_2095 242
468 3300039450 Ga0436363_0647949 Ga0436363_0647949_1473_2213 242
469 3300039450 Ga0436363_1203601 Ga0436363_1203601_3658_4398 242
470 3300039453 Ga0436362_0592346 Ga0436362_0592346_154_942 242
471 3300039453 Ga0436362_0620224 Ga0436362_0620224_627_1367 242
472 3300044694 Ga0466963_0234277 Ga0466963_0234277_219_959 242
473 3300044712 Ga0453684_0175287 Ga0453684_0175287_473_1228 242
474 3300045051 Ga0451576_0331392 Ga0451576_0331392_675_1403 242
475 3300045051 Ga0451576_0383525 Ga0451576_0383525_624_1352 242
476 3300045836 Ga0466958_0138432 Ga0466958_0138432_309_1037 242
477 3300045836 Ga0466958_0385170 Ga0466958_0385170_67_804 242
478 3300046454 Ga0495592_0163620 Ga0495592_0163620_275_1054 242
479 3300046462 Ga0495651_0402539 Ga0495651_0402539_19_747 242
480 3300046472 Ga0495580_0011195 Ga0495580_0011195_1386_2114 242
481 3300046472 Ga0495580_0014222 Ga0495580_0014222_1609_2337 242
482 3300046472 Ga0495580_0102050 Ga0495580_0102050_882_1640 242
483 3300046472 Ga0495580_0254849 Ga0495580_0254849_255_983 242
484 3300046472 Ga0495580_0394050 Ga0495580_0394050_47_805 242
485 3300046472 Ga0495580_0428837 Ga0495580_0428837_64_804 242
486 3300046472 Ga0495580_0509813 Ga0495580_0509813_30_770 242
487 3300046473 Ga0495582_0163420 Ga0495582_0163420_117_845 242
488 3300046511 Ga0495608_0102751 Ga0495608_0102751_353_1117 242
489 3300046517 Ga0495630_0137815 Ga0495630_0137815_528_1256 242
490 3300046529 Ga0495652_0101144 Ga0495652_0101144_1316_2077 242
491 3300046535 Ga0495586_0052466 Ga0495586_0052466_1215_1994 242
492 3300046536 Ga0495587_0000640 Ga0495587_0000640_252_1031 242
493 3300046536 Ga0495587_0027794 Ga0495587_0027794_2578_3306 242
494 3300046543 Ga0495645_0049288 Ga0495645_0049288_798_1526 242
495 3300046559 Ga0495667_0214137 Ga0495667_0214137_406_1134 242
496 3300046559 Ga0495667_0454334 Ga0495667_0454334_19_747 242
497 3300046663 Ga0495635_0103696 Ga0495635_0103696_832_1560 242
498 3300046675 Ga0495657_0137483 Ga0495657_0137483_235_963 242
499 3300046679 Ga0495623_0067839 Ga0495623_0067839_504_1232 242
500 3300046679 Ga0495623_0175255 Ga0495623_0175255_16_744 242
501 3300046683 Ga0495658_0357782 Ga0495658_0357782_142_870 242
502 3300046809 Ga0495600_0157501 Ga0495600_0157501_47_811 242
503 3300047318 Ga0495636_0016181 Ga0495636_0016181_1151_1915 242
504 3300047319 Ga0495674_0080987 Ga0495674_0080987_1911_2660 242
505 3300047319 Ga0495674_0206844 Ga0495674_0206844_516_1244 242
506 3300047321 Ga0495676_0364015 Ga0495676_0364015_13_753 242
507 3300047322 Ga0495680_0059445 Ga0495680_0059445_1536_2297 242
508 3300047471 Ga0495684_0030460 Ga0495684_0030460_2107_2835 242
509 3300047471 Ga0495684_0031272 Ga0495684_0031272_2894_3622 242
510 3300047471 Ga0495684_0032701 Ga0495684_0032701_2277_3041 242
511 3300047471 Ga0495684_0049869 Ga0495684_0049869_483_1244 242
512 3300048088 Ga0495602_0007373 Ga0495602_0007373_1012_1791 242
513 3300048088 Ga0495602_0143065 Ga0495602_0143065_42_770 242
514 3300048088 Ga0495602_0337095 Ga0495602_0337095_237_965 242
515 3300048905 Ga0496102_0675129 Ga0496102_0675129_132_890 242
516 3300048907 Ga0496104_0290375 Ga0496104_0290375_151_891 242
517 3300048911 Ga0496108_0682848 Ga0496108_0682848_111_851 242
518 3300048918 Ga0496115_0093629 Ga0496115_0093629_336_1076 242
519 3300049568 Ga0501031_0002163 Ga0501031_0002163_6169_6930 242
520 3300049570 Ga0501033_0027878 Ga0501033_0027878_2663_3424 242
521 3300049571 Ga0501034_0008169 Ga0501034_0008169_9403_10143 242
522 3300049571 Ga0501034_0037104 Ga0501034_0037104_2514_3275 242
523 3300049572 Ga0501036_0000255 Ga0501036_0000255_1903_2664 242
524 3300049573 Ga0501037_0029347 Ga0501037_0029347_789_1550 242
525 3300049574 Ga0501038_0001681 Ga0501038_0001681_10813_11574 242
526 3300049575 Ga0501039_0032376 Ga0501039_0032376_1594_2355 242
527 3300049576 Ga0501040_0471575 Ga0501040_0471575_121_849 242
528 3300049578 Ga0501042_0119259 Ga0501042_0119259_1016_1777 242
529 3300049579 Ga0501043_0238048 Ga0501043_0238048_10_771 242
530 3300049580 Ga0501046_0012015 Ga0501046_0012015_4937_5698 242
531 3300049580 Ga0501046_0129826 Ga0501046_0129826_623_1360 242
532 3300049581 Ga0501047_0005379 Ga0501047_0005379_1163_1903 242
533 3300049581 Ga0501047_0104999 Ga0501047_0104999_142_903 242
534 3300049581 Ga0501047_0393686 Ga0501047_0393686_248_988 242
535 3300049582 Ga0501048_0010139 Ga0501048_0010139_3042_3803 242
536 3300049582 Ga0501048_0552841 Ga0501048_0552841_50_790 242
537 3300049584 Ga0501068_0004494 Ga0501068_0004494_1375_2136 242
538 3300049585 Ga0501069_0003875 Ga0501069_0003875_2326_3087 242
539 3300049586 Ga0501070_0029721 Ga0501070_0029721_2016_2777 242
540 3300049586 Ga0501070_0090854 Ga0501070_0090854_1280_2020 242
541 3300049588 Ga0501072_0000250 Ga0501072_0000250_8791_9552 242
542 3300049589 Ga0501073_0009030 Ga0501073_0009030_1788_2549 242
543 3300049589 Ga0501073_0109147 Ga0501073_0109147_272_1012 242
544 3300049590 Ga0501074_0004552 Ga0501074_0004552_713_1474 242
545 3300049591 Ga0501075_0221346 Ga0501075_0221346_63_791 242
546 3300049592 Ga0501076_0507005 Ga0501076_0507005_148_909 242
547 3300049593 Ga0501077_0005572 Ga0501077_0005572_5110_5871 242
548 3300049661 Ga0501217_103991 Ga0501217_103991_46_792 242
549 3300049686 Ga0501257_041642 Ga0501257_041642_96_842 242
550 3300049741 Ga0501079_0010908 Ga0501079_0010908_5329_6090 242
551 3300049742 Ga0501080_0001964 Ga0501080_0001964_3023_3784 242
552 3300049742 Ga0501080_0172422 Ga0501080_0172422_277_1017 242
553 3300049744 Ga0501083_0011177 Ga0501083_0011177_3023_3784 242
554 3300049822 Ga0501035_0010163 Ga0501035_0010163_6071_6832 242
555 3300049822 Ga0501035_0056092 Ga0501035_0056092_2178_2915 242
556 3300049822 Ga0501035_0335447 Ga0501035_0335447_118_858 242
557 3300049823 Ga0501044_0002393 Ga0501044_0002393_15986_16723 242
558 3300049823 Ga0501044_0021570 Ga0501044_0021570_2028_2765 242
559 3300049823 Ga0501044_0044948 Ga0501044_0044948_2016_2777 242
560 3300050508 nmdc:mga09592_346529_c1 nmdc:mga09592_346529_c1_504_1250 242
561 3300050509 nmdc:mga0qj67_97961_c1 nmdc:mga0qj67_97961_c1_650_1390 242
562 3300050511 nmdc:mga08y16_251203_c1 nmdc:mga08y16_251203_c1_658_1443 242
563 3300050511 nmdc:mga08y16_390678_c1 nmdc:mga08y16_390678_c1_482_1210 242
564 3300053077 Ga0495601_0052290 Ga0495601_0052290_542_1306 242
565 3300054114 Ga0501084_0000893 Ga0501084_0000893_5048_5809 242
566 3300060353 Ga0501082_0000283 Ga0501082_0000283_7120_7848 242
567 3300060353 Ga0501082_0062309 Ga0501082_0062309_2308_3069 242
568 3300060353 Ga0501082_0216336 Ga0501082_0216336_207_935 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

67

213

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wbs-assembly1.cif.gz_A crystal structure of an abc transporter related protein from burkholderia phymatum 0.9798 1 239
5x5y-assembly1.cif.gz_A a membrane protein complex 0.9719 3 239
6hs3-assembly1.cif.gz_A crystal structure of an abc transporter related protein from burkholderia pseudomallei 0.9706 1 239
6mjp-assembly1.cif.gz_B lptb(e163q)fgc from vibrio cholerae 0.9694 3 239
4wbs-assembly2.cif.gz_B crystal structure of an abc transporter related protein from burkholderia phymatum 0.9684 2 239
ID Description Score Start End Superfamily
4wbsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9798 1 239 3.40.50.300
4wbsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.964 1 239 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9523 4 236 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9411 1 219 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9296 4 232 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A800DFT5-F1-model_v4 LPS export ABC transporter ATP-binding protein 0.9952 47 239 GO:0005524
GO:0016887
GO:0043190
GO:0055085
AF-A0A1I2K4U1-F1-model_v4 Lipopolysaccharide export system ATP-binding protein LptB 0.9951 2 239 GO:0005524
GO:0005737
GO:0016887
GO:0043190
GO:0055085
AF-A0A7C3HEI8-F1-model_v4 ATP-binding cassette domain-containing protein 0.9922 138 241 GO:0005524
GO:0005886
GO:0016887
AF-A0A2V7MZW3-F1-model_v4 LPS export ABC transporter ATP-binding protein 0.991 2 237 GO:0005524
GO:0016887
GO:0043190
GO:0055085
AF-A0A520NCX8-F1-model_v4 LPS export ABC transporter ATP-binding protein 0.9907 4 239 GO:0005524
GO:0016887
GO:0043190
GO:0055085

Feature Viewer

pLDDT pTM Quality
94.94 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map