F464607
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 568 | 218 | 568 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100006709|Ga0068856_1000067097 |
| Length | 295 |
| Sequence | MNPLRRSRRSLRRLDCACSQIHCVSYTYQLQRISLEPAARLAFGPSRHMRTLQTVEISKSYSGRRVVDNVTVRVGQGEVVGLLGPNGAGKTTSFYIIVGLISPESGEVLLDGKSITPLPMYQRARRGVSYLPQEPSVFRKLSVEDNLMAILQTLPLNGRERRERMNVLIEDMGLETVRHSKGYMLSGGERRRVEIARSLVLQPDFILLDEPFSGIDPIQVLELQRIIGDLKRKGIGILVTDHNVRETLAVTDRAYIISSGRIFRAGSPESLGNDPEVRRIYLGENFYFPPVLAGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 73 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 74 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 75 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 76 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 129 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 132 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 134 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 137 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 138 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 140 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 144 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 145 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 146 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 147 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 148 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 149 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 150 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 180 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 205 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 206 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 217 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.18 |
| Nodule | 0 |
| Rhizoplane | 0.7 |
| Rhizosphere | 92.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100000008 | 3300005329 | Bacteria | 329206 |
| 2 | Ga0070683_100001900 | 3300005329 | Bacteria | 16333 |
| 3 | Ga0070683_100014842 | 3300005329 | Bacteria | 6829 |
| 4 | Ga0070683_100037407 | 3300005329 | Bacteria | 4443 |
| 5 | Ga0070683_100079582 | 3300005329 | Bacteria | 3067 |
| 6 | Ga0070683_100225677 | 3300005329 | Bacteria | 1780 |
| 7 | Ga0070683_100482516 | 3300005329 | Bacteria | 1184 |
| 8 | Ga0068869_100052850 | 3300005334 | Bacteria | 2951 |
| 9 | Ga0068869_100226762 | 3300005334 | Bacteria | 1483 |
| 10 | Ga0070666_10055652 | 3300005335 | Bacteria | 2670 |
| 11 | Ga0070666_10331947 | 3300005335 | Bacteria | 1086 |
| 12 | Ga0070680_100000677 | 3300005336 | Bacteria | 23667 |
| 13 | Ga0070680_100260766 | 3300005336 | Bacteria | 1466 |
| 14 | Ga0070680_100314890 | 3300005336 | Bacteria | 1328 |
| 15 | Ga0070660_100009046 | 3300005339 | Bacteria | 6989 |
| 16 | Ga0070660_100026524 | 3300005339 | Bacteria | 4314 |
| 17 | Ga0070660_100061874 | 3300005339 | Bacteria | 2907 |
| 18 | Ga0070660_100140177 | 3300005339 | Bacteria | 1939 |
| 19 | Ga0070691_10015204 | 3300005341 | Bacteria | 3536 |
| 20 | Ga0070687_100478053 | 3300005343 | Bacteria | 834 |
| 21 | Ga0070661_100038345 | 3300005344 | Bacteria | 3488 |
| 22 | Ga0070668_100178369 | 3300005347 | Bacteria | 1734 |
| 23 | Ga0070669_100380405 | 3300005353 | Bacteria | 1151 |
| 24 | Ga0070674_100036703 | 3300005356 | Bacteria | 3292 |
| 25 | Ga0070673_100011878 | 3300005364 | Bacteria | 5962 |
| 26 | Ga0070673_100145132 | 3300005364 | Bacteria | 2006 |
| 27 | Ga0070673_100447870 | 3300005364 | Bacteria | 1161 |
| 28 | Ga0070659_100065655 | 3300005366 | Bacteria | 2874 |
| 29 | Ga0070667_100436781 | 3300005367 | Bacteria | 1195 |
| 30 | Ga0070709_10106055 | 3300005434 | Bacteria | 1881 |
| 31 | Ga0070714_100002199 | 3300005435 | Bacteria | 14362 |
| 32 | Ga0070714_100066908 | 3300005435 | Bacteria | 3097 |
| 33 | Ga0070714_100119549 | 3300005435 | Bacteria | 2342 |
| 34 | Ga0070714_100517729 | 3300005435 | Bacteria | 1139 |
| 35 | Ga0070714_100569380 | 3300005435 | Bacteria | 1086 |
| 36 | Ga0070713_100003787 | 3300005436 | Bacteria | 10015 |
| 37 | Ga0070713_100007840 | 3300005436 | Bacteria | 7528 |
| 38 | Ga0070713_100148944 | 3300005436 | Bacteria | 2080 |
| 39 | Ga0070713_100174044 | 3300005436 | Bacteria | 1930 |
| 40 | Ga0070713_100316474 | 3300005436 | Unclassified | 1440 |
| 41 | Ga0070701_10103267 | 3300005438 | Bacteria | 1582 |
| 42 | Ga0070711_100007987 | 3300005439 | Bacteria | 6459 |
| 43 | Ga0070711_100010318 | 3300005439 | Bacteria | 5778 |
| 44 | Ga0070711_100048495 | 3300005439 | Bacteria | 2905 |
| 45 | Ga0070711_100125161 | 3300005439 | Bacteria | 1907 |
| 46 | Ga0070705_100099200 | 3300005440 | Bacteria | 1835 |
| 47 | Ga0070681_10007191 | 3300005458 | Bacteria | 10848 |
| 48 | Ga0070681_10017934 | 3300005458 | Bacteria | 7076 |
| 49 | Ga0070681_10081737 | 3300005458 | Bacteria | 3187 |
| 50 | Ga0070681_10145649 | 3300005458 | Bacteria | 2298 |
| 51 | Ga0070681_10228452 | 3300005458 | Bacteria | 1775 |
| 52 | Ga0068867_100269336 | 3300005459 | Bacteria | 1392 |
| 53 | Ga0070679_100028687 | 3300005530 | Bacteria | 5489 |
| 54 | Ga0070679_100116873 | 3300005530 | Bacteria | 2652 |
| 55 | Ga0070679_100162172 | 3300005530 | Bacteria | 2210 |
| 56 | Ga0070679_100569882 | 3300005530 | Bacteria | 1076 |
| 57 | Ga0070679_100781188 | 3300005530 | Bacteria | 898 |
| 58 | Ga0070684_100000002 | 3300005535 | Bacteria | 257669 |
| 59 | Ga0070684_100003837 | 3300005535 | Bacteria | 11361 |
| 60 | Ga0070684_100022567 | 3300005535 | Bacteria | 5252 |
| 61 | Ga0070684_100074730 | 3300005535 | Bacteria | 2988 |
| 62 | Ga0070684_100571768 | 3300005535 | Bacteria | 1050 |
| 63 | Ga0070686_100177528 | 3300005544 | Bacteria | 1511 |
| 64 | Ga0070695_100177298 | 3300005545 | Bacteria | 1508 |
| 65 | Ga0070695_100257203 | 3300005545 | Bacteria | 1274 |
| 66 | Ga0070665_100085135 | 3300005548 | Bacteria | 3167 |
| 67 | Ga0070665_100261525 | 3300005548 | Bacteria | 1732 |
| 68 | Ga0070665_100291856 | 3300005548 | Bacteria | 1633 |
| 69 | Ga0070665_100395535 | 3300005548 | Bacteria | 1390 |
| 70 | Ga0070665_100510306 | 3300005548 | Bacteria | 1214 |
| 71 | Ga0068855_100009996 | 3300005563 | Bacteria | 11432 |
| 72 | Ga0068855_100015477 | 3300005563 | Bacteria | 9183 |
| 73 | Ga0068855_100016105 | 3300005563 | Bacteria | 8989 |
| 74 | Ga0068855_100017428 | 3300005563 | Bacteria | 8640 |
| 75 | Ga0068855_100060397 | 3300005563 | Bacteria | 4433 |
| 76 | Ga0068855_100063730 | 3300005563 | Bacteria | 4300 |
| 77 | Ga0068855_100103223 | 3300005563 | Bacteria | 3281 |
| 78 | Ga0068855_100162916 | 3300005563 | Bacteria | 2530 |
| 79 | Ga0068855_100174102 | 3300005563 | Bacteria | 2436 |
| 80 | Ga0068855_100296764 | 3300005563 | Bacteria | 1790 |
| 81 | Ga0068855_100724929 | 3300005563 | Bacteria | 1062 |
| 82 | Ga0068857_100003127 | 3300005577 | Bacteria | 13693 |
| 83 | Ga0068857_100110224 | 3300005577 | Bacteria | 2473 |
| 84 | Ga0068854_100138297 | 3300005578 | Bacteria | 1866 |
| 85 | Ga0068856_100005417 | 3300005614 | Bacteria | 12572 |
| 86 | Ga0068856_100006709 | 3300005614 | Bacteria | 11280 |
| 87 | Ga0068856_100016973 | 3300005614 | Bacteria | 7057 |
| 88 | Ga0068856_100053461 | 3300005614 | Bacteria | 3982 |
| 89 | Ga0068856_100058410 | 3300005614 | Bacteria | 3809 |
| 90 | Ga0068856_100118342 | 3300005614 | Bacteria | 2650 |
| 91 | Ga0068856_100422736 | 3300005614 | Bacteria | 1352 |
| 92 | Ga0068852_100008659 | 3300005616 | Bacteria | 7518 |
| 93 | Ga0068852_100060397 | 3300005616 | Bacteria | 3290 |
| 94 | Ga0068852_100282565 | 3300005616 | Bacteria | 1600 |
| 95 | Ga0068859_100055438 | 3300005617 | Bacteria | 3989 |
| 96 | Ga0068859_100199818 | 3300005617 | Bacteria | 2084 |
| 97 | Ga0068859_100370362 | 3300005617 | Bacteria | 1528 |
| 98 | Ga0068859_100997121 | 3300005617 | Bacteria | 920 |
| 99 | Ga0068864_100223655 | 3300005618 | Bacteria | 1737 |
| 100 | Ga0068866_10006279 | 3300005718 | Bacteria | 4946 |
| 101 | Ga0068861_100874459 | 3300005719 | Bacteria | 849 |
| 102 | Ga0068863_100091762 | 3300005841 | Bacteria | 2880 |
| 103 | Ga0068863_100259366 | 3300005841 | Bacteria | 1680 |
| 104 | Ga0068863_100297219 | 3300005841 | Bacteria | 1566 |
| 105 | Ga0068858_100038124 | 3300005842 | Bacteria | 4457 |
| 106 | Ga0068858_100054904 | 3300005842 | Bacteria | 3683 |
| 107 | Ga0068858_100107109 | 3300005842 | Bacteria | 2609 |
| 108 | Ga0068858_100250634 | 3300005842 | Bacteria | 1682 |
| 109 | Ga0068860_100005181 | 3300005843 | Bacteria | 13253 |
| 110 | Ga0068860_100323128 | 3300005843 | Bacteria | 1515 |
| 111 | Ga0081455_10043488 | 3300005937 | Bacteria | 3928 |
| 112 | Ga0070717_10009055 | 3300006028 | Bacteria | 7473 |
| 113 | Ga0070717_10016370 | 3300006028 | Bacteria | 5749 |
| 114 | Ga0070717_10037014 | 3300006028 | Bacteria | 3960 |
| 115 | Ga0070717_10270977 | 3300006028 | Bacteria | 1504 |
| 116 | Ga0070712_100435498 | 3300006175 | Bacteria | 1089 |
| 117 | Ga0097621_100076451 | 3300006237 | Bacteria | 2778 |
| 118 | Ga0097621_100153476 | 3300006237 | Bacteria | 1976 |
| 119 | Ga0068871_100029962 | 3300006358 | Bacteria | 4280 |
| 120 | Ga0068871_100053583 | 3300006358 | Bacteria | 3270 |
| 121 | Ga0068871_100197464 | 3300006358 | Bacteria | 1736 |
| 122 | Ga0068871_100542794 | 3300006358 | Bacteria | 1052 |
| 123 | Ga0075430_100069294 | 3300006846 | Bacteria | 2959 |
| 124 | Ga0075429_100372687 | 3300006880 | Bacteria | 1250 |
| 125 | Ga0075436_100021873 | 3300006914 | Bacteria | 4391 |
| 126 | Ga0097620_100055437 | 3300006931 | Bacteria | 3989 |
| 127 | Ga0097620_100199802 | 3300006931 | Bacteria | 2084 |
| 128 | Ga0097620_100370327 | 3300006931 | Bacteria | 1528 |
| 129 | Ga0097620_100996879 | 3300006931 | Bacteria | 920 |
| 130 | Ga0105240_10000429 | 3300009093 | Bacteria | 77882 |
| 131 | Ga0105240_10005328 | 3300009093 | Bacteria | 19189 |
| 132 | Ga0105240_10007071 | 3300009093 | Bacteria | 16360 |
| 133 | Ga0105240_10008797 | 3300009093 | Bacteria | 14382 |
| 134 | Ga0105240_10014961 | 3300009093 | Bacteria | 10571 |
| 135 | Ga0105240_10016627 | 3300009093 | Bacteria | 9950 |
| 136 | Ga0105240_10034152 | 3300009093 | Bacteria | 6564 |
| 137 | Ga0105240_10034531 | 3300009093 | Bacteria | 6522 |
| 138 | Ga0105240_10186563 | 3300009093 | Bacteria | 2442 |
| 139 | Ga0105240_10318326 | 3300009093 | Bacteria | 1774 |
| 140 | Ga0105240_10814909 | 3300009093 | Bacteria | 1010 |
| 141 | Ga0105240_10906886 | 3300009093 | Bacteria | 948 |
| 142 | Ga0105245_10000273 | 3300009098 | Bacteria | 49064 |
| 143 | Ga0105245_10000579 | 3300009098 | Bacteria | 33283 |
| 144 | Ga0105245_10017701 | 3300009098 | Bacteria | 6221 |
| 145 | Ga0105245_10087169 | 3300009098 | Bacteria | 2865 |
| 146 | Ga0105245_10106423 | 3300009098 | Bacteria | 2602 |
| 147 | Ga0105245_10135244 | 3300009098 | Bacteria | 2316 |
| 148 | Ga0105245_10360468 | 3300009098 | Bacteria | 1443 |
| 149 | Ga0105245_11009608 | 3300009098 | Bacteria | 877 |
| 150 | Ga0105243_10040207 | 3300009148 | Bacteria | 3650 |
| 151 | Ga0105243_10056235 | 3300009148 | Bacteria | 3128 |
| 152 | Ga0105243_10477788 | 3300009148 | Bacteria | 1175 |
| 153 | Ga0105241_10000998 | 3300009174 | Bacteria | 21446 |
| 154 | Ga0105241_10067848 | 3300009174 | Bacteria | 2762 |
| 155 | Ga0105241_10264084 | 3300009174 | Bacteria | 1464 |
| 156 | Ga0105242_10344456 | 3300009176 | Bacteria | 1374 |
| 157 | Ga0105242_10405537 | 3300009176 | Bacteria | 1273 |
| 158 | Ga0105248_10031133 | 3300009177 | Bacteria | 5963 |
| 159 | Ga0105248_10031794 | 3300009177 | Bacteria | 5897 |
| 160 | Ga0105248_10102595 | 3300009177 | Bacteria | 3224 |
| 161 | Ga0105248_10145239 | 3300009177 | Bacteria | 2677 |
| 162 | Ga0105248_10670202 | 3300009177 | Bacteria | 1170 |
| 163 | Ga0105248_11211217 | 3300009177 | Bacteria | 854 |
| 164 | Ga0105237_10001090 | 3300009545 | Bacteria | 36343 |
| 165 | Ga0105237_10002784 | 3300009545 | Bacteria | 21245 |
| 166 | Ga0105237_10015615 | 3300009545 | Bacteria | 7894 |
| 167 | Ga0105237_10034802 | 3300009545 | Bacteria | 5097 |
| 168 | Ga0105237_10147837 | 3300009545 | Bacteria | 2345 |
| 169 | Ga0105237_10181006 | 3300009545 | Bacteria | 2108 |
| 170 | Ga0105237_10218788 | 3300009545 | Bacteria | 1905 |
| 171 | Ga0105237_10379661 | 3300009545 | Bacteria | 1418 |
| 172 | Ga0105238_10003080 | 3300009551 | Bacteria | 16631 |
| 173 | Ga0105238_10011625 | 3300009551 | Bacteria | 8868 |
| 174 | Ga0105238_10034169 | 3300009551 | Bacteria | 5174 |
| 175 | Ga0105238_10060312 | 3300009551 | Bacteria | 3798 |
| 176 | Ga0105238_10145966 | 3300009551 | Bacteria | 2342 |
| 177 | Ga0105238_10238310 | 3300009551 | Bacteria | 1796 |
| 178 | Ga0105238_10465429 | 3300009551 | Bacteria | 1262 |
| 179 | Ga0105249_10019639 | 3300009553 | Bacteria | 6031 |
| 180 | Ga0105249_10055098 | 3300009553 | Bacteria | 3636 |
| 181 | Ga0105239_10002592 | 3300010375 | Bacteria | 22902 |
| 182 | Ga0105239_10009694 | 3300010375 | Bacteria | 10829 |
| 183 | Ga0105239_10049742 | 3300010375 | Bacteria | 4596 |
| 184 | Ga0105239_10197565 | 3300010375 | Bacteria | 2253 |
| 185 | Ga0105239_10197879 | 3300010375 | Bacteria | 2251 |
| 186 | Ga0105239_10249964 | 3300010375 | Bacteria | 1991 |
| 187 | Ga0105246_10011848 | 3300011119 | Bacteria | 5422 |
| 188 | Ga0105246_10125648 | 3300011119 | Bacteria | 1908 |
| 189 | Ga0105246_10668816 | 3300011119 | Bacteria | 906 |
| 190 | Ga0157371_10013037 | 3300013102 | Bacteria | 6330 |
| 191 | Ga0157371_10165120 | 3300013102 | Bacteria | 1581 |
| 192 | Ga0157370_10012939 | 3300013104 | Bacteria | 8626 |
| 193 | Ga0157370_10019317 | 3300013104 | Bacteria | 6840 |
| 194 | Ga0157370_10020902 | 3300013104 | Bacteria | 6529 |
| 195 | Ga0157370_10098514 | 3300013104 | Bacteria | 2741 |
| 196 | Ga0157370_10103094 | 3300013104 | Bacteria | 2671 |
| 197 | Ga0157370_10237655 | 3300013104 | Bacteria | 1686 |
| 198 | Ga0157370_10267985 | 3300013104 | Bacteria | 1578 |
| 199 | Ga0157369_10002698 | 3300013105 | Bacteria | 21162 |
| 200 | Ga0157369_10009582 | 3300013105 | Bacteria | 11075 |
| 201 | Ga0157369_10023045 | 3300013105 | Bacteria | 6940 |
| 202 | Ga0157369_10025896 | 3300013105 | Bacteria | 6508 |
| 203 | Ga0157369_10038177 | 3300013105 | Bacteria | 5252 |
| 204 | Ga0157369_10155578 | 3300013105 | Bacteria | 2415 |
| 205 | Ga0157369_10177348 | 3300013105 | Bacteria | 2243 |
| 206 | Ga0157369_10202587 | 3300013105 | Bacteria | 2082 |
| 207 | Ga0157369_10223578 | 3300013105 | Bacteria | 1970 |
| 208 | Ga0157369_10412880 | 3300013105 | Bacteria | 1400 |
| 209 | Ga0157369_10483695 | 3300013105 | Bacteria | 1281 |
| 210 | Ga0157369_10728272 | 3300013105 | Bacteria | 1021 |
| 211 | Ga0157374_10016687 | 3300013296 | Bacteria | 6460 |
| 212 | Ga0157374_10049371 | 3300013296 | Bacteria | 3908 |
| 213 | Ga0157374_10061073 | 3300013296 | Bacteria | 3529 |
| 214 | Ga0157374_10218861 | 3300013296 | Bacteria | 1868 |
| 215 | Ga0157374_10407343 | 3300013296 | Bacteria | 1357 |
| 216 | Ga0157374_10487470 | 3300013296 | Bacteria | 1236 |
| 217 | Ga0157374_10617527 | 3300013296 | Bacteria | 1095 |
| 218 | Ga0163162_10124350 | 3300013306 | Bacteria | 2685 |
| 219 | Ga0163162_10148226 | 3300013306 | Bacteria | 2463 |
| 220 | Ga0163162_10905617 | 3300013306 | Bacteria | 995 |
| 221 | Ga0157372_10004812 | 3300013307 | Bacteria | 14350 |
| 222 | Ga0157372_10029757 | 3300013307 | Bacteria | 5968 |
| 223 | Ga0157372_10074425 | 3300013307 | Bacteria | 3830 |
| 224 | Ga0157372_10086820 | 3300013307 | Bacteria | 3549 |
| 225 | Ga0157372_10117799 | 3300013307 | Bacteria | 3046 |
| 226 | Ga0157372_10777737 | 3300013307 | Bacteria | 1113 |
| 227 | Ga0157375_10026447 | 3300013308 | Bacteria | 5408 |
| 228 | Ga0157375_10059048 | 3300013308 | Bacteria | 3798 |
| 229 | Ga0157375_10885082 | 3300013308 | Bacteria | 1038 |
| 230 | Ga0163163_10011072 | 3300014325 | Bacteria | 8160 |
| 231 | Ga0163163_10022012 | 3300014325 | Bacteria | 6027 |
| 232 | Ga0163163_10074254 | 3300014325 | Bacteria | 3392 |
| 233 | Ga0163163_10375595 | 3300014325 | Bacteria | 1479 |
| 234 | Ga0157380_10628249 | 3300014326 | Bacteria | 1067 |
| 235 | Ga0157377_10322409 | 3300014745 | Bacteria | 1027 |
| 236 | Ga0157379_10563167 | 3300014968 | Bacteria | 1061 |
| 237 | Ga0157376_10021715 | 3300014969 | Bacteria | 4989 |
| 238 | Ga0157376_10075195 | 3300014969 | Bacteria | 2882 |
| 239 | Ga0157376_10104900 | 3300014969 | Bacteria | 2478 |
| 240 | Ga0157376_10111498 | 3300014969 | Bacteria | 2408 |
| 241 | Ga0157376_10130430 | 3300014969 | Bacteria | 2242 |
| 242 | Ga0213874_10007461 | 3300021377 | Bacteria | 2626 |
| 243 | Ga0213874_10048568 | 3300021377 | Bacteria | 1295 |
| 244 | Ga0213876_10002768 | 3300021384 | Bacteria | 10215 |
| 245 | Ga0213876_10018059 | 3300021384 | Bacteria | 3722 |
| 246 | Ga0213876_10028854 | 3300021384 | Bacteria | 2926 |
| 247 | Ga0213875_10000005 | 3300021388 | Bacteria | 595146 |
| 248 | Ga0213875_10001437 | 3300021388 | Bacteria | 15432 |
| 249 | Ga0213875_10015098 | 3300021388 | Bacteria | 3761 |
| 250 | Ga0213875_10120416 | 3300021388 | Bacteria | 1226 |
| 251 | Ga0213875_10170015 | 3300021388 | Bacteria | 1023 |
| 252 | Ga0213871_10000712 | 3300021441 | Bacteria | 4865 |
| 253 | Ga0224712_10002414 | 3300022467 | Bacteria | 4606 |
| 254 | Ga0207642_10128705 | 3300025899 | Bacteria | 1318 |
| 255 | Ga0207680_10209631 | 3300025903 | Bacteria | 1332 |
| 256 | Ga0207680_10401492 | 3300025903 | Bacteria | 969 |
| 257 | Ga0207699_10114365 | 3300025906 | Bacteria | 1735 |
| 258 | Ga0207705_10008718 | 3300025909 | Bacteria | 7391 |
| 259 | Ga0207684_10447695 | 3300025910 | Bacteria | 1109 |
| 260 | Ga0207654_10004981 | 3300025911 | Bacteria | 6715 |
| 261 | Ga0207707_10007218 | 3300025912 | Bacteria | 9671 |
| 262 | Ga0207707_10013512 | 3300025912 | Bacteria | 7116 |
| 263 | Ga0207707_10065395 | 3300025912 | Bacteria | 3168 |
| 264 | Ga0207707_10116451 | 3300025912 | Bacteria | 2335 |
| 265 | Ga0207707_10143814 | 3300025912 | Bacteria | 2085 |
| 266 | Ga0207707_10262808 | 3300025912 | Bacteria | 1497 |
| 267 | Ga0207707_10471341 | 3300025912 | Bacteria | 1073 |
| 268 | Ga0207695_10000470 | 3300025913 | Bacteria | 87551 |
| 269 | Ga0207695_10006140 | 3300025913 | Bacteria | 15663 |
| 270 | Ga0207695_10010697 | 3300025913 | Bacteria | 11204 |
| 271 | Ga0207695_10013497 | 3300025913 | Bacteria | 9738 |
| 272 | Ga0207695_10029996 | 3300025913 | Bacteria | 5997 |
| 273 | Ga0207695_10101832 | 3300025913 | Bacteria | 2866 |
| 274 | Ga0207695_10106495 | 3300025913 | Bacteria | 2790 |
| 275 | Ga0207695_10107150 | 3300025913 | Bacteria | 2780 |
| 276 | Ga0207695_10115620 | 3300025913 | Bacteria | 2657 |
| 277 | Ga0207695_10419691 | 3300025913 | Bacteria | 1222 |
| 278 | Ga0207695_10662935 | 3300025913 | Bacteria | 924 |
| 279 | Ga0207671_10019415 | 3300025914 | Bacteria | 5196 |
| 280 | Ga0207671_10024035 | 3300025914 | Bacteria | 4587 |
| 281 | Ga0207671_10037511 | 3300025914 | Bacteria | 3594 |
| 282 | Ga0207671_10046774 | 3300025914 | Bacteria | 3202 |
| 283 | Ga0207671_10167956 | 3300025914 | Bacteria | 1702 |
| 284 | Ga0207671_10431260 | 3300025914 | Bacteria | 1049 |
| 285 | Ga0207663_10018362 | 3300025916 | Bacteria | 3919 |
| 286 | Ga0207663_10100162 | 3300025916 | Bacteria | 1944 |
| 287 | Ga0207663_10157929 | 3300025916 | Bacteria | 1597 |
| 288 | Ga0207660_10004761 | 3300025917 | Bacteria | 8837 |
| 289 | Ga0207657_10075609 | 3300025919 | Bacteria | 2842 |
| 290 | Ga0207657_10216636 | 3300025919 | Bacteria | 1535 |
| 291 | Ga0207649_10231426 | 3300025920 | Bacteria | 1322 |
| 292 | Ga0207649_10264256 | 3300025920 | Bacteria | 1245 |
| 293 | Ga0207652_10021834 | 3300025921 | Bacteria | 5287 |
| 294 | Ga0207652_10074284 | 3300025921 | Bacteria | 2960 |
| 295 | Ga0207652_10078855 | 3300025921 | Bacteria | 2877 |
| 296 | Ga0207652_10455037 | 3300025921 | Bacteria | 1154 |
| 297 | Ga0207652_10473225 | 3300025921 | Bacteria | 1129 |
| 298 | Ga0207652_10478558 | 3300025921 | Bacteria | 1122 |
| 299 | Ga0207652_10816101 | 3300025921 | Bacteria | 828 |
| 300 | Ga0207694_10000818 | 3300025924 | Bacteria | 27805 |
| 301 | Ga0207694_10004826 | 3300025924 | Bacteria | 10464 |
| 302 | Ga0207694_10046209 | 3300025924 | Bacteria | 3365 |
| 303 | Ga0207694_10254046 | 3300025924 | Bacteria | 1439 |
| 304 | Ga0207659_10300554 | 3300025926 | Bacteria | 1318 |
| 305 | Ga0207687_10001280 | 3300025927 | Bacteria | 17197 |
| 306 | Ga0207687_10002559 | 3300025927 | Bacteria | 12356 |
| 307 | Ga0207700_10002212 | 3300025928 | Bacteria | 11163 |
| 308 | Ga0207700_10013778 | 3300025928 | Bacteria | 5275 |
| 309 | Ga0207700_10048398 | 3300025928 | Bacteria | 3157 |
| 310 | Ga0207700_10075163 | 3300025928 | Bacteria | 2617 |
| 311 | Ga0207700_10149760 | 3300025928 | Bacteria | 1927 |
| 312 | Ga0207700_10157584 | 3300025928 | Bacteria | 1883 |
| 313 | Ga0207664_10012730 | 3300025929 | Bacteria | 6021 |
| 314 | Ga0207664_10048554 | 3300025929 | Bacteria | 3338 |
| 315 | Ga0207664_10061059 | 3300025929 | Bacteria | 3006 |
| 316 | Ga0207664_10084911 | 3300025929 | Unclassified | 2583 |
| 317 | Ga0207644_10017405 | 3300025931 | Bacteria | 4852 |
| 318 | Ga0207690_10083038 | 3300025932 | Bacteria | 2242 |
| 319 | Ga0207690_10091253 | 3300025932 | Bacteria | 2153 |
| 320 | Ga0207686_10018506 | 3300025934 | Bacteria | 3946 |
| 321 | Ga0207686_10214714 | 3300025934 | Bacteria | 1385 |
| 322 | Ga0207686_10459567 | 3300025934 | Bacteria | 981 |
| 323 | Ga0207709_10092935 | 3300025935 | Bacteria | 1976 |
| 324 | Ga0207670_10229833 | 3300025936 | Bacteria | 1424 |
| 325 | Ga0207670_10355753 | 3300025936 | Bacteria | 1161 |
| 326 | Ga0207669_10191094 | 3300025937 | Bacteria | 1477 |
| 327 | Ga0207704_10504794 | 3300025938 | Bacteria | 975 |
| 328 | Ga0207711_10010087 | 3300025941 | Bacteria | 7852 |
| 329 | Ga0207711_10013977 | 3300025941 | Bacteria | 6668 |
| 330 | Ga0207711_10081728 | 3300025941 | Bacteria | 2824 |
| 331 | Ga0207711_10194994 | 3300025941 | Bacteria | 1847 |
| 332 | Ga0207711_10309856 | 3300025941 | Bacteria | 1457 |
| 333 | Ga0207689_10036394 | 3300025942 | Bacteria | 4087 |
| 334 | Ga0207689_10160536 | 3300025942 | Bacteria | 1852 |
| 335 | Ga0207661_10000008 | 3300025944 | Bacteria | 451211 |
| 336 | Ga0207661_10001072 | 3300025944 | Bacteria | 18217 |
| 337 | Ga0207661_10045157 | 3300025944 | Bacteria | 3485 |
| 338 | Ga0207661_10059944 | 3300025944 | Bacteria | 3068 |
| 339 | Ga0207661_10090459 | 3300025944 | Bacteria | 2548 |
| 340 | Ga0207661_10146882 | 3300025944 | Bacteria | 2035 |
| 341 | Ga0207661_10321415 | 3300025944 | Bacteria | 1391 |
| 342 | Ga0207661_10414219 | 3300025944 | Bacteria | 1223 |
| 343 | Ga0207679_10392782 | 3300025945 | Bacteria | 1219 |
| 344 | Ga0207667_10000145 | 3300025949 | Bacteria | 107389 |
| 345 | Ga0207667_10000290 | 3300025949 | Bacteria | 69361 |
| 346 | Ga0207667_10011688 | 3300025949 | Bacteria | 10186 |
| 347 | Ga0207667_10127407 | 3300025949 | Bacteria | 2622 |
| 348 | Ga0207667_10155824 | 3300025949 | Bacteria | 2350 |
| 349 | Ga0207667_10192928 | 3300025949 | Bacteria | 2090 |
| 350 | Ga0207667_10304703 | 3300025949 | Bacteria | 1628 |
| 351 | Ga0207667_10712431 | 3300025949 | Bacteria | 1005 |
| 352 | Ga0207667_10963294 | 3300025949 | Bacteria | 842 |
| 353 | Ga0207651_10043438 | 3300025960 | Bacteria | 3000 |
| 354 | Ga0207651_10117804 | 3300025960 | Bacteria | 2007 |
| 355 | Ga0207651_10363526 | 3300025960 | Bacteria | 1222 |
| 356 | Ga0207712_10010922 | 3300025961 | Bacteria | 5779 |
| 357 | Ga0207658_10357577 | 3300025986 | Bacteria | 1273 |
| 358 | Ga0207703_10006989 | 3300026035 | Bacteria | 8981 |
| 359 | Ga0207703_10055253 | 3300026035 | Bacteria | 3230 |
| 360 | Ga0207639_10035064 | 3300026041 | Bacteria | 3712 |
| 361 | Ga0207702_10002090 | 3300026078 | Bacteria | 19275 |
| 362 | Ga0207702_10028242 | 3300026078 | Bacteria | 4662 |
| 363 | Ga0207702_10034359 | 3300026078 | Bacteria | 4238 |
| 364 | Ga0207702_10413295 | 3300026078 | Bacteria | 1303 |
| 365 | Ga0207641_10454559 | 3300026088 | Bacteria | 1238 |
| 366 | Ga0207641_10909892 | 3300026088 | Bacteria | 874 |
| 367 | Ga0207648_10141179 | 3300026089 | Bacteria | 2123 |
| 368 | Ga0207648_10169932 | 3300026089 | Bacteria | 1927 |
| 369 | Ga0207676_10259825 | 3300026095 | Bacteria | 1567 |
| 370 | Ga0207674_10000264 | 3300026116 | Bacteria | 65695 |
| 371 | Ga0207674_10001670 | 3300026116 | Bacteria | 28551 |
| 372 | Ga0207698_10129290 | 3300026142 | Bacteria | 2155 |
| 373 | Ga0268266_10023283 | 3300028379 | Bacteria | 5274 |
| 374 | Ga0268266_10226307 | 3300028379 | Bacteria | 1721 |
| 375 | Ga0268266_10419840 | 3300028379 | Bacteria | 1267 |
| 376 | Ga0268264_10014792 | 3300028381 | Bacteria | 6409 |
| 377 | Ga0268264_10522362 | 3300028381 | Bacteria | 1161 |
| 378 | Ga0265323_10000261 | 3300028653 | Bacteria | 30888 |
| 379 | Ga0265338_10096059 | 3300028800 | Bacteria | 2433 |
| 380 | Ga0265338_10217341 | 3300028800 | Bacteria | 1430 |
| 381 | Ga0265325_10004637 | 3300031241 | Bacteria | 8628 |
| 382 | Ga0265325_10052299 | 3300031241 | Bacteria | 2098 |
| 383 | Ga0265316_10006280 | 3300031344 | Bacteria | 11383 |
| 384 | Ga0265313_10003281 | 3300031595 | Bacteria | 13290 |
| 385 | Ga0265314_10001266 | 3300031711 | Bacteria | 28791 |
| 386 | Ga0265314_10005327 | 3300031711 | Bacteria | 11638 |
| 387 | Ga0265314_10015999 | 3300031711 | Bacteria | 5938 |
| 388 | Ga0265342_10078980 | 3300031712 | Bacteria | 1904 |
| 389 | Ga0373953_0085580 | 3300035117 | Bacteria | 1315 |
| 390 | Ga0373954_0006574 | 3300035118 | Bacteria | 5070 |
| 391 | Ga0373954_0036060 | 3300035118 | Bacteria | 2294 |
| 392 | Ga0373954_0045734 | 3300035118 | Bacteria | 2045 |
| 393 | Ga0373954_0202731 | 3300035118 | Bacteria | 975 |
| 394 | Ga0373956_0048036 | 3300035119 | Bacteria | 1911 |
| 395 | Ga0373956_0099721 | 3300035119 | Bacteria | 1346 |
| 396 | Ga0373957_0024235 | 3300035120 | Bacteria | 2178 |
| 397 | Ga0373955_0009957 | 3300035172 | Bacteria | 4473 |
| 398 | Ga0373955_0067763 | 3300035172 | Bacteria | 1987 |
| 399 | Ga0373955_0110042 | 3300035172 | Bacteria | 1592 |
| 400 | Ga0373924_0167911 | 3300035410 | Bacteria | 964 |
| 401 | Ga0373935_0047100 | 3300035692 | Unclassified | 2725 |
| 402 | Ga0373935_0131017 | 3300035692 | Bacteria | 1685 |
| 403 | Ga0373935_0131484 | 3300035692 | Bacteria | 1682 |
| 404 | Ga0373935_0184925 | 3300035692 | Bacteria | 1432 |
| 405 | Ga0373927_0003403 | 3300035695 | Bacteria | 11443 |
| 406 | Ga0373927_0026658 | 3300035695 | Bacteria | 3777 |
| 407 | Ga0373927_0227621 | 3300035695 | Bacteria | 1225 |
| 408 | Ga0373933_0021198 | 3300035724 | Bacteria | 3689 |
| 409 | Ga0373933_0050067 | 3300035724 | Bacteria | 2492 |
| 410 | Ga0373947_0001364 | 3300035725 | Bacteria | 15014 |
| 411 | Ga0373947_0155910 | 3300035725 | Bacteria | 1474 |
| 412 | Ga0373947_0263598 | 3300035725 | Unclassified | 1142 |
| 413 | Ga0373947_0338650 | 3300035725 | Bacteria | 1008 |
| 414 | Ga0373937_0001893 | 3300036401 | Bacteria | 17557 |
| 415 | Ga0373937_0020624 | 3300036401 | Bacteria | 5908 |
| 416 | Ga0373937_0046600 | 3300036401 | Bacteria | 3965 |
| 417 | Ga0373937_0084416 | 3300036401 | Bacteria | 2938 |
| 418 | Ga0373937_0393444 | 3300036401 | Unclassified | 1315 |
| 419 | Ga0316584_0254296 | 3300036712 | Bacteria | 1283 |
| 420 | Ga0373925_0001414 | 3300037068 | Bacteria | 20838 |
| 421 | Ga0373925_0053958 | 3300037068 | Bacteria | 3006 |
| 422 | Ga0373925_0080751 | 3300037068 | Bacteria | 2472 |
| 423 | Ga0373925_0553994 | 3300037068 | Bacteria | 946 |
| 424 | Ga0395900_0113016 | 3300037418 | Bacteria | 2788 |
| 425 | Ga0395898_0056747 | 3300037466 | Bacteria | 3817 |
| 426 | Ga0436364_0051577 | 3300037853 | Bacteria | 4362 |
| 427 | Ga0436364_0059099 | 3300037853 | Bacteria | 8032 |
| 428 | Ga0436364_0157811 | 3300037853 | Bacteria | 430293 |
| 429 | Ga0436364_0203770 | 3300037853 | Bacteria | 5968 |
| 430 | Ga0436364_0362008 | 3300037853 | Bacteria | 3917 |
| 431 | Ga0436364_0475118 | 3300037853 | Bacteria | 1996 |
| 432 | Ga0436364_0602759 | 3300037853 | Bacteria | 6558 |
| 433 | Ga0436364_0657729 | 3300037853 | Bacteria | 1521 |
| 434 | Ga0436364_0851706 | 3300037853 | Bacteria | 1108 |
| 435 | Ga0436364_0909379 | 3300037853 | Bacteria | 1095 |
| 436 | Ga0436364_0934794 | 3300037853 | Bacteria | 1571 |
| 437 | Ga0436364_1409641 | 3300037853 | Bacteria | 4411 |
| 438 | Ga0436364_1556058 | 3300037853 | Bacteria | 18341 |
| 439 | Ga0436365_0096934 | 3300039437 | Bacteria | 2609 |
| 440 | Ga0436365_0157338 | 3300039437 | Bacteria | 1275 |
| 441 | Ga0436365_0288035 | 3300039437 | Bacteria | 1169 |
| 442 | Ga0436365_0491703 | 3300039437 | Bacteria | 2831 |
| 443 | Ga0436365_0617682 | 3300039437 | Bacteria | 10340 |
| 444 | Ga0436365_0761153 | 3300039437 | Bacteria | 3697 |
| 445 | Ga0436365_0860671 | 3300039437 | Bacteria | 10150 |
| 446 | Ga0436365_1105269 | 3300039437 | Bacteria | 7072 |
| 447 | Ga0436365_1821431 | 3300039437 | Bacteria | 1579 |
| 448 | Ga0436360_0318029 | 3300039438 | Bacteria | 5276 |
| 449 | Ga0436360_0701333 | 3300039438 | Bacteria | 3452 |
| 450 | Ga0436361_0233351 | 3300039447 | Bacteria | 63019 |
| 451 | Ga0436363_0618120 | 3300039450 | Bacteria | 12910 |
| 452 | Ga0436363_0647949 | 3300039450 | Bacteria | 2751 |
| 453 | Ga0436363_1203601 | 3300039450 | Bacteria | 5897 |
| 454 | Ga0436362_0592346 | 3300039453 | Bacteria | 1106 |
| 455 | Ga0436362_0620224 | 3300039453 | Bacteria | 3388 |
| 456 | Ga0436362_0851569 | 3300039453 | Bacteria | 2160 |
| 457 | Ga0453683_0000676 | 3300044673 | Bacteria | 36239 |
| 458 | Ga0466963_0234277 | 3300044694 | Bacteria | 1287 |
| 459 | Ga0453684_0175287 | 3300044712 | Bacteria | 2523 |
| 460 | Ga0451576_0172357 | 3300045051 | Bacteria | 2259 |
| 461 | Ga0451576_0235447 | 3300045051 | Bacteria | 1912 |
| 462 | Ga0451576_0331392 | 3300045051 | Bacteria | 1593 |
| 463 | Ga0451576_0383525 | 3300045051 | Bacteria | 1473 |
| 464 | Ga0466958_0138432 | 3300045836 | Bacteria | 1532 |
| 465 | Ga0466958_0385170 | 3300045836 | Bacteria | 904 |
| 466 | Ga0495592_0163620 | 3300046454 | Bacteria | 1529 |
| 467 | Ga0495651_0402539 | 3300046462 | Bacteria | 893 |
| 468 | Ga0495580_0011195 | 3300046472 | Bacteria | 6946 |
| 469 | Ga0495580_0014222 | 3300046472 | Bacteria | 6042 |
| 470 | Ga0495580_0034199 | 3300046472 | Bacteria | 3659 |
| 471 | Ga0495580_0038940 | 3300046472 | Bacteria | 3402 |
| 472 | Ga0495580_0102050 | 3300046472 | Bacteria | 1995 |
| 473 | Ga0495580_0225716 | 3300046472 | Bacteria | 1286 |
| 474 | Ga0495580_0254849 | 3300046472 | Bacteria | 1201 |
| 475 | Ga0495580_0394050 | 3300046472 | Bacteria | 934 |
| 476 | Ga0495580_0428837 | 3300046472 | Bacteria | 889 |
| 477 | Ga0495580_0509813 | 3300046472 | Unclassified | 802 |
| 478 | Ga0495582_0163420 | 3300046473 | Bacteria | 1267 |
| 479 | Ga0495608_0102751 | 3300046511 | Bacteria | 1842 |
| 480 | Ga0495630_0137815 | 3300046517 | Bacteria | 1855 |
| 481 | Ga0495652_0101144 | 3300046529 | Bacteria | 2337 |
| 482 | Ga0495665_0042286 | 3300046531 | Bacteria | 2426 |
| 483 | Ga0495586_0052466 | 3300046535 | Bacteria | 2208 |
| 484 | Ga0495587_0000640 | 3300046536 | Bacteria | 23483 |
| 485 | Ga0495587_0027794 | 3300046536 | Bacteria | 3444 |
| 486 | Ga0495645_0049288 | 3300046543 | Bacteria | 3067 |
| 487 | Ga0495667_0214137 | 3300046559 | Bacteria | 1231 |
| 488 | Ga0495667_0454334 | 3300046559 | Bacteria | 805 |
| 489 | Ga0495635_0103696 | 3300046663 | Bacteria | 1944 |
| 490 | Ga0495657_0137483 | 3300046675 | Bacteria | 1526 |
| 491 | Ga0495623_0067839 | 3300046679 | Bacteria | 2226 |
| 492 | Ga0495623_0175255 | 3300046679 | Bacteria | 1250 |
| 493 | Ga0495658_0357782 | 3300046683 | Bacteria | 928 |
| 494 | Ga0495600_0157501 | 3300046809 | Bacteria | 1469 |
| 495 | Ga0495636_0016181 | 3300047318 | Bacteria | 2977 |
| 496 | Ga0495674_0080987 | 3300047319 | Bacteria | 2786 |
| 497 | Ga0495674_0113073 | 3300047319 | Bacteria | 2300 |
| 498 | Ga0495674_0206844 | 3300047319 | Bacteria | 1627 |
| 499 | Ga0495674_0412953 | 3300047319 | Bacteria | 1088 |
| 500 | Ga0495676_0364015 | 3300047321 | Bacteria | 965 |
| 501 | Ga0495680_0059445 | 3300047322 | Bacteria | 2951 |
| 502 | Ga0495675_0200158 | 3300047444 | Bacteria | 1216 |
| 503 | Ga0495684_0008927 | 3300047471 | Bacteria | 7744 |
| 504 | Ga0495684_0030460 | 3300047471 | Bacteria | 4143 |
| 505 | Ga0495684_0031272 | 3300047471 | Bacteria | 4087 |
| 506 | Ga0495684_0032701 | 3300047471 | Bacteria | 3995 |
| 507 | Ga0495684_0049869 | 3300047471 | Bacteria | 3198 |
| 508 | Ga0495602_0007373 | 3300048088 | Bacteria | 11517 |
| 509 | Ga0495602_0143065 | 3300048088 | Bacteria | 1891 |
| 510 | Ga0495602_0337095 | 3300048088 | Bacteria | 1092 |
| 511 | Ga0496102_0675129 | 3300048905 | Bacteria | 956 |
| 512 | Ga0496104_0290375 | 3300048907 | Unclassified | 1548 |
| 513 | Ga0496108_0682848 | 3300048911 | Bacteria | 891 |
| 514 | Ga0496115_0093629 | 3300048918 | Bacteria | 2457 |
| 515 | Ga0501031_0002163 | 3300049568 | Bacteria | 12402 |
| 516 | Ga0501033_0027878 | 3300049570 | Bacteria | 4244 |
| 517 | Ga0501034_0008169 | 3300049571 | Bacteria | 11098 |
| 518 | Ga0501034_0037104 | 3300049571 | Bacteria | 4934 |
| 519 | Ga0501036_0000255 | 3300049572 | Bacteria | 36165 |
| 520 | Ga0501037_0029347 | 3300049573 | Bacteria | 4063 |
| 521 | Ga0501038_0001681 | 3300049574 | Bacteria | 20492 |
| 522 | Ga0501039_0032376 | 3300049575 | Bacteria | 4030 |
| 523 | Ga0501040_0471575 | 3300049576 | Bacteria | 904 |
| 524 | Ga0501042_0119259 | 3300049578 | Bacteria | 1899 |
| 525 | Ga0501043_0238048 | 3300049579 | Bacteria | 1404 |
| 526 | Ga0501046_0012015 | 3300049580 | Bacteria | 7386 |
| 527 | Ga0501046_0129826 | 3300049580 | Bacteria | 1912 |
| 528 | Ga0501047_0005379 | 3300049581 | Bacteria | 12036 |
| 529 | Ga0501047_0104999 | 3300049581 | Bacteria | 2705 |
| 530 | Ga0501047_0393686 | 3300049581 | Bacteria | 1219 |
| 531 | Ga0501048_0010139 | 3300049582 | Bacteria | 7047 |
| 532 | Ga0501048_0552841 | 3300049582 | Bacteria | 826 |
| 533 | Ga0501068_0004494 | 3300049584 | Bacteria | 7592 |
| 534 | Ga0501069_0003875 | 3300049585 | Bacteria | 7708 |
| 535 | Ga0501070_0029721 | 3300049586 | Bacteria | 4579 |
| 536 | Ga0501070_0090854 | 3300049586 | Bacteria | 2527 |
| 537 | Ga0501072_0000250 | 3300049588 | Bacteria | 39677 |
| 538 | Ga0501073_0009030 | 3300049589 | Bacteria | 7358 |
| 539 | Ga0501073_0109147 | 3300049589 | Bacteria | 1920 |
| 540 | Ga0501074_0004552 | 3300049590 | Bacteria | 9924 |
| 541 | Ga0501075_0221346 | 3300049591 | Bacteria | 1444 |
| 542 | Ga0501076_0507005 | 3300049592 | Bacteria | 994 |
| 543 | Ga0501077_0005572 | 3300049593 | Bacteria | 7667 |
| 544 | Ga0501217_103991 | 3300049661 | Bacteria | 810 |
| 545 | Ga0501257_041642 | 3300049686 | Bacteria | 1129 |
| 546 | Ga0501079_0010908 | 3300049741 | Bacteria | 6921 |
| 547 | Ga0501080_0001964 | 3300049742 | Bacteria | 17742 |
| 548 | Ga0501080_0172422 | 3300049742 | Bacteria | 1995 |
| 549 | Ga0501083_0011177 | 3300049744 | Bacteria | 6297 |
| 550 | Ga0501083_0013381 | 3300049744 | Bacteria | 5735 |
| 551 | Ga0501035_0010163 | 3300049822 | Bacteria | 8734 |
| 552 | Ga0501035_0056092 | 3300049822 | Bacteria | 3517 |
| 553 | Ga0501035_0335447 | 3300049822 | Bacteria | 1268 |
| 554 | Ga0501044_0002393 | 3300049823 | Bacteria | 21384 |
| 555 | Ga0501044_0021570 | 3300049823 | Bacteria | 6868 |
| 556 | Ga0501044_0044948 | 3300049823 | Bacteria | 4579 |
| 557 | nmdc:mga09592_346529_c1 | 3300050508 | Bacteria | 1286 |
| 558 | nmdc:mga0qj67_97961_c1 | 3300050509 | Bacteria | 2362 |
| 559 | nmdc:mga08y16_251203_c1 | 3300050511 | Bacteria | 1827 |
| 560 | nmdc:mga08y16_390678_c1 | 3300050511 | Bacteria | 1425 |
| 561 | nmdc:mga08x19_1108_c1 | 3300050514 | Bacteria | 16801 |
| 562 | nmdc:mga08x19_157824_c1 | 3300050514 | Bacteria | 1539 |
| 563 | Ga0495601_0052290 | 3300053077 | Bacteria | 2579 |
| 564 | Ga0500568_0006476 | 3300053139 | Bacteria | 5871 |
| 565 | Ga0501084_0000893 | 3300054114 | Bacteria | 23072 |
| 566 | Ga0501082_0000283 | 3300060353 | Bacteria | 44708 |
| 567 | Ga0501082_0062309 | 3300060353 | Bacteria | 3210 |
| 568 | Ga0501082_0216336 | 3300060353 | Bacteria | 1667 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10106423 | Ga0105245_101064232 | 194 |
| 2 | 3300035725 | Ga0373947_0338650 | Ga0373947_0338650_68_760 | 203 |
| 3 | 3300009093 | Ga0105240_10016627 | Ga0105240_100166273 | 209 |
| 4 | 3300013104 | Ga0157370_10020902 | Ga0157370_100209025 | 209 |
| 5 | 3300025913 | Ga0207695_10106495 | Ga0207695_101064952 | 209 |
| 6 | 3300025949 | Ga0207667_10127407 | Ga0207667_101274072 | 209 |
| 7 | 3300005548 | Ga0070665_100395535 | Ga0070665_1003955352 | 210 |
| 8 | 3300009176 | Ga0105242_10344456 | Ga0105242_103444561 | 210 |
| 9 | 3300013296 | Ga0157374_10407343 | Ga0157374_104073432 | 210 |
| 10 | 3300013306 | Ga0163162_10905617 | Ga0163162_109056171 | 210 |
| 11 | 3300025934 | Ga0207686_10214714 | Ga0207686_102147141 | 210 |
| 12 | 3300028379 | Ga0268266_10419840 | Ga0268266_104198402 | 210 |
| 13 | 3300006028 | Ga0070717_10037014 | Ga0070717_100370144 | 226 |
| 14 | 3300021388 | Ga0213875_10001437 | Ga0213875_100014379 | 226 |
| 15 | 3300035118 | Ga0373954_0006574 | Ga0373954_0006574_1342_2115 | 226 |
| 16 | 3300035119 | Ga0373956_0099721 | Ga0373956_0099721_561_1334 | 226 |
| 17 | 3300035692 | Ga0373935_0184925 | Ga0373935_0184925_501_1274 | 226 |
| 18 | 3300035695 | Ga0373927_0026658 | Ga0373927_0026658_2194_2967 | 226 |
| 19 | 3300036401 | Ga0373937_0084416 | Ga0373937_0084416_881_1654 | 226 |
| 20 | 3300037068 | Ga0373925_0080751 | Ga0373925_0080751_272_1045 | 226 |
| 21 | 3300046472 | Ga0495580_0034199 | Ga0495580_0034199_2023_2796 | 226 |
| 22 | 3300047319 | Ga0495674_0113073 | Ga0495674_0113073_740_1513 | 226 |
| 23 | 3300047471 | Ga0495684_0008927 | Ga0495684_0008927_109_882 | 226 |
| 24 | 3300005563 | Ga0068855_100016105 | Ga0068855_1000161052 | 227 |
| 25 | 3300005614 | Ga0068856_100058410 | Ga0068856_1000584105 | 227 |
| 26 | 3300009551 | Ga0105238_10034169 | Ga0105238_100341692 | 227 |
| 27 | 3300013105 | Ga0157369_10202587 | Ga0157369_102025872 | 227 |
| 28 | 3300025920 | Ga0207649_10231426 | Ga0207649_102314262 | 227 |
| 29 | 3300026078 | Ga0207702_10413295 | Ga0207702_104132952 | 227 |
| 30 | 3300026142 | Ga0207698_10129290 | Ga0207698_101292902 | 227 |
| 31 | 3300028381 | Ga0268264_10522362 | Ga0268264_105223622 | 227 |
| 32 | 3300031711 | Ga0265314_10005327 | Ga0265314_100053272 | 227 |
| 33 | 3300039453 | Ga0436362_0851569 | Ga0436362_0851569_716_1474 | 227 |
| 34 | 3300009148 | Ga0105243_10477788 | Ga0105243_104777882 | 228 |
| 35 | 3300039447 | Ga0436361_0233351 | Ga0436361_0233351_58445_59185 | 234 |
| 36 | 3300005329 | Ga0070683_100014842 | Ga0070683_1000148422 | 235 |
| 37 | 3300005535 | Ga0070684_100074730 | Ga0070684_1000747303 | 235 |
| 38 | 3300006358 | Ga0068871_100029962 | Ga0068871_1000299623 | 235 |
| 39 | 3300009098 | Ga0105245_10135244 | Ga0105245_101352444 | 235 |
| 40 | 3300014325 | Ga0163163_10011072 | Ga0163163_100110722 | 235 |
| 41 | 3300025944 | Ga0207661_10045157 | Ga0207661_100451572 | 235 |
| 42 | 3300005336 | Ga0070680_100314890 | Ga0070680_1003148901 | 236 |
| 43 | 3300005458 | Ga0070681_10007191 | Ga0070681_100071916 | 236 |
| 44 | 3300005530 | Ga0070679_100569882 | Ga0070679_1005698821 | 236 |
| 45 | 3300021384 | Ga0213876_10018059 | Ga0213876_100180593 | 236 |
| 46 | 3300025912 | Ga0207707_10013512 | Ga0207707_100135126 | 236 |
| 47 | 3300025921 | Ga0207652_10473225 | Ga0207652_104732251 | 236 |
| 48 | 3300035692 | Ga0373935_0131484 | Ga0373935_0131484_355_1095 | 236 |
| 49 | 3300037853 | Ga0436364_0851706 | Ga0436364_0851706_43_765 | 236 |
| 50 | 3300039437 | Ga0436365_1105269 | Ga0436365_1105269_598_1320 | 236 |
| 51 | 3300039450 | Ga0436363_0618120 | Ga0436363_0618120_2225_2947 | 236 |
| 52 | 3300021388 | Ga0213875_10000005 | Ga0213875_10000005257 | 239 |
| 53 | 3300037853 | Ga0436364_0157811 | Ga0436364_0157811_292850_293593 | 239 |
| 54 | 3300005347 | Ga0070668_100178369 | Ga0070668_1001783692 | 240 |
| 55 | 3300005436 | Ga0070713_100174044 | Ga0070713_1001740441 | 240 |
| 56 | 3300005440 | Ga0070705_100099200 | Ga0070705_1000992002 | 240 |
| 57 | 3300005563 | Ga0068855_100724929 | Ga0068855_1007249292 | 240 |
| 58 | 3300005617 | Ga0068859_100370362 | Ga0068859_1003703622 | 240 |
| 59 | 3300005842 | Ga0068858_100054904 | Ga0068858_1000549044 | 240 |
| 60 | 3300006931 | Ga0097620_100370327 | Ga0097620_1003703272 | 240 |
| 61 | 3300013306 | Ga0163162_10148226 | Ga0163162_101482264 | 240 |
| 62 | 3300014326 | Ga0157380_10628249 | Ga0157380_106282492 | 240 |
| 63 | 3300025906 | Ga0207699_10114365 | Ga0207699_101143652 | 240 |
| 64 | 3300025910 | Ga0207684_10447695 | Ga0207684_104476952 | 240 |
| 65 | 3300025921 | Ga0207652_10478558 | Ga0207652_104785582 | 240 |
| 66 | 3300026035 | Ga0207703_10055253 | Ga0207703_100552533 | 240 |
| 67 | 3300031344 | Ga0265316_10006280 | Ga0265316_100062805 | 240 |
| 68 | 3300031711 | Ga0265314_10015999 | Ga0265314_100159994 | 240 |
| 69 | 3300031712 | Ga0265342_10078980 | Ga0265342_100789802 | 240 |
| 70 | 3300044673 | Ga0453683_0000676 | Ga0453683_0000676_30192_30929 | 240 |
| 71 | 3300045051 | Ga0451576_0172357 | Ga0451576_0172357_956_1699 | 240 |
| 72 | 3300045051 | Ga0451576_0235447 | Ga0451576_0235447_1127_1882 | 240 |
| 73 | 3300046472 | Ga0495580_0038940 | Ga0495580_0038940_351_1088 | 240 |
| 74 | 3300047319 | Ga0495674_0412953 | Ga0495674_0412953_231_953 | 240 |
| 75 | 3300047444 | Ga0495675_0200158 | Ga0495675_0200158_166_888 | 240 |
| 76 | 3300049744 | Ga0501083_0013381 | Ga0501083_0013381_2398_3123 | 240 |
| 77 | 3300005439 | Ga0070711_100125161 | Ga0070711_1001251612 | 241 |
| 78 | 3300005458 | Ga0070681_10145649 | Ga0070681_101456492 | 241 |
| 79 | 3300005530 | Ga0070679_100116873 | Ga0070679_1001168732 | 241 |
| 80 | 3300005545 | Ga0070695_100257203 | Ga0070695_1002572032 | 241 |
| 81 | 3300005719 | Ga0068861_100874459 | Ga0068861_1008744591 | 241 |
| 82 | 3300006914 | Ga0075436_100021873 | Ga0075436_1000218732 | 241 |
| 83 | 3300009174 | Ga0105241_10264084 | Ga0105241_102640842 | 241 |
| 84 | 3300009545 | Ga0105237_10034802 | Ga0105237_100348022 | 241 |
| 85 | 3300025912 | Ga0207707_10143814 | Ga0207707_101438142 | 241 |
| 86 | 3300025914 | Ga0207671_10024035 | Ga0207671_100240355 | 241 |
| 87 | 3300025916 | Ga0207663_10100162 | Ga0207663_101001622 | 241 |
| 88 | 3300025921 | Ga0207652_10455037 | Ga0207652_104550372 | 241 |
| 89 | 3300031241 | Ga0265325_10004637 | Ga0265325_100046376 | 241 |
| 90 | 3300035172 | Ga0373955_0009957 | Ga0373955_0009957_3671_4417 | 241 |
| 91 | 3300035695 | Ga0373927_0003403 | Ga0373927_0003403_1680_2429 | 241 |
| 92 | 3300035695 | Ga0373927_0227621 | Ga0373927_0227621_158_916 | 241 |
| 93 | 3300046472 | Ga0495580_0225716 | Ga0495580_0225716_282_1028 | 241 |
| 94 | 3300046531 | Ga0495665_0042286 | Ga0495665_0042286_1325_2071 | 241 |
| 95 | 3300050514 | nmdc:mga08x19_1108_c1 | nmdc:mga08x19_1108_c1_1833_2582 | 241 |
| 96 | 3300050514 | nmdc:mga08x19_157824_c1 | nmdc:mga08x19_157824_c1_245_991 | 241 |
| 97 | 3300053139 | Ga0500568_0006476 | Ga0500568_0006476_34_759 | 241 |
| 98 | 3300005329 | Ga0070683_100000008 | Ga0070683_10000000870 | 242 |
| 99 | 3300005329 | Ga0070683_100001900 | Ga0070683_10000190016 | 242 |
| 100 | 3300005329 | Ga0070683_100037407 | Ga0070683_1000374074 | 242 |
| 101 | 3300005329 | Ga0070683_100079582 | Ga0070683_1000795824 | 242 |
| 102 | 3300005329 | Ga0070683_100225677 | Ga0070683_1002256771 | 242 |
| 103 | 3300005329 | Ga0070683_100482516 | Ga0070683_1004825162 | 242 |
| 104 | 3300005334 | Ga0068869_100052850 | Ga0068869_1000528502 | 242 |
| 105 | 3300005334 | Ga0068869_100226762 | Ga0068869_1002267621 | 242 |
| 106 | 3300005335 | Ga0070666_10055652 | Ga0070666_100556524 | 242 |
| 107 | 3300005335 | Ga0070666_10331947 | Ga0070666_103319471 | 242 |
| 108 | 3300005336 | Ga0070680_100000677 | Ga0070680_10000067711 | 242 |
| 109 | 3300005336 | Ga0070680_100260766 | Ga0070680_1002607662 | 242 |
| 110 | 3300005339 | Ga0070660_100009046 | Ga0070660_1000090463 | 242 |
| 111 | 3300005339 | Ga0070660_100026524 | Ga0070660_1000265242 | 242 |
| 112 | 3300005339 | Ga0070660_100061874 | Ga0070660_1000618743 | 242 |
| 113 | 3300005339 | Ga0070660_100140177 | Ga0070660_1001401772 | 242 |
| 114 | 3300005341 | Ga0070691_10015204 | Ga0070691_100152042 | 242 |
| 115 | 3300005343 | Ga0070687_100478053 | Ga0070687_1004780531 | 242 |
| 116 | 3300005344 | Ga0070661_100038345 | Ga0070661_1000383452 | 242 |
| 117 | 3300005353 | Ga0070669_100380405 | Ga0070669_1003804052 | 242 |
| 118 | 3300005356 | Ga0070674_100036703 | Ga0070674_1000367032 | 242 |
| 119 | 3300005364 | Ga0070673_100011878 | Ga0070673_1000118782 | 242 |
| 120 | 3300005364 | Ga0070673_100145132 | Ga0070673_1001451322 | 242 |
| 121 | 3300005364 | Ga0070673_100447870 | Ga0070673_1004478701 | 242 |
| 122 | 3300005366 | Ga0070659_100065655 | Ga0070659_1000656554 | 242 |
| 123 | 3300005367 | Ga0070667_100436781 | Ga0070667_1004367812 | 242 |
| 124 | 3300005434 | Ga0070709_10106055 | Ga0070709_101060552 | 242 |
| 125 | 3300005435 | Ga0070714_100002199 | Ga0070714_1000021998 | 242 |
| 126 | 3300005435 | Ga0070714_100066908 | Ga0070714_1000669082 | 242 |
| 127 | 3300005435 | Ga0070714_100119549 | Ga0070714_1001195492 | 242 |
| 128 | 3300005435 | Ga0070714_100517729 | Ga0070714_1005177291 | 242 |
| 129 | 3300005435 | Ga0070714_100569380 | Ga0070714_1005693802 | 242 |
| 130 | 3300005436 | Ga0070713_100003787 | Ga0070713_1000037876 | 242 |
| 131 | 3300005436 | Ga0070713_100007840 | Ga0070713_1000078408 | 242 |
| 132 | 3300005436 | Ga0070713_100148944 | Ga0070713_1001489442 | 242 |
| 133 | 3300005436 | Ga0070713_100316474 | Ga0070713_1003164742 | 242 |
| 134 | 3300005438 | Ga0070701_10103267 | Ga0070701_101032672 | 242 |
| 135 | 3300005439 | Ga0070711_100007987 | Ga0070711_1000079874 | 242 |
| 136 | 3300005439 | Ga0070711_100010318 | Ga0070711_1000103185 | 242 |
| 137 | 3300005439 | Ga0070711_100048495 | Ga0070711_1000484952 | 242 |
| 138 | 3300005458 | Ga0070681_10017934 | Ga0070681_100179343 | 242 |
| 139 | 3300005458 | Ga0070681_10081737 | Ga0070681_100817372 | 242 |
| 140 | 3300005458 | Ga0070681_10228452 | Ga0070681_102284521 | 242 |
| 141 | 3300005459 | Ga0068867_100269336 | Ga0068867_1002693361 | 242 |
| 142 | 3300005530 | Ga0070679_100028687 | Ga0070679_1000286874 | 242 |
| 143 | 3300005530 | Ga0070679_100162172 | Ga0070679_1001621722 | 242 |
| 144 | 3300005530 | Ga0070679_100781188 | Ga0070679_1007811882 | 242 |
| 145 | 3300005535 | Ga0070684_100000002 | Ga0070684_10000000260 | 242 |
| 146 | 3300005535 | Ga0070684_100003837 | Ga0070684_1000038379 | 242 |
| 147 | 3300005535 | Ga0070684_100022567 | Ga0070684_1000225673 | 242 |
| 148 | 3300005535 | Ga0070684_100571768 | Ga0070684_1005717682 | 242 |
| 149 | 3300005544 | Ga0070686_100177528 | Ga0070686_1001775282 | 242 |
| 150 | 3300005545 | Ga0070695_100177298 | Ga0070695_1001772982 | 242 |
| 151 | 3300005548 | Ga0070665_100085135 | Ga0070665_1000851352 | 242 |
| 152 | 3300005548 | Ga0070665_100261525 | Ga0070665_1002615251 | 242 |
| 153 | 3300005548 | Ga0070665_100291856 | Ga0070665_1002918562 | 242 |
| 154 | 3300005548 | Ga0070665_100510306 | Ga0070665_1005103062 | 242 |
| 155 | 3300005563 | Ga0068855_100009996 | Ga0068855_1000099963 | 242 |
| 156 | 3300005563 | Ga0068855_100015477 | Ga0068855_1000154773 | 242 |
| 157 | 3300005563 | Ga0068855_100017428 | Ga0068855_1000174288 | 242 |
| 158 | 3300005563 | Ga0068855_100060397 | Ga0068855_1000603973 | 242 |
| 159 | 3300005563 | Ga0068855_100063730 | Ga0068855_1000637302 | 242 |
| 160 | 3300005563 | Ga0068855_100103223 | Ga0068855_1001032232 | 242 |
| 161 | 3300005563 | Ga0068855_100162916 | Ga0068855_1001629162 | 242 |
| 162 | 3300005563 | Ga0068855_100174102 | Ga0068855_1001741022 | 242 |
| 163 | 3300005563 | Ga0068855_100296764 | Ga0068855_1002967642 | 242 |
| 164 | 3300005577 | Ga0068857_100003127 | Ga0068857_1000031275 | 242 |
| 165 | 3300005577 | Ga0068857_100110224 | Ga0068857_1001102242 | 242 |
| 166 | 3300005578 | Ga0068854_100138297 | Ga0068854_1001382972 | 242 |
| 167 | 3300005614 | Ga0068856_100005417 | Ga0068856_10000541710 | 242 |
| 168 | 3300005614 | Ga0068856_100006709 | Ga0068856_1000067097 | 242 |
| 169 | 3300005614 | Ga0068856_100016973 | Ga0068856_1000169734 | 242 |
| 170 | 3300005614 | Ga0068856_100053461 | Ga0068856_1000534613 | 242 |
| 171 | 3300005614 | Ga0068856_100118342 | Ga0068856_1001183422 | 242 |
| 172 | 3300005614 | Ga0068856_100422736 | Ga0068856_1004227362 | 242 |
| 173 | 3300005616 | Ga0068852_100008659 | Ga0068852_1000086593 | 242 |
| 174 | 3300005616 | Ga0068852_100060397 | Ga0068852_1000603973 | 242 |
| 175 | 3300005616 | Ga0068852_100282565 | Ga0068852_1002825651 | 242 |
| 176 | 3300005617 | Ga0068859_100055438 | Ga0068859_1000554382 | 242 |
| 177 | 3300005617 | Ga0068859_100199818 | Ga0068859_1001998182 | 242 |
| 178 | 3300005617 | Ga0068859_100997121 | Ga0068859_1009971212 | 242 |
| 179 | 3300005618 | Ga0068864_100223655 | Ga0068864_1002236552 | 242 |
| 180 | 3300005718 | Ga0068866_10006279 | Ga0068866_100062792 | 242 |
| 181 | 3300005841 | Ga0068863_100091762 | Ga0068863_1000917623 | 242 |
| 182 | 3300005841 | Ga0068863_100259366 | Ga0068863_1002593662 | 242 |
| 183 | 3300005841 | Ga0068863_100297219 | Ga0068863_1002972192 | 242 |
| 184 | 3300005842 | Ga0068858_100038124 | Ga0068858_1000381242 | 242 |
| 185 | 3300005842 | Ga0068858_100107109 | Ga0068858_1001071092 | 242 |
| 186 | 3300005842 | Ga0068858_100250634 | Ga0068858_1002506342 | 242 |
| 187 | 3300005843 | Ga0068860_100005181 | Ga0068860_1000051813 | 242 |
| 188 | 3300005843 | Ga0068860_100323128 | Ga0068860_1003231282 | 242 |
| 189 | 3300005937 | Ga0081455_10043488 | Ga0081455_100434882 | 242 |
| 190 | 3300006028 | Ga0070717_10009055 | Ga0070717_100090554 | 242 |
| 191 | 3300006028 | Ga0070717_10016370 | Ga0070717_100163704 | 242 |
| 192 | 3300006028 | Ga0070717_10270977 | Ga0070717_102709772 | 242 |
| 193 | 3300006175 | Ga0070712_100435498 | Ga0070712_1004354982 | 242 |
| 194 | 3300006237 | Ga0097621_100076451 | Ga0097621_1000764514 | 242 |
| 195 | 3300006237 | Ga0097621_100153476 | Ga0097621_1001534762 | 242 |
| 196 | 3300006358 | Ga0068871_100053583 | Ga0068871_1000535832 | 242 |
| 197 | 3300006358 | Ga0068871_100197464 | Ga0068871_1001974642 | 242 |
| 198 | 3300006358 | Ga0068871_100542794 | Ga0068871_1005427942 | 242 |
| 199 | 3300006846 | Ga0075430_100069294 | Ga0075430_1000692941 | 242 |
| 200 | 3300006880 | Ga0075429_100372687 | Ga0075429_1003726872 | 242 |
| 201 | 3300006931 | Ga0097620_100055437 | Ga0097620_1000554372 | 242 |
| 202 | 3300006931 | Ga0097620_100199802 | Ga0097620_1001998022 | 242 |
| 203 | 3300006931 | Ga0097620_100996879 | Ga0097620_1009968792 | 242 |
| 204 | 3300009093 | Ga0105240_10000429 | Ga0105240_1000042916 | 242 |
| 205 | 3300009093 | Ga0105240_10005328 | Ga0105240_100053284 | 242 |
| 206 | 3300009093 | Ga0105240_10007071 | Ga0105240_1000707115 | 242 |
| 207 | 3300009093 | Ga0105240_10008797 | Ga0105240_100087973 | 242 |
| 208 | 3300009093 | Ga0105240_10014961 | Ga0105240_100149615 | 242 |
| 209 | 3300009093 | Ga0105240_10034152 | Ga0105240_100341529 | 242 |
| 210 | 3300009093 | Ga0105240_10034531 | Ga0105240_100345313 | 242 |
| 211 | 3300009093 | Ga0105240_10186563 | Ga0105240_101865632 | 242 |
| 212 | 3300009093 | Ga0105240_10318326 | Ga0105240_103183262 | 242 |
| 213 | 3300009093 | Ga0105240_10814909 | Ga0105240_108149091 | 242 |
| 214 | 3300009093 | Ga0105240_10906886 | Ga0105240_109068862 | 242 |
| 215 | 3300009098 | Ga0105245_10000273 | Ga0105245_1000027339 | 242 |
| 216 | 3300009098 | Ga0105245_10000579 | Ga0105245_1000057924 | 242 |
| 217 | 3300009098 | Ga0105245_10017701 | Ga0105245_100177013 | 242 |
| 218 | 3300009098 | Ga0105245_10087169 | Ga0105245_100871692 | 242 |
| 219 | 3300009098 | Ga0105245_10360468 | Ga0105245_103604681 | 242 |
| 220 | 3300009098 | Ga0105245_11009608 | Ga0105245_110096082 | 242 |
| 221 | 3300009148 | Ga0105243_10040207 | Ga0105243_100402073 | 242 |
| 222 | 3300009148 | Ga0105243_10056235 | Ga0105243_100562354 | 242 |
| 223 | 3300009174 | Ga0105241_10000998 | Ga0105241_100009983 | 242 |
| 224 | 3300009174 | Ga0105241_10067848 | Ga0105241_100678483 | 242 |
| 225 | 3300009176 | Ga0105242_10405537 | Ga0105242_104055372 | 242 |
| 226 | 3300009177 | Ga0105248_10031133 | Ga0105248_100311334 | 242 |
| 227 | 3300009177 | Ga0105248_10031794 | Ga0105248_100317944 | 242 |
| 228 | 3300009177 | Ga0105248_10102595 | Ga0105248_101025954 | 242 |
| 229 | 3300009177 | Ga0105248_10145239 | Ga0105248_101452391 | 242 |
| 230 | 3300009177 | Ga0105248_10670202 | Ga0105248_106702021 | 242 |
| 231 | 3300009177 | Ga0105248_11211217 | Ga0105248_112112172 | 242 |
| 232 | 3300009545 | Ga0105237_10001090 | Ga0105237_1000109018 | 242 |
| 233 | 3300009545 | Ga0105237_10002784 | Ga0105237_1000278414 | 242 |
| 234 | 3300009545 | Ga0105237_10015615 | Ga0105237_100156156 | 242 |
| 235 | 3300009545 | Ga0105237_10147837 | Ga0105237_101478372 | 242 |
| 236 | 3300009545 | Ga0105237_10181006 | Ga0105237_101810062 | 242 |
| 237 | 3300009545 | Ga0105237_10218788 | Ga0105237_102187882 | 242 |
| 238 | 3300009545 | Ga0105237_10379661 | Ga0105237_103796612 | 242 |
| 239 | 3300009551 | Ga0105238_10003080 | Ga0105238_100030809 | 242 |
| 240 | 3300009551 | Ga0105238_10011625 | Ga0105238_100116255 | 242 |
| 241 | 3300009551 | Ga0105238_10060312 | Ga0105238_100603122 | 242 |
| 242 | 3300009551 | Ga0105238_10145966 | Ga0105238_101459662 | 242 |
| 243 | 3300009551 | Ga0105238_10238310 | Ga0105238_102383102 | 242 |
| 244 | 3300009551 | Ga0105238_10465429 | Ga0105238_104654292 | 242 |
| 245 | 3300009553 | Ga0105249_10019639 | Ga0105249_100196393 | 242 |
| 246 | 3300009553 | Ga0105249_10055098 | Ga0105249_100550982 | 242 |
| 247 | 3300010375 | Ga0105239_10002592 | Ga0105239_1000259216 | 242 |
| 248 | 3300010375 | Ga0105239_10009694 | Ga0105239_100096941 | 242 |
| 249 | 3300010375 | Ga0105239_10049742 | Ga0105239_100497423 | 242 |
| 250 | 3300010375 | Ga0105239_10197565 | Ga0105239_101975653 | 242 |
| 251 | 3300010375 | Ga0105239_10197879 | Ga0105239_101978792 | 242 |
| 252 | 3300010375 | Ga0105239_10249964 | Ga0105239_102499642 | 242 |
| 253 | 3300011119 | Ga0105246_10011848 | Ga0105246_100118482 | 242 |
| 254 | 3300011119 | Ga0105246_10125648 | Ga0105246_101256482 | 242 |
| 255 | 3300011119 | Ga0105246_10668816 | Ga0105246_106688161 | 242 |
| 256 | 3300013102 | Ga0157371_10013037 | Ga0157371_100130377 | 242 |
| 257 | 3300013102 | Ga0157371_10165120 | Ga0157371_101651202 | 242 |
| 258 | 3300013104 | Ga0157370_10012939 | Ga0157370_100129398 | 242 |
| 259 | 3300013104 | Ga0157370_10019317 | Ga0157370_100193175 | 242 |
| 260 | 3300013104 | Ga0157370_10098514 | Ga0157370_100985143 | 242 |
| 261 | 3300013104 | Ga0157370_10103094 | Ga0157370_101030942 | 242 |
| 262 | 3300013104 | Ga0157370_10237655 | Ga0157370_102376552 | 242 |
| 263 | 3300013104 | Ga0157370_10267985 | Ga0157370_102679852 | 242 |
| 264 | 3300013105 | Ga0157369_10002698 | Ga0157369_1000269816 | 242 |
| 265 | 3300013105 | Ga0157369_10009582 | Ga0157369_100095823 | 242 |
| 266 | 3300013105 | Ga0157369_10023045 | Ga0157369_100230452 | 242 |
| 267 | 3300013105 | Ga0157369_10025896 | Ga0157369_100258962 | 242 |
| 268 | 3300013105 | Ga0157369_10038177 | Ga0157369_100381773 | 242 |
| 269 | 3300013105 | Ga0157369_10155578 | Ga0157369_101555782 | 242 |
| 270 | 3300013105 | Ga0157369_10177348 | Ga0157369_101773482 | 242 |
| 271 | 3300013105 | Ga0157369_10223578 | Ga0157369_102235781 | 242 |
| 272 | 3300013105 | Ga0157369_10412880 | Ga0157369_104128801 | 242 |
| 273 | 3300013105 | Ga0157369_10483695 | Ga0157369_104836951 | 242 |
| 274 | 3300013105 | Ga0157369_10728272 | Ga0157369_107282722 | 242 |
| 275 | 3300013296 | Ga0157374_10016687 | Ga0157374_100166875 | 242 |
| 276 | 3300013296 | Ga0157374_10049371 | Ga0157374_100493713 | 242 |
| 277 | 3300013296 | Ga0157374_10061073 | Ga0157374_100610734 | 242 |
| 278 | 3300013296 | Ga0157374_10218861 | Ga0157374_102188612 | 242 |
| 279 | 3300013296 | Ga0157374_10487470 | Ga0157374_104874702 | 242 |
| 280 | 3300013296 | Ga0157374_10617527 | Ga0157374_106175271 | 242 |
| 281 | 3300013306 | Ga0163162_10124350 | Ga0163162_101243502 | 242 |
| 282 | 3300013307 | Ga0157372_10004812 | Ga0157372_1000481214 | 242 |
| 283 | 3300013307 | Ga0157372_10029757 | Ga0157372_100297574 | 242 |
| 284 | 3300013307 | Ga0157372_10074425 | Ga0157372_100744254 | 242 |
| 285 | 3300013307 | Ga0157372_10086820 | Ga0157372_100868202 | 242 |
| 286 | 3300013307 | Ga0157372_10117799 | Ga0157372_101177992 | 242 |
| 287 | 3300013307 | Ga0157372_10777737 | Ga0157372_107777372 | 242 |
| 288 | 3300013308 | Ga0157375_10026447 | Ga0157375_100264472 | 242 |
| 289 | 3300013308 | Ga0157375_10059048 | Ga0157375_100590483 | 242 |
| 290 | 3300013308 | Ga0157375_10885082 | Ga0157375_108850822 | 242 |
| 291 | 3300014325 | Ga0163163_10022012 | Ga0163163_100220122 | 242 |
| 292 | 3300014325 | Ga0163163_10074254 | Ga0163163_100742542 | 242 |
| 293 | 3300014325 | Ga0163163_10375595 | Ga0163163_103755952 | 242 |
| 294 | 3300014745 | Ga0157377_10322409 | Ga0157377_103224092 | 242 |
| 295 | 3300014968 | Ga0157379_10563167 | Ga0157379_105631672 | 242 |
| 296 | 3300014969 | Ga0157376_10021715 | Ga0157376_100217153 | 242 |
| 297 | 3300014969 | Ga0157376_10075195 | Ga0157376_100751954 | 242 |
| 298 | 3300014969 | Ga0157376_10104900 | Ga0157376_101049003 | 242 |
| 299 | 3300014969 | Ga0157376_10111498 | Ga0157376_101114982 | 242 |
| 300 | 3300014969 | Ga0157376_10130430 | Ga0157376_101304302 | 242 |
| 301 | 3300021377 | Ga0213874_10007461 | Ga0213874_100074612 | 242 |
| 302 | 3300021377 | Ga0213874_10048568 | Ga0213874_100485682 | 242 |
| 303 | 3300021384 | Ga0213876_10002768 | Ga0213876_100027685 | 242 |
| 304 | 3300021384 | Ga0213876_10028854 | Ga0213876_100288541 | 242 |
| 305 | 3300021388 | Ga0213875_10015098 | Ga0213875_100150984 | 242 |
| 306 | 3300021388 | Ga0213875_10120416 | Ga0213875_101204161 | 242 |
| 307 | 3300021388 | Ga0213875_10170015 | Ga0213875_101700152 | 242 |
| 308 | 3300021441 | Ga0213871_10000712 | Ga0213871_100007122 | 242 |
| 309 | 3300022467 | Ga0224712_10002414 | Ga0224712_100024143 | 242 |
| 310 | 3300025899 | Ga0207642_10128705 | Ga0207642_101287052 | 242 |
| 311 | 3300025903 | Ga0207680_10209631 | Ga0207680_102096312 | 242 |
| 312 | 3300025903 | Ga0207680_10401492 | Ga0207680_104014922 | 242 |
| 313 | 3300025909 | Ga0207705_10008718 | Ga0207705_100087186 | 242 |
| 314 | 3300025911 | Ga0207654_10004981 | Ga0207654_100049813 | 242 |
| 315 | 3300025912 | Ga0207707_10007218 | Ga0207707_100072187 | 242 |
| 316 | 3300025912 | Ga0207707_10065395 | Ga0207707_100653952 | 242 |
| 317 | 3300025912 | Ga0207707_10116451 | Ga0207707_101164511 | 242 |
| 318 | 3300025912 | Ga0207707_10262808 | Ga0207707_102628082 | 242 |
| 319 | 3300025912 | Ga0207707_10471341 | Ga0207707_104713412 | 242 |
| 320 | 3300025913 | Ga0207695_10000470 | Ga0207695_1000047025 | 242 |
| 321 | 3300025913 | Ga0207695_10006140 | Ga0207695_100061403 | 242 |
| 322 | 3300025913 | Ga0207695_10010697 | Ga0207695_100106977 | 242 |
| 323 | 3300025913 | Ga0207695_10013497 | Ga0207695_100134974 | 242 |
| 324 | 3300025913 | Ga0207695_10029996 | Ga0207695_100299962 | 242 |
| 325 | 3300025913 | Ga0207695_10101832 | Ga0207695_101018322 | 242 |
| 326 | 3300025913 | Ga0207695_10107150 | Ga0207695_101071503 | 242 |
| 327 | 3300025913 | Ga0207695_10115620 | Ga0207695_101156202 | 242 |
| 328 | 3300025913 | Ga0207695_10419691 | Ga0207695_104196912 | 242 |
| 329 | 3300025913 | Ga0207695_10662935 | Ga0207695_106629351 | 242 |
| 330 | 3300025914 | Ga0207671_10019415 | Ga0207671_100194152 | 242 |
| 331 | 3300025914 | Ga0207671_10037511 | Ga0207671_100375111 | 242 |
| 332 | 3300025914 | Ga0207671_10046774 | Ga0207671_100467742 | 242 |
| 333 | 3300025914 | Ga0207671_10167956 | Ga0207671_101679563 | 242 |
| 334 | 3300025914 | Ga0207671_10431260 | Ga0207671_104312602 | 242 |
| 335 | 3300025916 | Ga0207663_10018362 | Ga0207663_100183623 | 242 |
| 336 | 3300025916 | Ga0207663_10157929 | Ga0207663_101579292 | 242 |
| 337 | 3300025917 | Ga0207660_10004761 | Ga0207660_1000476110 | 242 |
| 338 | 3300025919 | Ga0207657_10075609 | Ga0207657_100756092 | 242 |
| 339 | 3300025919 | Ga0207657_10216636 | Ga0207657_102166362 | 242 |
| 340 | 3300025920 | Ga0207649_10264256 | Ga0207649_102642562 | 242 |
| 341 | 3300025921 | Ga0207652_10021834 | Ga0207652_100218343 | 242 |
| 342 | 3300025921 | Ga0207652_10074284 | Ga0207652_100742842 | 242 |
| 343 | 3300025921 | Ga0207652_10078855 | Ga0207652_100788552 | 242 |
| 344 | 3300025921 | Ga0207652_10816101 | Ga0207652_108161011 | 242 |
| 345 | 3300025924 | Ga0207694_10000818 | Ga0207694_1000081814 | 242 |
| 346 | 3300025924 | Ga0207694_10004826 | Ga0207694_100048269 | 242 |
| 347 | 3300025924 | Ga0207694_10046209 | Ga0207694_100462092 | 242 |
| 348 | 3300025924 | Ga0207694_10254046 | Ga0207694_102540462 | 242 |
| 349 | 3300025926 | Ga0207659_10300554 | Ga0207659_103005542 | 242 |
| 350 | 3300025927 | Ga0207687_10001280 | Ga0207687_100012809 | 242 |
| 351 | 3300025927 | Ga0207687_10002559 | Ga0207687_100025599 | 242 |
| 352 | 3300025928 | Ga0207700_10002212 | Ga0207700_100022125 | 242 |
| 353 | 3300025928 | Ga0207700_10013778 | Ga0207700_100137781 | 242 |
| 354 | 3300025928 | Ga0207700_10048398 | Ga0207700_100483982 | 242 |
| 355 | 3300025928 | Ga0207700_10075163 | Ga0207700_100751631 | 242 |
| 356 | 3300025928 | Ga0207700_10149760 | Ga0207700_101497602 | 242 |
| 357 | 3300025928 | Ga0207700_10157584 | Ga0207700_101575842 | 242 |
| 358 | 3300025929 | Ga0207664_10012730 | Ga0207664_100127306 | 242 |
| 359 | 3300025929 | Ga0207664_10048554 | Ga0207664_100485541 | 242 |
| 360 | 3300025929 | Ga0207664_10061059 | Ga0207664_100610592 | 242 |
| 361 | 3300025929 | Ga0207664_10084911 | Ga0207664_100849112 | 242 |
| 362 | 3300025931 | Ga0207644_10017405 | Ga0207644_100174051 | 242 |
| 363 | 3300025932 | Ga0207690_10083038 | Ga0207690_100830382 | 242 |
| 364 | 3300025932 | Ga0207690_10091253 | Ga0207690_100912531 | 242 |
| 365 | 3300025934 | Ga0207686_10018506 | Ga0207686_100185062 | 242 |
| 366 | 3300025934 | Ga0207686_10459567 | Ga0207686_104595672 | 242 |
| 367 | 3300025935 | Ga0207709_10092935 | Ga0207709_100929352 | 242 |
| 368 | 3300025936 | Ga0207670_10229833 | Ga0207670_102298332 | 242 |
| 369 | 3300025936 | Ga0207670_10355753 | Ga0207670_103557532 | 242 |
| 370 | 3300025937 | Ga0207669_10191094 | Ga0207669_101910942 | 242 |
| 371 | 3300025938 | Ga0207704_10504794 | Ga0207704_105047942 | 242 |
| 372 | 3300025941 | Ga0207711_10010087 | Ga0207711_100100879 | 242 |
| 373 | 3300025941 | Ga0207711_10013977 | Ga0207711_100139772 | 242 |
| 374 | 3300025941 | Ga0207711_10081728 | Ga0207711_100817282 | 242 |
| 375 | 3300025941 | Ga0207711_10194994 | Ga0207711_101949942 | 242 |
| 376 | 3300025941 | Ga0207711_10309856 | Ga0207711_103098561 | 242 |
| 377 | 3300025942 | Ga0207689_10036394 | Ga0207689_100363942 | 242 |
| 378 | 3300025942 | Ga0207689_10160536 | Ga0207689_101605362 | 242 |
| 379 | 3300025944 | Ga0207661_10000008 | Ga0207661_1000000870 | 242 |
| 380 | 3300025944 | Ga0207661_10001072 | Ga0207661_1000107217 | 242 |
| 381 | 3300025944 | Ga0207661_10059944 | Ga0207661_100599444 | 242 |
| 382 | 3300025944 | Ga0207661_10090459 | Ga0207661_100904592 | 242 |
| 383 | 3300025944 | Ga0207661_10146882 | Ga0207661_101468823 | 242 |
| 384 | 3300025944 | Ga0207661_10321415 | Ga0207661_103214152 | 242 |
| 385 | 3300025944 | Ga0207661_10414219 | Ga0207661_104142192 | 242 |
| 386 | 3300025945 | Ga0207679_10392782 | Ga0207679_103927822 | 242 |
| 387 | 3300025949 | Ga0207667_10000145 | Ga0207667_1000014599 | 242 |
| 388 | 3300025949 | Ga0207667_10000290 | Ga0207667_1000029039 | 242 |
| 389 | 3300025949 | Ga0207667_10011688 | Ga0207667_1001168810 | 242 |
| 390 | 3300025949 | Ga0207667_10155824 | Ga0207667_101558242 | 242 |
| 391 | 3300025949 | Ga0207667_10192928 | Ga0207667_101929282 | 242 |
| 392 | 3300025949 | Ga0207667_10304703 | Ga0207667_103047032 | 242 |
| 393 | 3300025949 | Ga0207667_10712431 | Ga0207667_107124312 | 242 |
| 394 | 3300025949 | Ga0207667_10963294 | Ga0207667_109632941 | 242 |
| 395 | 3300025960 | Ga0207651_10043438 | Ga0207651_100434382 | 242 |
| 396 | 3300025960 | Ga0207651_10117804 | Ga0207651_101178042 | 242 |
| 397 | 3300025960 | Ga0207651_10363526 | Ga0207651_103635262 | 242 |
| 398 | 3300025961 | Ga0207712_10010922 | Ga0207712_100109222 | 242 |
| 399 | 3300025986 | Ga0207658_10357577 | Ga0207658_103575772 | 242 |
| 400 | 3300026035 | Ga0207703_10006989 | Ga0207703_100069895 | 242 |
| 401 | 3300026041 | Ga0207639_10035064 | Ga0207639_100350642 | 242 |
| 402 | 3300026078 | Ga0207702_10002090 | Ga0207702_100020903 | 242 |
| 403 | 3300026078 | Ga0207702_10028242 | Ga0207702_100282422 | 242 |
| 404 | 3300026078 | Ga0207702_10034359 | Ga0207702_100343592 | 242 |
| 405 | 3300026088 | Ga0207641_10454559 | Ga0207641_104545592 | 242 |
| 406 | 3300026088 | Ga0207641_10909892 | Ga0207641_109098922 | 242 |
| 407 | 3300026089 | Ga0207648_10141179 | Ga0207648_101411791 | 242 |
| 408 | 3300026089 | Ga0207648_10169932 | Ga0207648_101699322 | 242 |
| 409 | 3300026095 | Ga0207676_10259825 | Ga0207676_102598252 | 242 |
| 410 | 3300026116 | Ga0207674_10000264 | Ga0207674_1000026475 | 242 |
| 411 | 3300026116 | Ga0207674_10001670 | Ga0207674_1000167029 | 242 |
| 412 | 3300028379 | Ga0268266_10023283 | Ga0268266_100232833 | 242 |
| 413 | 3300028379 | Ga0268266_10226307 | Ga0268266_102263072 | 242 |
| 414 | 3300028381 | Ga0268264_10014792 | Ga0268264_100147922 | 242 |
| 415 | 3300028653 | Ga0265323_10000261 | Ga0265323_1000026121 | 242 |
| 416 | 3300028800 | Ga0265338_10096059 | Ga0265338_100960592 | 242 |
| 417 | 3300028800 | Ga0265338_10217341 | Ga0265338_102173412 | 242 |
| 418 | 3300031241 | Ga0265325_10052299 | Ga0265325_100522992 | 242 |
| 419 | 3300031595 | Ga0265313_10003281 | Ga0265313_100032818 | 242 |
| 420 | 3300031711 | Ga0265314_10001266 | Ga0265314_1000126612 | 242 |
| 421 | 3300035117 | Ga0373953_0085580 | Ga0373953_0085580_201_965 | 242 |
| 422 | 3300035118 | Ga0373954_0036060 | Ga0373954_0036060_319_1083 | 242 |
| 423 | 3300035118 | Ga0373954_0045734 | Ga0373954_0045734_15_779 | 242 |
| 424 | 3300035118 | Ga0373954_0202731 | Ga0373954_0202731_200_928 | 242 |
| 425 | 3300035119 | Ga0373956_0048036 | Ga0373956_0048036_1135_1899 | 242 |
| 426 | 3300035120 | Ga0373957_0024235 | Ga0373957_0024235_727_1491 | 242 |
| 427 | 3300035172 | Ga0373955_0067763 | Ga0373955_0067763_898_1662 | 242 |
| 428 | 3300035172 | Ga0373955_0110042 | Ga0373955_0110042_807_1556 | 242 |
| 429 | 3300035410 | Ga0373924_0167911 | Ga0373924_0167911_163_942 | 242 |
| 430 | 3300035692 | Ga0373935_0047100 | Ga0373935_0047100_1120_1860 | 242 |
| 431 | 3300035692 | Ga0373935_0131017 | Ga0373935_0131017_825_1589 | 242 |
| 432 | 3300035724 | Ga0373933_0021198 | Ga0373933_0021198_509_1273 | 242 |
| 433 | 3300035724 | Ga0373933_0050067 | Ga0373933_0050067_1562_2311 | 242 |
| 434 | 3300035725 | Ga0373947_0001364 | Ga0373947_0001364_13893_14633 | 242 |
| 435 | 3300035725 | Ga0373947_0155910 | Ga0373947_0155910_280_1038 | 242 |
| 436 | 3300035725 | Ga0373947_0263598 | Ga0373947_0263598_200_940 | 242 |
| 437 | 3300036401 | Ga0373937_0001893 | Ga0373937_0001893_12853_13617 | 242 |
| 438 | 3300036401 | Ga0373937_0020624 | Ga0373937_0020624_3182_3961 | 242 |
| 439 | 3300036401 | Ga0373937_0046600 | Ga0373937_0046600_2769_3518 | 242 |
| 440 | 3300036401 | Ga0373937_0393444 | Ga0373937_0393444_34_774 | 242 |
| 441 | 3300036712 | Ga0316584_0254296 | Ga0316584_0254296_369_1139 | 242 |
| 442 | 3300037068 | Ga0373925_0001414 | Ga0373925_0001414_2822_3562 | 242 |
| 443 | 3300037068 | Ga0373925_0053958 | Ga0373925_0053958_1306_2064 | 242 |
| 444 | 3300037068 | Ga0373925_0553994 | Ga0373925_0553994_86_814 | 242 |
| 445 | 3300037418 | Ga0395900_0113016 | Ga0395900_0113016_316_1056 | 242 |
| 446 | 3300037466 | Ga0395898_0056747 | Ga0395898_0056747_2290_3021 | 242 |
| 447 | 3300037853 | Ga0436364_0051577 | Ga0436364_0051577_3552_4310 | 242 |
| 448 | 3300037853 | Ga0436364_0059099 | Ga0436364_0059099_212_952 | 242 |
| 449 | 3300037853 | Ga0436364_0203770 | Ga0436364_0203770_1736_2494 | 242 |
| 450 | 3300037853 | Ga0436364_0362008 | Ga0436364_0362008_2991_3731 | 242 |
| 451 | 3300037853 | Ga0436364_0475118 | Ga0436364_0475118_557_1336 | 242 |
| 452 | 3300037853 | Ga0436364_0602759 | Ga0436364_0602759_2849_3607 | 242 |
| 453 | 3300037853 | Ga0436364_0657729 | Ga0436364_0657729_54_782 | 242 |
| 454 | 3300037853 | Ga0436364_0909379 | Ga0436364_0909379_276_1049 | 242 |
| 455 | 3300037853 | Ga0436364_0934794 | Ga0436364_0934794_266_1024 | 242 |
| 456 | 3300037853 | Ga0436364_1409641 | Ga0436364_1409641_2986_3735 | 242 |
| 457 | 3300037853 | Ga0436364_1556058 | Ga0436364_1556058_2505_3263 | 242 |
| 458 | 3300039437 | Ga0436365_0096934 | Ga0436365_0096934_1093_1851 | 242 |
| 459 | 3300039437 | Ga0436365_0157338 | Ga0436365_0157338_434_1222 | 242 |
| 460 | 3300039437 | Ga0436365_0288035 | Ga0436365_0288035_171_899 | 242 |
| 461 | 3300039437 | Ga0436365_0491703 | Ga0436365_0491703_1132_1911 | 242 |
| 462 | 3300039437 | Ga0436365_0617682 | Ga0436365_0617682_6678_7418 | 242 |
| 463 | 3300039437 | Ga0436365_0761153 | Ga0436365_0761153_1179_1937 | 242 |
| 464 | 3300039437 | Ga0436365_0860671 | Ga0436365_0860671_7182_7970 | 242 |
| 465 | 3300039437 | Ga0436365_1821431 | Ga0436365_1821431_717_1475 | 242 |
| 466 | 3300039438 | Ga0436360_0318029 | Ga0436360_0318029_4417_5157 | 242 |
| 467 | 3300039438 | Ga0436360_0701333 | Ga0436360_0701333_1337_2095 | 242 |
| 468 | 3300039450 | Ga0436363_0647949 | Ga0436363_0647949_1473_2213 | 242 |
| 469 | 3300039450 | Ga0436363_1203601 | Ga0436363_1203601_3658_4398 | 242 |
| 470 | 3300039453 | Ga0436362_0592346 | Ga0436362_0592346_154_942 | 242 |
| 471 | 3300039453 | Ga0436362_0620224 | Ga0436362_0620224_627_1367 | 242 |
| 472 | 3300044694 | Ga0466963_0234277 | Ga0466963_0234277_219_959 | 242 |
| 473 | 3300044712 | Ga0453684_0175287 | Ga0453684_0175287_473_1228 | 242 |
| 474 | 3300045051 | Ga0451576_0331392 | Ga0451576_0331392_675_1403 | 242 |
| 475 | 3300045051 | Ga0451576_0383525 | Ga0451576_0383525_624_1352 | 242 |
| 476 | 3300045836 | Ga0466958_0138432 | Ga0466958_0138432_309_1037 | 242 |
| 477 | 3300045836 | Ga0466958_0385170 | Ga0466958_0385170_67_804 | 242 |
| 478 | 3300046454 | Ga0495592_0163620 | Ga0495592_0163620_275_1054 | 242 |
| 479 | 3300046462 | Ga0495651_0402539 | Ga0495651_0402539_19_747 | 242 |
| 480 | 3300046472 | Ga0495580_0011195 | Ga0495580_0011195_1386_2114 | 242 |
| 481 | 3300046472 | Ga0495580_0014222 | Ga0495580_0014222_1609_2337 | 242 |
| 482 | 3300046472 | Ga0495580_0102050 | Ga0495580_0102050_882_1640 | 242 |
| 483 | 3300046472 | Ga0495580_0254849 | Ga0495580_0254849_255_983 | 242 |
| 484 | 3300046472 | Ga0495580_0394050 | Ga0495580_0394050_47_805 | 242 |
| 485 | 3300046472 | Ga0495580_0428837 | Ga0495580_0428837_64_804 | 242 |
| 486 | 3300046472 | Ga0495580_0509813 | Ga0495580_0509813_30_770 | 242 |
| 487 | 3300046473 | Ga0495582_0163420 | Ga0495582_0163420_117_845 | 242 |
| 488 | 3300046511 | Ga0495608_0102751 | Ga0495608_0102751_353_1117 | 242 |
| 489 | 3300046517 | Ga0495630_0137815 | Ga0495630_0137815_528_1256 | 242 |
| 490 | 3300046529 | Ga0495652_0101144 | Ga0495652_0101144_1316_2077 | 242 |
| 491 | 3300046535 | Ga0495586_0052466 | Ga0495586_0052466_1215_1994 | 242 |
| 492 | 3300046536 | Ga0495587_0000640 | Ga0495587_0000640_252_1031 | 242 |
| 493 | 3300046536 | Ga0495587_0027794 | Ga0495587_0027794_2578_3306 | 242 |
| 494 | 3300046543 | Ga0495645_0049288 | Ga0495645_0049288_798_1526 | 242 |
| 495 | 3300046559 | Ga0495667_0214137 | Ga0495667_0214137_406_1134 | 242 |
| 496 | 3300046559 | Ga0495667_0454334 | Ga0495667_0454334_19_747 | 242 |
| 497 | 3300046663 | Ga0495635_0103696 | Ga0495635_0103696_832_1560 | 242 |
| 498 | 3300046675 | Ga0495657_0137483 | Ga0495657_0137483_235_963 | 242 |
| 499 | 3300046679 | Ga0495623_0067839 | Ga0495623_0067839_504_1232 | 242 |
| 500 | 3300046679 | Ga0495623_0175255 | Ga0495623_0175255_16_744 | 242 |
| 501 | 3300046683 | Ga0495658_0357782 | Ga0495658_0357782_142_870 | 242 |
| 502 | 3300046809 | Ga0495600_0157501 | Ga0495600_0157501_47_811 | 242 |
| 503 | 3300047318 | Ga0495636_0016181 | Ga0495636_0016181_1151_1915 | 242 |
| 504 | 3300047319 | Ga0495674_0080987 | Ga0495674_0080987_1911_2660 | 242 |
| 505 | 3300047319 | Ga0495674_0206844 | Ga0495674_0206844_516_1244 | 242 |
| 506 | 3300047321 | Ga0495676_0364015 | Ga0495676_0364015_13_753 | 242 |
| 507 | 3300047322 | Ga0495680_0059445 | Ga0495680_0059445_1536_2297 | 242 |
| 508 | 3300047471 | Ga0495684_0030460 | Ga0495684_0030460_2107_2835 | 242 |
| 509 | 3300047471 | Ga0495684_0031272 | Ga0495684_0031272_2894_3622 | 242 |
| 510 | 3300047471 | Ga0495684_0032701 | Ga0495684_0032701_2277_3041 | 242 |
| 511 | 3300047471 | Ga0495684_0049869 | Ga0495684_0049869_483_1244 | 242 |
| 512 | 3300048088 | Ga0495602_0007373 | Ga0495602_0007373_1012_1791 | 242 |
| 513 | 3300048088 | Ga0495602_0143065 | Ga0495602_0143065_42_770 | 242 |
| 514 | 3300048088 | Ga0495602_0337095 | Ga0495602_0337095_237_965 | 242 |
| 515 | 3300048905 | Ga0496102_0675129 | Ga0496102_0675129_132_890 | 242 |
| 516 | 3300048907 | Ga0496104_0290375 | Ga0496104_0290375_151_891 | 242 |
| 517 | 3300048911 | Ga0496108_0682848 | Ga0496108_0682848_111_851 | 242 |
| 518 | 3300048918 | Ga0496115_0093629 | Ga0496115_0093629_336_1076 | 242 |
| 519 | 3300049568 | Ga0501031_0002163 | Ga0501031_0002163_6169_6930 | 242 |
| 520 | 3300049570 | Ga0501033_0027878 | Ga0501033_0027878_2663_3424 | 242 |
| 521 | 3300049571 | Ga0501034_0008169 | Ga0501034_0008169_9403_10143 | 242 |
| 522 | 3300049571 | Ga0501034_0037104 | Ga0501034_0037104_2514_3275 | 242 |
| 523 | 3300049572 | Ga0501036_0000255 | Ga0501036_0000255_1903_2664 | 242 |
| 524 | 3300049573 | Ga0501037_0029347 | Ga0501037_0029347_789_1550 | 242 |
| 525 | 3300049574 | Ga0501038_0001681 | Ga0501038_0001681_10813_11574 | 242 |
| 526 | 3300049575 | Ga0501039_0032376 | Ga0501039_0032376_1594_2355 | 242 |
| 527 | 3300049576 | Ga0501040_0471575 | Ga0501040_0471575_121_849 | 242 |
| 528 | 3300049578 | Ga0501042_0119259 | Ga0501042_0119259_1016_1777 | 242 |
| 529 | 3300049579 | Ga0501043_0238048 | Ga0501043_0238048_10_771 | 242 |
| 530 | 3300049580 | Ga0501046_0012015 | Ga0501046_0012015_4937_5698 | 242 |
| 531 | 3300049580 | Ga0501046_0129826 | Ga0501046_0129826_623_1360 | 242 |
| 532 | 3300049581 | Ga0501047_0005379 | Ga0501047_0005379_1163_1903 | 242 |
| 533 | 3300049581 | Ga0501047_0104999 | Ga0501047_0104999_142_903 | 242 |
| 534 | 3300049581 | Ga0501047_0393686 | Ga0501047_0393686_248_988 | 242 |
| 535 | 3300049582 | Ga0501048_0010139 | Ga0501048_0010139_3042_3803 | 242 |
| 536 | 3300049582 | Ga0501048_0552841 | Ga0501048_0552841_50_790 | 242 |
| 537 | 3300049584 | Ga0501068_0004494 | Ga0501068_0004494_1375_2136 | 242 |
| 538 | 3300049585 | Ga0501069_0003875 | Ga0501069_0003875_2326_3087 | 242 |
| 539 | 3300049586 | Ga0501070_0029721 | Ga0501070_0029721_2016_2777 | 242 |
| 540 | 3300049586 | Ga0501070_0090854 | Ga0501070_0090854_1280_2020 | 242 |
| 541 | 3300049588 | Ga0501072_0000250 | Ga0501072_0000250_8791_9552 | 242 |
| 542 | 3300049589 | Ga0501073_0009030 | Ga0501073_0009030_1788_2549 | 242 |
| 543 | 3300049589 | Ga0501073_0109147 | Ga0501073_0109147_272_1012 | 242 |
| 544 | 3300049590 | Ga0501074_0004552 | Ga0501074_0004552_713_1474 | 242 |
| 545 | 3300049591 | Ga0501075_0221346 | Ga0501075_0221346_63_791 | 242 |
| 546 | 3300049592 | Ga0501076_0507005 | Ga0501076_0507005_148_909 | 242 |
| 547 | 3300049593 | Ga0501077_0005572 | Ga0501077_0005572_5110_5871 | 242 |
| 548 | 3300049661 | Ga0501217_103991 | Ga0501217_103991_46_792 | 242 |
| 549 | 3300049686 | Ga0501257_041642 | Ga0501257_041642_96_842 | 242 |
| 550 | 3300049741 | Ga0501079_0010908 | Ga0501079_0010908_5329_6090 | 242 |
| 551 | 3300049742 | Ga0501080_0001964 | Ga0501080_0001964_3023_3784 | 242 |
| 552 | 3300049742 | Ga0501080_0172422 | Ga0501080_0172422_277_1017 | 242 |
| 553 | 3300049744 | Ga0501083_0011177 | Ga0501083_0011177_3023_3784 | 242 |
| 554 | 3300049822 | Ga0501035_0010163 | Ga0501035_0010163_6071_6832 | 242 |
| 555 | 3300049822 | Ga0501035_0056092 | Ga0501035_0056092_2178_2915 | 242 |
| 556 | 3300049822 | Ga0501035_0335447 | Ga0501035_0335447_118_858 | 242 |
| 557 | 3300049823 | Ga0501044_0002393 | Ga0501044_0002393_15986_16723 | 242 |
| 558 | 3300049823 | Ga0501044_0021570 | Ga0501044_0021570_2028_2765 | 242 |
| 559 | 3300049823 | Ga0501044_0044948 | Ga0501044_0044948_2016_2777 | 242 |
| 560 | 3300050508 | nmdc:mga09592_346529_c1 | nmdc:mga09592_346529_c1_504_1250 | 242 |
| 561 | 3300050509 | nmdc:mga0qj67_97961_c1 | nmdc:mga0qj67_97961_c1_650_1390 | 242 |
| 562 | 3300050511 | nmdc:mga08y16_251203_c1 | nmdc:mga08y16_251203_c1_658_1443 | 242 |
| 563 | 3300050511 | nmdc:mga08y16_390678_c1 | nmdc:mga08y16_390678_c1_482_1210 | 242 |
| 564 | 3300053077 | Ga0495601_0052290 | Ga0495601_0052290_542_1306 | 242 |
| 565 | 3300054114 | Ga0501084_0000893 | Ga0501084_0000893_5048_5809 | 242 |
| 566 | 3300060353 | Ga0501082_0000283 | Ga0501082_0000283_7120_7848 | 242 |
| 567 | 3300060353 | Ga0501082_0062309 | Ga0501082_0062309_2308_3069 | 242 |
| 568 | 3300060353 | Ga0501082_0216336 | Ga0501082_0216336_207_935 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wbs-assembly1.cif.gz_A | crystal structure of an abc transporter related protein from burkholderia phymatum | 0.9798 | 1 | 239 |
| 5x5y-assembly1.cif.gz_A | a membrane protein complex | 0.9719 | 3 | 239 |
| 6hs3-assembly1.cif.gz_A | crystal structure of an abc transporter related protein from burkholderia pseudomallei | 0.9706 | 1 | 239 |
| 6mjp-assembly1.cif.gz_B | lptb(e163q)fgc from vibrio cholerae | 0.9694 | 3 | 239 |
| 4wbs-assembly2.cif.gz_B | crystal structure of an abc transporter related protein from burkholderia phymatum | 0.9684 | 2 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wbsA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9798 | 1 | 239 | 3.40.50.300 |
| 4wbsA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.964 | 1 | 239 | 3.40.50.300 |
| af_P0A9S7_4_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9523 | 4 | 236 | 3.40.50.300 |
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9411 | 1 | 219 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9296 | 4 | 232 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A800DFT5-F1-model_v4 | LPS export ABC transporter ATP-binding protein | 0.9952 | 47 | 239 |
GO:0005524
GO:0016887 GO:0043190 GO:0055085 |
| AF-A0A1I2K4U1-F1-model_v4 | Lipopolysaccharide export system ATP-binding protein LptB | 0.9951 | 2 | 239 |
GO:0005524
GO:0005737 GO:0016887 GO:0043190 GO:0055085 |
| AF-A0A7C3HEI8-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9922 | 138 | 241 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A2V7MZW3-F1-model_v4 | LPS export ABC transporter ATP-binding protein | 0.991 | 2 | 237 |
GO:0005524
GO:0016887 GO:0043190 GO:0055085 |
| AF-A0A520NCX8-F1-model_v4 | LPS export ABC transporter ATP-binding protein | 0.9907 | 4 | 239 |
GO:0005524
GO:0016887 GO:0043190 GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar