F464507
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 567 | 232 | 1134 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_11165914|Ga0105242_111659141 |
| Length | 236 |
| Sequence | MKVGKLPTLPWYLRMFVFVVVAGVIYAGFWYFITRSVRAETAAMQGEIAQLKPRNAQAQVVSQRLNEFKAAYKAREEEYAELKALLPEQKEITKVLEGIQDRVRTNSTVLIRFFPKEDVQQENYSGKKIEVVVVSSFAALRSFFEQLAHYQRIVSVTNFELRQLERQSPAMTLDARFDLTAFYVSAEKLQQQQPAPANASGGQTSGQVPPIQIASPSPIDTKKISDALKYNPTVKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 166 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 167 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 176 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 177 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 178 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 179 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 180 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 186 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 187 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 188 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 192 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 193 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 194 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 195 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 196 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 197 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 200 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 201 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 202 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 203 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 204 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 205 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 206 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 207 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 208 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 209 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 210 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 211 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 212 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 213 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 214 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 215 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 216 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 220 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 221 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 222 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 223 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 224 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 225 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 226 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 227 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.59 |
| Rhizosphere | 98.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 32.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105242_11165914 | 3300009176 | Unclassified | 788 |
| 2 | CNBas_1001055 | 3300000531 | Bacteria | 1402 |
| 3 | CNAas_1000181 | 3300000532 | Bacteria | 5790 |
| 4 | JGI25406J46586_10008456 | 3300003203 | Unclassified | 4661 |
| 5 | rootL2_10079104 | 3300003322 | Bacteria | 2834 |
| 6 | Ga0065704_10012739 | 3300005289 | Bacteria | 1801 |
| 7 | Ga0065704_10104920 | 3300005289 | Bacteria | 2126 |
| 8 | Ga0065712_10000119 | 3300005290 | Bacteria | 137052 |
| 9 | Ga0065712_10001378 | 3300005290 | Bacteria | 7401 |
| 10 | Ga0065712_10006111 | 3300005290 | Bacteria | 2694 |
| 11 | Ga0065715_10006815 | 3300005293 | Bacteria | 2794 |
| 12 | Ga0065715_10089430 | 3300005293 | Bacteria | 10224 |
| 13 | Ga0065715_10091808 | 3300005293 | Bacteria | 5525 |
| 14 | Ga0065715_10093519 | 3300005293 | Unclassified | 4654 |
| 15 | Ga0065715_10105306 | 3300005293 | Bacteria | 2884 |
| 16 | Ga0065715_10126025 | 3300005293 | Unclassified | 2098 |
| 17 | Ga0065715_10213778 | 3300005293 | Unclassified | 1302 |
| 18 | Ga0065707_10001424 | 3300005295 | Bacteria | 6861 |
| 19 | Ga0065707_10139895 | 3300005295 | Bacteria | 1787 |
| 20 | Ga0065707_10170709 | 3300005295 | Bacteria | 1487 |
| 21 | Ga0070676_10072450 | 3300005328 | Unclassified | 2071 |
| 22 | Ga0070676_10393074 | 3300005328 | Unclassified | 963 |
| 23 | Ga0070690_100000815 | 3300005330 | Bacteria | 15792 |
| 24 | Ga0070690_100011683 | 3300005330 | Bacteria | 5143 |
| 25 | Ga0070690_100072473 | 3300005330 | Bacteria | 2240 |
| 26 | Ga0070670_100046535 | 3300005331 | Bacteria | 3731 |
| 27 | Ga0068869_100006679 | 3300005334 | Bacteria | 7327 |
| 28 | Ga0068869_100013648 | 3300005334 | Bacteria | 5410 |
| 29 | Ga0070666_10088657 | 3300005335 | Unclassified | 2123 |
| 30 | Ga0070680_100026646 | 3300005336 | Bacteria | 4623 |
| 31 | Ga0070680_100097026 | 3300005336 | Bacteria | 2444 |
| 32 | Ga0068868_100012859 | 3300005338 | Bacteria | 6123 |
| 33 | Ga0068868_100055738 | 3300005338 | Bacteria | 3120 |
| 34 | Ga0068868_100059251 | 3300005338 | Unclassified | 3028 |
| 35 | Ga0070660_100062135 | 3300005339 | Bacteria | 2901 |
| 36 | Ga0070689_100000332 | 3300005340 | Bacteria | 27541 |
| 37 | Ga0070691_10119564 | 3300005341 | Unclassified | 1325 |
| 38 | Ga0070687_100014055 | 3300005343 | Bacteria | 3586 |
| 39 | Ga0070692_10020296 | 3300005345 | Bacteria | 3221 |
| 40 | Ga0070692_10093066 | 3300005345 | Bacteria | 1641 |
| 41 | Ga0070692_10181273 | 3300005345 | Bacteria | 1221 |
| 42 | Ga0070692_10464251 | 3300005345 | Unclassified | 813 |
| 43 | Ga0070669_100006887 | 3300005353 | Bacteria | 8168 |
| 44 | Ga0070669_100016941 | 3300005353 | Bacteria | 5203 |
| 45 | Ga0070675_100057812 | 3300005354 | Unclassified | 3198 |
| 46 | Ga0070671_100002480 | 3300005355 | Bacteria | 14270 |
| 47 | Ga0070671_100018059 | 3300005355 | Bacteria | 5724 |
| 48 | Ga0070674_100845730 | 3300005356 | Bacteria | 793 |
| 49 | Ga0070673_100009775 | 3300005364 | Bacteria | 6458 |
| 50 | Ga0070673_100096745 | 3300005364 | Bacteria | 2423 |
| 51 | Ga0070673_100261381 | 3300005364 | Bacteria | 1512 |
| 52 | Ga0070673_100789792 | 3300005364 | Unclassified | 876 |
| 53 | Ga0070688_100033707 | 3300005365 | Unclassified | 3096 |
| 54 | Ga0070659_100002213 | 3300005366 | Bacteria | 13825 |
| 55 | Ga0070659_100185611 | 3300005366 | Bacteria | 1708 |
| 56 | Ga0070667_100025175 | 3300005367 | Unclassified | 4946 |
| 57 | Ga0070667_100086409 | 3300005367 | Bacteria | 2691 |
| 58 | Ga0070703_10006075 | 3300005406 | Bacteria | 3380 |
| 59 | Ga0070701_10007656 | 3300005438 | Bacteria | 4631 |
| 60 | Ga0070701_10016745 | 3300005438 | Bacteria | 3414 |
| 61 | Ga0070701_10107090 | 3300005438 | Bacteria | 1557 |
| 62 | Ga0070701_10260055 | 3300005438 | Bacteria | 1052 |
| 63 | Ga0070701_10283339 | 3300005438 | Unclassified | 1013 |
| 64 | Ga0070701_10359040 | 3300005438 | Bacteria | 912 |
| 65 | Ga0070705_100012488 | 3300005440 | Bacteria | 4319 |
| 66 | Ga0070700_100000599 | 3300005441 | Bacteria | 17976 |
| 67 | Ga0070700_100002970 | 3300005441 | Bacteria | 8699 |
| 68 | Ga0070700_100018171 | 3300005441 | Bacteria | 4038 |
| 69 | Ga0070700_100270682 | 3300005441 | Bacteria | 1227 |
| 70 | Ga0070694_100012167 | 3300005444 | Bacteria | 5346 |
| 71 | Ga0070694_100024293 | 3300005444 | Unclassified | 3911 |
| 72 | Ga0070694_100035183 | 3300005444 | Unclassified | 3309 |
| 73 | Ga0070694_100037621 | 3300005444 | Bacteria | 3210 |
| 74 | Ga0070694_100053687 | 3300005444 | Bacteria | 2728 |
| 75 | Ga0070694_100110501 | 3300005444 | Bacteria | 1958 |
| 76 | Ga0070694_100158590 | 3300005444 | Unclassified | 1658 |
| 77 | Ga0070694_100171683 | 3300005444 | Bacteria | 1598 |
| 78 | Ga0070708_100000893 | 3300005445 | Bacteria | 22576 |
| 79 | Ga0070708_100365781 | 3300005445 | Bacteria | 1359 |
| 80 | Ga0070662_100094692 | 3300005457 | Bacteria | 2249 |
| 81 | Ga0070662_100292436 | 3300005457 | Unclassified | 1321 |
| 82 | Ga0070662_100747382 | 3300005457 | Bacteria | 829 |
| 83 | Ga0070681_10000489 | 3300005458 | Bacteria | 32333 |
| 84 | Ga0070681_10023649 | 3300005458 | Bacteria | 6182 |
| 85 | Ga0070681_10036842 | 3300005458 | Bacteria | 4911 |
| 86 | Ga0070681_10473753 | 3300005458 | Bacteria | 1165 |
| 87 | Ga0068867_100014729 | 3300005459 | Bacteria | 5542 |
| 88 | Ga0068867_100996015 | 3300005459 | Bacteria | 760 |
| 89 | Ga0070685_10009550 | 3300005466 | Bacteria | 5016 |
| 90 | Ga0070685_10671258 | 3300005466 | Unclassified | 753 |
| 91 | Ga0070706_100004529 | 3300005467 | Bacteria | 13381 |
| 92 | Ga0070706_100075032 | 3300005467 | Unclassified | 3130 |
| 93 | Ga0070706_100084605 | 3300005467 | Bacteria | 2939 |
| 94 | Ga0070707_100007041 | 3300005468 | Bacteria | 10426 |
| 95 | Ga0070698_100003700 | 3300005471 | Bacteria | 16783 |
| 96 | Ga0070698_100015281 | 3300005471 | Bacteria | 8116 |
| 97 | Ga0070698_100259343 | 3300005471 | Unclassified | 1670 |
| 98 | Ga0070699_100003184 | 3300005518 | Bacteria | 14519 |
| 99 | Ga0070699_100039893 | 3300005518 | Unclassified | 4066 |
| 100 | Ga0070699_100224364 | 3300005518 | Bacteria | 1675 |
| 101 | Ga0070699_100229251 | 3300005518 | Bacteria | 1656 |
| 102 | Ga0070699_100614721 | 3300005518 | Bacteria | 991 |
| 103 | Ga0070699_100729211 | 3300005518 | Bacteria | 906 |
| 104 | Ga0070679_100000604 | 3300005530 | Bacteria | 30555 |
| 105 | Ga0070679_100002464 | 3300005530 | Bacteria | 16764 |
| 106 | Ga0070697_100002853 | 3300005536 | Bacteria | 13292 |
| 107 | Ga0070697_100011788 | 3300005536 | Bacteria | 6840 |
| 108 | Ga0070697_100056905 | 3300005536 | Bacteria | 3182 |
| 109 | Ga0070697_100063694 | 3300005536 | Bacteria | 3011 |
| 110 | Ga0068853_100084677 | 3300005539 | Bacteria | 2778 |
| 111 | Ga0068853_100158832 | 3300005539 | Bacteria | 2038 |
| 112 | Ga0070672_100149979 | 3300005543 | Unclassified | 1928 |
| 113 | Ga0070672_100800381 | 3300005543 | Unclassified | 829 |
| 114 | Ga0070686_100001026 | 3300005544 | Bacteria | 16055 |
| 115 | Ga0070686_100014776 | 3300005544 | Unclassified | 4504 |
| 116 | Ga0070695_100042646 | 3300005545 | Unclassified | 2881 |
| 117 | Ga0070695_100090337 | 3300005545 | Unclassified | 2044 |
| 118 | Ga0070695_100333631 | 3300005545 | Bacteria | 1131 |
| 119 | Ga0070695_100574933 | 3300005545 | Bacteria | 881 |
| 120 | Ga0070696_100011471 | 3300005546 | Bacteria | 5935 |
| 121 | Ga0070696_100021570 | 3300005546 | Unclassified | 4367 |
| 122 | Ga0070696_100061302 | 3300005546 | Bacteria | 2631 |
| 123 | Ga0070696_100123566 | 3300005546 | Unclassified | 1875 |
| 124 | Ga0070696_100180734 | 3300005546 | Bacteria | 1565 |
| 125 | Ga0070696_100310546 | 3300005546 | Unclassified | 1210 |
| 126 | Ga0070693_100000939 | 3300005547 | Bacteria | 12910 |
| 127 | Ga0070693_100009613 | 3300005547 | Bacteria | 4814 |
| 128 | Ga0070693_100051343 | 3300005547 | Bacteria | 2361 |
| 129 | Ga0070693_100452124 | 3300005547 | Unclassified | 902 |
| 130 | Ga0070665_100049616 | 3300005548 | Unclassified | 4211 |
| 131 | Ga0070665_100464336 | 3300005548 | Bacteria | 1276 |
| 132 | Ga0070704_100007286 | 3300005549 | Bacteria | 6579 |
| 133 | Ga0070704_100031246 | 3300005549 | Bacteria | 3580 |
| 134 | Ga0070704_100056971 | 3300005549 | Bacteria | 2777 |
| 135 | Ga0070704_100183445 | 3300005549 | Bacteria | 1676 |
| 136 | Ga0070704_100223544 | 3300005549 | Bacteria | 1532 |
| 137 | Ga0070664_100006025 | 3300005564 | Bacteria | 9805 |
| 138 | Ga0068857_100003448 | 3300005577 | Bacteria | 13186 |
| 139 | Ga0068854_100017914 | 3300005578 | Unclassified | 4748 |
| 140 | Ga0068854_100098095 | 3300005578 | Bacteria | 2192 |
| 141 | Ga0068854_100112996 | 3300005578 | Bacteria | 2051 |
| 142 | Ga0068854_100312003 | 3300005578 | Bacteria | 1276 |
| 143 | Ga0068856_100140122 | 3300005614 | Unclassified | 2425 |
| 144 | Ga0070702_100011505 | 3300005615 | Bacteria | 4402 |
| 145 | Ga0070702_100045914 | 3300005615 | Unclassified | 2474 |
| 146 | Ga0070702_100054736 | 3300005615 | Bacteria | 2297 |
| 147 | Ga0070702_100674727 | 3300005615 | Unclassified | 785 |
| 148 | Ga0068852_100036764 | 3300005616 | Unclassified | 4101 |
| 149 | Ga0068852_100059883 | 3300005616 | Bacteria | 3304 |
| 150 | Ga0068859_100022691 | 3300005617 | Bacteria | 6292 |
| 151 | Ga0068859_100023895 | 3300005617 | Bacteria | 6134 |
| 152 | Ga0068859_100032365 | 3300005617 | Bacteria | 5253 |
| 153 | Ga0068859_100086047 | 3300005617 | Bacteria | 3189 |
| 154 | Ga0068859_100087977 | 3300005617 | Bacteria | 3155 |
| 155 | Ga0068859_100095936 | 3300005617 | Bacteria | 3018 |
| 156 | Ga0068859_100136947 | 3300005617 | Bacteria | 2522 |
| 157 | Ga0068859_100168398 | 3300005617 | Bacteria | 2271 |
| 158 | Ga0068859_100212184 | 3300005617 | Bacteria | 2022 |
| 159 | Ga0068859_100220117 | 3300005617 | Unclassified | 1986 |
| 160 | Ga0068859_100242736 | 3300005617 | Unclassified | 1891 |
| 161 | Ga0068859_100260873 | 3300005617 | Bacteria | 1824 |
| 162 | Ga0068859_100744048 | 3300005617 | Bacteria | 1069 |
| 163 | Ga0068864_100001530 | 3300005618 | Bacteria | 19039 |
| 164 | Ga0068864_100022149 | 3300005618 | Bacteria | 5326 |
| 165 | Ga0068864_100133936 | 3300005618 | Bacteria | 2229 |
| 166 | Ga0068864_100148639 | 3300005618 | Unclassified | 2120 |
| 167 | Ga0068864_100282137 | 3300005618 | Unclassified | 1551 |
| 168 | Ga0068864_100368629 | 3300005618 | Unclassified | 1359 |
| 169 | Ga0068864_101195686 | 3300005618 | Bacteria | 759 |
| 170 | Ga0068866_10012456 | 3300005718 | Unclassified | 3704 |
| 171 | Ga0068866_10016431 | 3300005718 | Unclassified | 3309 |
| 172 | Ga0068861_100002479 | 3300005719 | Bacteria | 12027 |
| 173 | Ga0068861_100015170 | 3300005719 | Bacteria | 5423 |
| 174 | Ga0068861_100064328 | 3300005719 | Bacteria | 2822 |
| 175 | Ga0068861_100090638 | 3300005719 | Unclassified | 2412 |
| 176 | Ga0068861_100574003 | 3300005719 | Unclassified | 1031 |
| 177 | Ga0068851_10000602 | 3300005834 | Bacteria | 15490 |
| 178 | Ga0068870_10005617 | 3300005840 | Bacteria | 5484 |
| 179 | Ga0068870_10012218 | 3300005840 | Unclassified | 4006 |
| 180 | Ga0068870_10141602 | 3300005840 | Bacteria | 1408 |
| 181 | Ga0068863_100039560 | 3300005841 | Unclassified | 4485 |
| 182 | Ga0068863_100102348 | 3300005841 | Bacteria | 2723 |
| 183 | Ga0068858_100018216 | 3300005842 | Bacteria | 6575 |
| 184 | Ga0068858_100063191 | 3300005842 | Unclassified | 3426 |
| 185 | Ga0068858_100065198 | 3300005842 | Unclassified | 3370 |
| 186 | Ga0068858_100180580 | 3300005842 | Unclassified | 1993 |
| 187 | Ga0068858_100264220 | 3300005842 | Bacteria | 1636 |
| 188 | Ga0068858_100316135 | 3300005842 | Bacteria | 1492 |
| 189 | Ga0068860_100014889 | 3300005843 | Bacteria | 7604 |
| 190 | Ga0068860_100056661 | 3300005843 | Unclassified | 3725 |
| 191 | Ga0068860_100090477 | 3300005843 | Bacteria | 2915 |
| 192 | Ga0068860_100192851 | 3300005843 | Unclassified | 1972 |
| 193 | Ga0068860_100327698 | 3300005843 | Unclassified | 1504 |
| 194 | Ga0068860_100340314 | 3300005843 | Bacteria | 1475 |
| 195 | Ga0068860_100518085 | 3300005843 | Bacteria | 1192 |
| 196 | Ga0068860_100575214 | 3300005843 | Bacteria | 1130 |
| 197 | Ga0068862_100002424 | 3300005844 | Bacteria | 16560 |
| 198 | Ga0068862_100428767 | 3300005844 | Unclassified | 1242 |
| 199 | Ga0081539_10000043 | 3300005985 | Bacteria | 288108 |
| 200 | Ga0081539_10205041 | 3300005985 | Bacteria | 908 |
| 201 | Ga0097621_100000998 | 3300006237 | Bacteria | 19881 |
| 202 | Ga0097621_100059911 | 3300006237 | Unclassified | 3118 |
| 203 | Ga0097621_100284425 | 3300006237 | Unclassified | 1456 |
| 204 | Ga0068871_100011234 | 3300006358 | Bacteria | 6562 |
| 205 | Ga0068871_100016501 | 3300006358 | Bacteria | 5564 |
| 206 | Ga0075428_100122412 | 3300006844 | Bacteria | 2832 |
| 207 | Ga0075428_100224857 | 3300006844 | Unclassified | 2026 |
| 208 | Ga0075433_10028824 | 3300006852 | Bacteria | 4723 |
| 209 | Ga0075433_10395491 | 3300006852 | Unclassified | 1219 |
| 210 | Ga0075433_10427128 | 3300006852 | Bacteria | 1168 |
| 211 | Ga0075434_100064748 | 3300006871 | Bacteria | 3640 |
| 212 | Ga0075434_100165629 | 3300006871 | Unclassified | 2230 |
| 213 | Ga0075434_100207408 | 3300006871 | Unclassified | 1980 |
| 214 | Ga0068865_100013756 | 3300006881 | Bacteria | 5126 |
| 215 | Ga0068865_100055199 | 3300006881 | Bacteria | 2763 |
| 216 | Ga0068865_100086504 | 3300006881 | Unclassified | 2263 |
| 217 | Ga0097620_100022692 | 3300006931 | Bacteria | 6292 |
| 218 | Ga0097620_100023895 | 3300006931 | Bacteria | 6134 |
| 219 | Ga0097620_100032365 | 3300006931 | Bacteria | 5253 |
| 220 | Ga0097620_100056714 | 3300006931 | Bacteria | 3944 |
| 221 | Ga0097620_100086056 | 3300006931 | Bacteria | 3189 |
| 222 | Ga0097620_100087973 | 3300006931 | Bacteria | 3155 |
| 223 | Ga0097620_100095940 | 3300006931 | Bacteria | 3018 |
| 224 | Ga0097620_100136936 | 3300006931 | Bacteria | 2522 |
| 225 | Ga0097620_100168404 | 3300006931 | Bacteria | 2271 |
| 226 | Ga0097620_100212177 | 3300006931 | Bacteria | 2022 |
| 227 | Ga0097620_100220110 | 3300006931 | Unclassified | 1986 |
| 228 | Ga0097620_100242724 | 3300006931 | Unclassified | 1891 |
| 229 | Ga0097620_100260883 | 3300006931 | Bacteria | 1824 |
| 230 | Ga0097620_100744025 | 3300006931 | Bacteria | 1069 |
| 231 | Ga0075435_100221459 | 3300007076 | Bacteria | 1607 |
| 232 | Ga0075435_100428543 | 3300007076 | Bacteria | 1140 |
| 233 | Ga0099794_10046319 | 3300007265 | Unclassified | 2083 |
| 234 | Ga0105240_10037067 | 3300009093 | Bacteria | 6268 |
| 235 | Ga0111539_10117315 | 3300009094 | Bacteria | 3120 |
| 236 | Ga0111539_10649599 | 3300009094 | Unclassified | 1228 |
| 237 | Ga0105245_10012480 | 3300009098 | Bacteria | 7393 |
| 238 | Ga0105245_10411729 | 3300009098 | Bacteria | 1353 |
| 239 | Ga0105245_10933738 | 3300009098 | Bacteria | 910 |
| 240 | Ga0105247_10001416 | 3300009101 | Bacteria | 17410 |
| 241 | Ga0105247_10052943 | 3300009101 | Bacteria | 2503 |
| 242 | Ga0114129_10002712 | 3300009147 | Bacteria | 24662 |
| 243 | Ga0114129_10019782 | 3300009147 | Bacteria | 9584 |
| 244 | Ga0114129_10101911 | 3300009147 | Bacteria | 3971 |
| 245 | Ga0114129_10170208 | 3300009147 | Unclassified | 2970 |
| 246 | Ga0114129_10306882 | 3300009147 | Bacteria | 2113 |
| 247 | Ga0105243_10027561 | 3300009148 | Unclassified | 4353 |
| 248 | Ga0105243_10086254 | 3300009148 | Bacteria | 2575 |
| 249 | Ga0105243_10479963 | 3300009148 | Unclassified | 1173 |
| 250 | Ga0105243_10586167 | 3300009148 | Bacteria | 1071 |
| 251 | Ga0105241_10160595 | 3300009174 | Bacteria | 1847 |
| 252 | Ga0105241_10532648 | 3300009174 | Bacteria | 1052 |
| 253 | Ga0105241_11144838 | 3300009174 | Bacteria | 734 |
| 254 | Ga0105242_10005503 | 3300009176 | Bacteria | 9779 |
| 255 | Ga0105248_10011583 | 3300009177 | Bacteria | 9713 |
| 256 | Ga0105248_10017988 | 3300009177 | Bacteria | 7802 |
| 257 | Ga0105248_10039136 | 3300009177 | Bacteria | 5310 |
| 258 | Ga0105248_10045072 | 3300009177 | Unclassified | 4945 |
| 259 | Ga0105248_10078569 | 3300009177 | Bacteria | 3709 |
| 260 | Ga0105248_10112798 | 3300009177 | Bacteria | 3066 |
| 261 | Ga0105248_10650518 | 3300009177 | Bacteria | 1189 |
| 262 | Ga0105248_10971173 | 3300009177 | Bacteria | 959 |
| 263 | Ga0105237_10100798 | 3300009545 | Bacteria | 2879 |
| 264 | Ga0105237_10150370 | 3300009545 | Bacteria | 2325 |
| 265 | Ga0105237_11204191 | 3300009545 | Unclassified | 764 |
| 266 | Ga0105238_11328017 | 3300009551 | Unclassified | 745 |
| 267 | Ga0105249_10031120 | 3300009553 | Unclassified | 4824 |
| 268 | Ga0105249_10060173 | 3300009553 | Unclassified | 3484 |
| 269 | Ga0105249_10109747 | 3300009553 | Bacteria | 2606 |
| 270 | Ga0105249_10242496 | 3300009553 | Bacteria | 1783 |
| 271 | Ga0105249_11540352 | 3300009553 | Unclassified | 737 |
| 272 | Ga0105239_10048726 | 3300010375 | Unclassified | 4645 |
| 273 | Ga0105239_10110007 | 3300010375 | Unclassified | 3054 |
| 274 | Ga0105239_10183383 | 3300010375 | Bacteria | 2342 |
| 275 | Ga0105239_11128419 | 3300010375 | Unclassified | 903 |
| 276 | Ga0105246_10058497 | 3300011119 | Unclassified | 2670 |
| 277 | Ga0105246_10099501 | 3300011119 | Bacteria | 2114 |
| 278 | Ga0105246_10286733 | 3300011119 | Bacteria | 1323 |
| 279 | Ga0157373_10007433 | 3300013100 | Bacteria | 8149 |
| 280 | Ga0157373_10123199 | 3300013100 | Bacteria | 1822 |
| 281 | Ga0157373_10235369 | 3300013100 | Unclassified | 1294 |
| 282 | Ga0157371_10375688 | 3300013102 | Bacteria | 1037 |
| 283 | Ga0157374_10032252 | 3300013296 | Unclassified | 4768 |
| 284 | Ga0157374_10070139 | 3300013296 | Unclassified | 3301 |
| 285 | Ga0157374_10202752 | 3300013296 | Bacteria | 1943 |
| 286 | Ga0157378_10015635 | 3300013297 | Bacteria | 6647 |
| 287 | Ga0157378_10028650 | 3300013297 | Bacteria | 4915 |
| 288 | Ga0157378_10060862 | 3300013297 | Unclassified | 3368 |
| 289 | Ga0157378_10604757 | 3300013297 | Bacteria | 1108 |
| 290 | Ga0157378_10612560 | 3300013297 | Bacteria | 1101 |
| 291 | Ga0163162_10004771 | 3300013306 | Bacteria | 13085 |
| 292 | Ga0163162_10016965 | 3300013306 | Bacteria | 7124 |
| 293 | Ga0163162_10078587 | 3300013306 | Bacteria | 3365 |
| 294 | Ga0163162_10105054 | 3300013306 | Bacteria | 2919 |
| 295 | Ga0163162_10278918 | 3300013306 | Unclassified | 1803 |
| 296 | Ga0163162_10408939 | 3300013306 | Bacteria | 1490 |
| 297 | Ga0157372_10005906 | 3300013307 | Bacteria | 13032 |
| 298 | Ga0157372_10080278 | 3300013307 | Bacteria | 3690 |
| 299 | Ga0157372_10623425 | 3300013307 | Unclassified | 1257 |
| 300 | Ga0157375_10024635 | 3300013308 | Bacteria | 5573 |
| 301 | Ga0157375_10050515 | 3300013308 | Unclassified | 4079 |
| 302 | Ga0157375_10052347 | 3300013308 | Bacteria | 4013 |
| 303 | Ga0157375_10156589 | 3300013308 | Bacteria | 2417 |
| 304 | Ga0157375_11419903 | 3300013308 | Bacteria | 818 |
| 305 | Ga0163163_10001052 | 3300014325 | Bacteria | 23379 |
| 306 | Ga0163163_10015350 | 3300014325 | Bacteria | 7078 |
| 307 | Ga0163163_10049992 | 3300014325 | Unclassified | 4116 |
| 308 | Ga0163163_10066860 | 3300014325 | Bacteria | 3571 |
| 309 | Ga0163163_10073975 | 3300014325 | Bacteria | 3398 |
| 310 | Ga0163163_10172003 | 3300014325 | Bacteria | 2213 |
| 311 | Ga0163163_10641481 | 3300014325 | Bacteria | 1125 |
| 312 | Ga0157380_10002253 | 3300014326 | Bacteria | 12973 |
| 313 | Ga0157380_10007050 | 3300014326 | Bacteria | 7956 |
| 314 | Ga0157380_10011829 | 3300014326 | Bacteria | 6312 |
| 315 | Ga0157380_10020643 | 3300014326 | Bacteria | 4925 |
| 316 | Ga0157380_10473440 | 3300014326 | Bacteria | 1209 |
| 317 | Ga0157377_10003928 | 3300014745 | Bacteria | 6773 |
| 318 | Ga0157377_10043192 | 3300014745 | Unclassified | 2507 |
| 319 | Ga0157377_10391261 | 3300014745 | Unclassified | 944 |
| 320 | Ga0157379_10025308 | 3300014968 | Bacteria | 5272 |
| 321 | Ga0157379_10056961 | 3300014968 | Bacteria | 3492 |
| 322 | Ga0163161_10005643 | 3300017792 | Bacteria | 8677 |
| 323 | Ga0207666_1016672 | 3300025271 | Unclassified | 1055 |
| 324 | Ga0207656_10001847 | 3300025321 | Bacteria | 7034 |
| 325 | Ga0207653_10004283 | 3300025885 | Bacteria | 4483 |
| 326 | Ga0207642_10006111 | 3300025899 | Unclassified | 3982 |
| 327 | Ga0207710_10000788 | 3300025900 | Bacteria | 17271 |
| 328 | Ga0207680_10081764 | 3300025903 | Bacteria | 2031 |
| 329 | Ga0207680_10187388 | 3300025903 | Unclassified | 1403 |
| 330 | Ga0207645_10387718 | 3300025907 | Unclassified | 938 |
| 331 | Ga0207643_10006201 | 3300025908 | Bacteria | 6398 |
| 332 | Ga0207643_10013123 | 3300025908 | Unclassified | 4483 |
| 333 | Ga0207684_10000131 | 3300025910 | Bacteria | 137508 |
| 334 | Ga0207684_10008833 | 3300025910 | Bacteria | 8944 |
| 335 | Ga0207684_10125223 | 3300025910 | Bacteria | 2204 |
| 336 | Ga0207707_10000017 | 3300025912 | Bacteria | 237068 |
| 337 | Ga0207707_10046816 | 3300025912 | Bacteria | 3767 |
| 338 | Ga0207707_10057384 | 3300025912 | Bacteria | 3389 |
| 339 | Ga0207707_10332701 | 3300025912 | Bacteria | 1310 |
| 340 | Ga0207671_10157935 | 3300025914 | Bacteria | 1755 |
| 341 | Ga0207660_10020366 | 3300025917 | Bacteria | 4450 |
| 342 | Ga0207660_10050214 | 3300025917 | Bacteria | 2961 |
| 343 | Ga0207657_10146456 | 3300025919 | Bacteria | 1926 |
| 344 | Ga0207652_10000335 | 3300025921 | Bacteria | 48903 |
| 345 | Ga0207652_10064169 | 3300025921 | Bacteria | 3178 |
| 346 | Ga0207646_10286162 | 3300025922 | Bacteria | 1490 |
| 347 | Ga0207646_10373158 | 3300025922 | Unclassified | 1289 |
| 348 | Ga0207681_10007936 | 3300025923 | Bacteria | 6490 |
| 349 | Ga0207681_10593001 | 3300025923 | Unclassified | 915 |
| 350 | Ga0207650_10047011 | 3300025925 | Bacteria | 3179 |
| 351 | Ga0207650_10118157 | 3300025925 | Bacteria | 2061 |
| 352 | Ga0207650_10165255 | 3300025925 | Bacteria | 1756 |
| 353 | Ga0207659_10040185 | 3300025926 | Unclassified | 3269 |
| 354 | Ga0207687_10032307 | 3300025927 | Unclassified | 3544 |
| 355 | Ga0207687_10163734 | 3300025927 | Bacteria | 1709 |
| 356 | Ga0207644_10011989 | 3300025931 | Bacteria | 5748 |
| 357 | Ga0207644_10352174 | 3300025931 | Unclassified | 1196 |
| 358 | Ga0207644_10578312 | 3300025931 | Unclassified | 931 |
| 359 | Ga0207690_10036931 | 3300025932 | Bacteria | 3168 |
| 360 | Ga0207690_10056970 | 3300025932 | Bacteria | 2639 |
| 361 | Ga0207706_10096462 | 3300025933 | Unclassified | 2600 |
| 362 | Ga0207706_10112332 | 3300025933 | Bacteria | 2397 |
| 363 | Ga0207706_10155909 | 3300025933 | Bacteria | 2008 |
| 364 | Ga0207686_10114315 | 3300025934 | Unclassified | 1826 |
| 365 | Ga0207686_10202988 | 3300025934 | Bacteria | 1421 |
| 366 | Ga0207709_10214799 | 3300025935 | Bacteria | 1383 |
| 367 | Ga0207709_10380640 | 3300025935 | Unclassified | 1074 |
| 368 | Ga0207709_10810290 | 3300025935 | Bacteria | 756 |
| 369 | Ga0207670_10000242 | 3300025936 | Bacteria | 33949 |
| 370 | Ga0207670_10101751 | 3300025936 | Unclassified | 2053 |
| 371 | Ga0207669_10097300 | 3300025937 | Unclassified | 1935 |
| 372 | Ga0207704_10011998 | 3300025938 | Unclassified | 4286 |
| 373 | Ga0207704_10066261 | 3300025938 | Unclassified | 2266 |
| 374 | Ga0207691_10002280 | 3300025940 | Bacteria | 18786 |
| 375 | Ga0207691_10175902 | 3300025940 | Bacteria | 1872 |
| 376 | Ga0207691_10680672 | 3300025940 | Unclassified | 868 |
| 377 | Ga0207711_10027943 | 3300025941 | Unclassified | 4742 |
| 378 | Ga0207711_10059483 | 3300025941 | Bacteria | 3290 |
| 379 | Ga0207711_10134031 | 3300025941 | Bacteria | 2223 |
| 380 | Ga0207711_10162068 | 3300025941 | Unclassified | 2025 |
| 381 | Ga0207711_10197499 | 3300025941 | Bacteria | 1835 |
| 382 | Ga0207711_10747699 | 3300025941 | Bacteria | 911 |
| 383 | Ga0207689_10004373 | 3300025942 | Bacteria | 12860 |
| 384 | Ga0207689_10046282 | 3300025942 | Unclassified | 3595 |
| 385 | Ga0207689_10048254 | 3300025942 | Bacteria | 3512 |
| 386 | Ga0207689_10131085 | 3300025942 | Bacteria | 2063 |
| 387 | Ga0207689_10207081 | 3300025942 | Bacteria | 1620 |
| 388 | Ga0207679_10022666 | 3300025945 | Bacteria | 4280 |
| 389 | Ga0207679_10068238 | 3300025945 | Unclassified | 2671 |
| 390 | Ga0207651_10187267 | 3300025960 | Bacteria | 1648 |
| 391 | Ga0207651_10316981 | 3300025960 | Unclassified | 1302 |
| 392 | Ga0207651_10326107 | 3300025960 | Bacteria | 1285 |
| 393 | Ga0207712_10977828 | 3300025961 | Bacteria | 750 |
| 394 | Ga0207640_10111947 | 3300025981 | Bacteria | 1937 |
| 395 | Ga0207640_10190557 | 3300025981 | Unclassified | 1545 |
| 396 | Ga0207640_10418454 | 3300025981 | Unclassified | 1096 |
| 397 | Ga0207658_10052637 | 3300025986 | Unclassified | 3005 |
| 398 | Ga0207677_10008663 | 3300026023 | Bacteria | 5693 |
| 399 | Ga0207677_10154424 | 3300026023 | Bacteria | 1775 |
| 400 | Ga0207677_10157679 | 3300026023 | Bacteria | 1760 |
| 401 | Ga0207703_10024298 | 3300026035 | Unclassified | 4768 |
| 402 | Ga0207703_10179296 | 3300026035 | Bacteria | 1869 |
| 403 | Ga0207703_10215137 | 3300026035 | Bacteria | 1715 |
| 404 | Ga0207703_10287752 | 3300026035 | Bacteria | 1495 |
| 405 | Ga0207703_10450497 | 3300026035 | Bacteria | 1202 |
| 406 | Ga0207639_10064559 | 3300026041 | Bacteria | 2839 |
| 407 | Ga0207639_10343924 | 3300026041 | Bacteria | 1330 |
| 408 | Ga0207708_10000101 | 3300026075 | Bacteria | 64996 |
| 409 | Ga0207708_10005440 | 3300026075 | Bacteria | 9392 |
| 410 | Ga0207708_10221414 | 3300026075 | Bacteria | 1516 |
| 411 | Ga0207708_10299502 | 3300026075 | Bacteria | 1308 |
| 412 | Ga0207702_10019552 | 3300026078 | Bacteria | 5605 |
| 413 | Ga0207641_10145895 | 3300026088 | Bacteria | 2140 |
| 414 | Ga0207641_10167139 | 3300026088 | Bacteria | 2004 |
| 415 | Ga0207641_10218975 | 3300026088 | Bacteria | 1764 |
| 416 | Ga0207641_11046108 | 3300026088 | Unclassified | 814 |
| 417 | Ga0207648_10004088 | 3300026089 | Bacteria | 15115 |
| 418 | Ga0207648_10050077 | 3300026089 | Bacteria | 3653 |
| 419 | Ga0207648_10204192 | 3300026089 | Bacteria | 1753 |
| 420 | Ga0207676_10004584 | 3300026095 | Bacteria | 9790 |
| 421 | Ga0207676_10090207 | 3300026095 | Bacteria | 2514 |
| 422 | Ga0207676_10126273 | 3300026095 | Bacteria | 2167 |
| 423 | Ga0207676_10401792 | 3300026095 | Unclassified | 1280 |
| 424 | Ga0207676_10493374 | 3300026095 | Bacteria | 1162 |
| 425 | Ga0207674_10002461 | 3300026116 | Bacteria | 23376 |
| 426 | Ga0207674_10026113 | 3300026116 | Bacteria | 6213 |
| 427 | Ga0207674_10384796 | 3300026116 | Unclassified | 1356 |
| 428 | Ga0207674_10472990 | 3300026116 | Bacteria | 1211 |
| 429 | Ga0207675_100012549 | 3300026118 | Bacteria | 7916 |
| 430 | Ga0207675_100038466 | 3300026118 | Bacteria | 4465 |
| 431 | Ga0207675_100077645 | 3300026118 | Unclassified | 3111 |
| 432 | Ga0207675_100085384 | 3300026118 | Bacteria | 2962 |
| 433 | Ga0207675_100104151 | 3300026118 | Bacteria | 2674 |
| 434 | Ga0207675_100679864 | 3300026118 | Unclassified | 1037 |
| 435 | Ga0207675_100742669 | 3300026118 | Unclassified | 992 |
| 436 | Ga0207683_10056753 | 3300026121 | Unclassified | 3436 |
| 437 | Ga0207683_10259203 | 3300026121 | Unclassified | 1588 |
| 438 | Ga0207698_10293758 | 3300026142 | Bacteria | 1509 |
| 439 | Ga0207428_10092335 | 3300027907 | Bacteria | 2349 |
| 440 | Ga0268266_10069122 | 3300028379 | Bacteria | 3060 |
| 441 | Ga0268266_10442923 | 3300028379 | Bacteria | 1234 |
| 442 | Ga0268265_10022851 | 3300028380 | Bacteria | 4401 |
| 443 | Ga0268265_10060840 | 3300028380 | Bacteria | 2896 |
| 444 | Ga0268264_10219441 | 3300028381 | Bacteria | 1750 |
| 445 | Ga0268264_10340786 | 3300028381 | Unclassified | 1424 |
| 446 | Ga0268264_10485634 | 3300028381 | Bacteria | 1202 |
| 447 | Ga0307513_10592409 | 3300031456 | Unclassified | 818 |
| 448 | Ga0307408_100042333 | 3300031548 | Bacteria | 3234 |
| 449 | Ga0307408_100152860 | 3300031548 | Bacteria | 1824 |
| 450 | Ga0307408_100312249 | 3300031548 | Unclassified | 1321 |
| 451 | Ga0307405_10051978 | 3300031731 | Unclassified | 2545 |
| 452 | Ga0307405_10328298 | 3300031731 | Unclassified | 1171 |
| 453 | Ga0307413_10408375 | 3300031824 | Bacteria | 1066 |
| 454 | Ga0307413_10878909 | 3300031824 | Unclassified | 760 |
| 455 | Ga0307406_10351847 | 3300031901 | Unclassified | 1151 |
| 456 | Ga0307406_10374840 | 3300031901 | Unclassified | 1120 |
| 457 | Ga0307407_10032736 | 3300031903 | Bacteria | 2830 |
| 458 | Ga0307407_10732548 | 3300031903 | Unclassified | 747 |
| 459 | Ga0307412_10157335 | 3300031911 | Unclassified | 1684 |
| 460 | Ga0307416_100066197 | 3300032002 | Bacteria | 2974 |
| 461 | Ga0307416_100092718 | 3300032002 | Bacteria | 2599 |
| 462 | Ga0307416_100316348 | 3300032002 | Unclassified | 1560 |
| 463 | Ga0307411_10009995 | 3300032005 | Bacteria | 5028 |
| 464 | Ga0307415_100123944 | 3300032126 | Unclassified | 1943 |
| 465 | Ga0307415_100143019 | 3300032126 | Bacteria | 1830 |
| 466 | Ga0373938_0081715 | 3300034957 | Unclassified | 788 |
| 467 | Ga0373940_0071669 | 3300035088 | Unclassified | 1010 |
| 468 | Ga0373949_0014785 | 3300035090 | Unclassified | 1740 |
| 469 | Ga0373951_0004187 | 3300035091 | Bacteria | 3440 |
| 470 | Ga0373942_0140062 | 3300035207 | Unclassified | 769 |
| 471 | Ga0373931_0027389 | 3300035691 | Bacteria | 2910 |
| 472 | Ga0373931_0335888 | 3300035691 | Unclassified | 942 |
| 473 | Ga0395900_0772725 | 3300037418 | Unclassified | 890 |
| 474 | Ga0395898_0261763 | 3300037466 | Unclassified | 1650 |
| 475 | Ga0395901_0132074 | 3300038443 | Unclassified | 2624 |
| 476 | Ga0439439_0042875 | 3300041406 | Bacteria | 1176 |
| 477 | Ga0439448_0064469 | 3300042005 | Bacteria | 1214 |
| 478 | Ga0439455_0105782 | 3300042012 | Unclassified | 780 |
| 479 | Ga0439458_0001673 | 3300042157 | Bacteria | 5538 |
| 480 | Ga0439464_0041620 | 3300042439 | Bacteria | 1310 |
| 481 | Ga0453683_0264275 | 3300044673 | Bacteria | 1098 |
| 482 | Ga0495580_0488143 | 3300046472 | Bacteria | 823 |
| 483 | Ga0495582_0429987 | 3300046473 | Bacteria | 762 |
| 484 | Ga0495658_0093535 | 3300046683 | Bacteria | 1784 |
| 485 | Ga0495636_0083145 | 3300047318 | Unclassified | 1381 |
| 486 | Ga0496102_0093217 | 3300048905 | Bacteria | 2790 |
| 487 | Ga0496103_0141208 | 3300048906 | Bacteria | 1540 |
| 488 | Ga0496104_0059278 | 3300048907 | Bacteria | 3624 |
| 489 | Ga0496104_0238477 | 3300048907 | Bacteria | 1730 |
| 490 | Ga0496108_0306455 | 3300048911 | Bacteria | 1384 |
| 491 | Ga0496109_0498098 | 3300048912 | Bacteria | 1150 |
| 492 | Ga0496112_0494492 | 3300048915 | Bacteria | 1159 |
| 493 | Ga0496112_0603044 | 3300048915 | Bacteria | 1030 |
| 494 | Ga0496113_0024552 | 3300048916 | Bacteria | 4286 |
| 495 | Ga0501291_002420 | 3300049514 | Bacteria | 2232 |
| 496 | Ga0501291_012471 | 3300049514 | Unclassified | 1242 |
| 497 | Ga0501292_008045 | 3300049515 | Unclassified | 1533 |
| 498 | Ga0501292_017095 | 3300049515 | Bacteria | 1144 |
| 499 | Ga0501295_018317 | 3300049518 | Bacteria | 1242 |
| 500 | Ga0501298_001233 | 3300049521 | Unclassified | 3731 |
| 501 | Ga0501298_003990 | 3300049521 | Bacteria | 2305 |
| 502 | Ga0501301_002098 | 3300049524 | Bacteria | 1298 |
| 503 | Ga0501038_0006459 | 3300049574 | Bacteria | 10855 |
| 504 | Ga0501077_0137184 | 3300049593 | Bacteria | 1551 |
| 505 | Ga0501201_007298 | 3300049651 | Unclassified | 1056 |
| 506 | Ga0501202_005490 | 3300049652 | Bacteria | 2247 |
| 507 | Ga0501202_022684 | 3300049652 | Unclassified | 1262 |
| 508 | Ga0501207_000093 | 3300049654 | Bacteria | 7264 |
| 509 | Ga0501207_017508 | 3300049654 | Unclassified | 1119 |
| 510 | Ga0501216_003145 | 3300049660 | Bacteria | 2390 |
| 511 | Ga0501216_005618 | 3300049660 | Bacteria | 1898 |
| 512 | Ga0501217_001064 | 3300049661 | Bacteria | 4996 |
| 513 | Ga0501217_002367 | 3300049661 | Unclassified | 3703 |
| 514 | Ga0501217_002649 | 3300049661 | Unclassified | 3546 |
| 515 | Ga0501217_004685 | 3300049661 | Bacteria | 2820 |
| 516 | Ga0501217_038247 | 3300049661 | Bacteria | 1211 |
| 517 | Ga0501223_033561 | 3300049663 | Bacteria | 998 |
| 518 | Ga0501224_006576 | 3300049664 | Unclassified | 1685 |
| 519 | Ga0501227_014085 | 3300049665 | Bacteria | 1770 |
| 520 | Ga0501233_001810 | 3300049668 | Unclassified | 3705 |
| 521 | Ga0501233_003519 | 3300049668 | Bacteria | 2820 |
| 522 | Ga0501235_004372 | 3300049669 | Bacteria | 3058 |
| 523 | Ga0501235_009065 | 3300049669 | Unclassified | 2173 |
| 524 | Ga0501235_009322 | 3300049669 | Bacteria | 2146 |
| 525 | Ga0501235_009732 | 3300049669 | Bacteria | 2102 |
| 526 | Ga0501235_040236 | 3300049669 | Bacteria | 1068 |
| 527 | Ga0501242_038872 | 3300049674 | Unclassified | 667 |
| 528 | Ga0501246_004999 | 3300049676 | Unclassified | 1105 |
| 529 | Ga0501249_072263 | 3300049679 | Unclassified | 806 |
| 530 | Ga0501253_001978 | 3300049683 | Unclassified | 2221 |
| 531 | Ga0501253_015213 | 3300049683 | Unclassified | 1260 |
| 532 | Ga0501257_092539 | 3300049686 | Unclassified | 787 |
| 533 | Ga0501261_003767 | 3300049690 | Unclassified | 1862 |
| 534 | Ga0501221_002240 | 3300049704 | Bacteria | 3214 |
| 535 | Ga0501221_043227 | 3300049704 | Unclassified | 990 |
| 536 | Ga0501225_0005132 | 3300049705 | Bacteria | 3856 |
| 537 | Ga0501225_0023797 | 3300049705 | Bacteria | 1687 |
| 538 | Ga0501234_002135 | 3300049707 | Unclassified | 3122 |
| 539 | Ga0501234_008646 | 3300049707 | Unclassified | 1586 |
| 540 | Ga0501234_019150 | 3300049707 | Bacteria | 1084 |
| 541 | Ga0501234_020400 | 3300049707 | Unclassified | 1054 |
| 542 | Ga0501234_031453 | 3300049707 | Bacteria | 858 |
| 543 | Ga0501079_0784726 | 3300049741 | Unclassified | 750 |
| 544 | Ga0501241_022038 | 3300049758 | Unclassified | 1175 |
| 545 | Ga0501265_022726 | 3300049762 | Unclassified | 858 |
| 546 | Ga0501270_010652 | 3300049767 | Unclassified | 1216 |
| 547 | Ga0501271_009207 | 3300049768 | Bacteria | 1025 |
| 548 | Ga0501274_007750 | 3300049771 | Unclassified | 951 |
| 549 | Ga0501283_001190 | 3300049779 | Bacteria | 3432 |
| 550 | Ga0501283_004889 | 3300049779 | Unclassified | 1825 |
| 551 | Ga0501204_043081 | 3300049850 | Unclassified | 668 |
| 552 | Ga0501212_000274 | 3300049851 | Unclassified | 4675 |
| 553 | Ga0501212_024579 | 3300049851 | Unclassified | 948 |
| 554 | Ga0501226_002639 | 3300049853 | Bacteria | 2174 |
| 555 | nmdc:mga05p37_11524_c2 | 3300050507 | Bacteria | 7641 |
| 556 | nmdc:mga05p37_268305_c1 | 3300050507 | Bacteria | 2040 |
| 557 | nmdc:mga05p37_579652_c1 | 3300050507 | Bacteria | 1271 |
| 558 | nmdc:mga05p37_72832_c1 | 3300050507 | Bacteria | 4228 |
| 559 | nmdc:mga05p37_76268_c1 | 3300050507 | Bacteria | 4127 |
| 560 | nmdc:mga06r32_1006642_c1 | 3300050510 | Unclassified | 786 |
| 561 | nmdc:mga08y16_331323_c1 | 3300050511 | Bacteria | 1566 |
| 562 | nmdc:mga08y16_90887_c1 | 3300050511 | Bacteria | 3182 |
| 563 | nmdc:mga0n895_105117_c1 | 3300050512 | Unclassified | 2836 |
| 564 | nmdc:mga0a205_10241_c1 | 3300050515 | Bacteria | 8613 |
| 565 | nmdc:mga0a205_468082_c1 | 3300050515 | Bacteria | 1119 |
| 566 | nmdc:mga0a205_638994_c1 | 3300050515 | Bacteria | 916 |
| 567 | nmdc:mga0a205_838487_c1 | 3300050515 | Unclassified | 767 |
| 568 | Ga0105242_11165914 | |||
| 569 | CNBas_1001055 | |||
| 570 | CNAas_1000181 | |||
| 571 | JGI25406J46586_10008456 | |||
| 572 | rootL2_10079104 | |||
| 573 | Ga0065704_10012739 | |||
| 574 | Ga0065704_10104920 | |||
| 575 | Ga0065712_10000119 | |||
| 576 | Ga0065712_10001378 | |||
| 577 | Ga0065712_10006111 | |||
| 578 | Ga0065715_10006815 | |||
| 579 | Ga0065715_10089430 | |||
| 580 | Ga0065715_10091808 | |||
| 581 | Ga0065715_10093519 | |||
| 582 | Ga0065715_10105306 | |||
| 583 | Ga0065715_10126025 | |||
| 584 | Ga0065715_10213778 | |||
| 585 | Ga0065707_10001424 | |||
| 586 | Ga0065707_10139895 | |||
| 587 | Ga0065707_10170709 | |||
| 588 | Ga0070676_10072450 | |||
| 589 | Ga0070676_10393074 | |||
| 590 | Ga0070690_100000815 | |||
| 591 | Ga0070690_100011683 | |||
| 592 | Ga0070690_100072473 | |||
| 593 | Ga0070670_100046535 | |||
| 594 | Ga0068869_100006679 | |||
| 595 | Ga0068869_100013648 | |||
| 596 | Ga0070666_10088657 | |||
| 597 | Ga0070680_100026646 | |||
| 598 | Ga0070680_100097026 | |||
| 599 | Ga0068868_100012859 | |||
| 600 | Ga0068868_100055738 | |||
| 601 | Ga0068868_100059251 | |||
| 602 | Ga0070660_100062135 | |||
| 603 | Ga0070689_100000332 | |||
| 604 | Ga0070691_10119564 | |||
| 605 | Ga0070687_100014055 | |||
| 606 | Ga0070692_10020296 | |||
| 607 | Ga0070692_10093066 | |||
| 608 | Ga0070692_10181273 | |||
| 609 | Ga0070692_10464251 | |||
| 610 | Ga0070669_100006887 | |||
| 611 | Ga0070669_100016941 | |||
| 612 | Ga0070675_100057812 | |||
| 613 | Ga0070671_100002480 | |||
| 614 | Ga0070671_100018059 | |||
| 615 | Ga0070674_100845730 | |||
| 616 | Ga0070673_100009775 | |||
| 617 | Ga0070673_100096745 | |||
| 618 | Ga0070673_100261381 | |||
| 619 | Ga0070673_100789792 | |||
| 620 | Ga0070688_100033707 | |||
| 621 | Ga0070659_100002213 | |||
| 622 | Ga0070659_100185611 | |||
| 623 | Ga0070667_100025175 | |||
| 624 | Ga0070667_100086409 | |||
| 625 | Ga0070703_10006075 | |||
| 626 | Ga0070701_10007656 | |||
| 627 | Ga0070701_10016745 | |||
| 628 | Ga0070701_10107090 | |||
| 629 | Ga0070701_10260055 | |||
| 630 | Ga0070701_10283339 | |||
| 631 | Ga0070701_10359040 | |||
| 632 | Ga0070705_100012488 | |||
| 633 | Ga0070700_100000599 | |||
| 634 | Ga0070700_100002970 | |||
| 635 | Ga0070700_100018171 | |||
| 636 | Ga0070700_100270682 | |||
| 637 | Ga0070694_100012167 | |||
| 638 | Ga0070694_100024293 | |||
| 639 | Ga0070694_100035183 | |||
| 640 | Ga0070694_100037621 | |||
| 641 | Ga0070694_100053687 | |||
| 642 | Ga0070694_100110501 | |||
| 643 | Ga0070694_100158590 | |||
| 644 | Ga0070694_100171683 | |||
| 645 | Ga0070708_100000893 | |||
| 646 | Ga0070708_100365781 | |||
| 647 | Ga0070662_100094692 | |||
| 648 | Ga0070662_100292436 | |||
| 649 | Ga0070662_100747382 | |||
| 650 | Ga0070681_10000489 | |||
| 651 | Ga0070681_10023649 | |||
| 652 | Ga0070681_10036842 | |||
| 653 | Ga0070681_10473753 | |||
| 654 | Ga0068867_100014729 | |||
| 655 | Ga0068867_100996015 | |||
| 656 | Ga0070685_10009550 | |||
| 657 | Ga0070685_10671258 | |||
| 658 | Ga0070706_100004529 | |||
| 659 | Ga0070706_100075032 | |||
| 660 | Ga0070706_100084605 | |||
| 661 | Ga0070707_100007041 | |||
| 662 | Ga0070698_100003700 | |||
| 663 | Ga0070698_100015281 | |||
| 664 | Ga0070698_100259343 | |||
| 665 | Ga0070699_100003184 | |||
| 666 | Ga0070699_100039893 | |||
| 667 | Ga0070699_100224364 | |||
| 668 | Ga0070699_100229251 | |||
| 669 | Ga0070699_100614721 | |||
| 670 | Ga0070699_100729211 | |||
| 671 | Ga0070679_100000604 | |||
| 672 | Ga0070679_100002464 | |||
| 673 | Ga0070697_100002853 | |||
| 674 | Ga0070697_100011788 | |||
| 675 | Ga0070697_100056905 | |||
| 676 | Ga0070697_100063694 | |||
| 677 | Ga0068853_100084677 | |||
| 678 | Ga0068853_100158832 | |||
| 679 | Ga0070672_100149979 | |||
| 680 | Ga0070672_100800381 | |||
| 681 | Ga0070686_100001026 | |||
| 682 | Ga0070686_100014776 | |||
| 683 | Ga0070695_100042646 | |||
| 684 | Ga0070695_100090337 | |||
| 685 | Ga0070695_100333631 | |||
| 686 | Ga0070695_100574933 | |||
| 687 | Ga0070696_100011471 | |||
| 688 | Ga0070696_100021570 | |||
| 689 | Ga0070696_100061302 | |||
| 690 | Ga0070696_100123566 | |||
| 691 | Ga0070696_100180734 | |||
| 692 | Ga0070696_100310546 | |||
| 693 | Ga0070693_100000939 | |||
| 694 | Ga0070693_100009613 | |||
| 695 | Ga0070693_100051343 | |||
| 696 | Ga0070693_100452124 | |||
| 697 | Ga0070665_100049616 | |||
| 698 | Ga0070665_100464336 | |||
| 699 | Ga0070704_100007286 | |||
| 700 | Ga0070704_100031246 | |||
| 701 | Ga0070704_100056971 | |||
| 702 | Ga0070704_100183445 | |||
| 703 | Ga0070704_100223544 | |||
| 704 | Ga0070664_100006025 | |||
| 705 | Ga0068857_100003448 | |||
| 706 | Ga0068854_100017914 | |||
| 707 | Ga0068854_100098095 | |||
| 708 | Ga0068854_100112996 | |||
| 709 | Ga0068854_100312003 | |||
| 710 | Ga0068856_100140122 | |||
| 711 | Ga0070702_100011505 | |||
| 712 | Ga0070702_100045914 | |||
| 713 | Ga0070702_100054736 | |||
| 714 | Ga0070702_100674727 | |||
| 715 | Ga0068852_100036764 | |||
| 716 | Ga0068852_100059883 | |||
| 717 | Ga0068859_100022691 | |||
| 718 | Ga0068859_100023895 | |||
| 719 | Ga0068859_100032365 | |||
| 720 | Ga0068859_100086047 | |||
| 721 | Ga0068859_100087977 | |||
| 722 | Ga0068859_100095936 | |||
| 723 | Ga0068859_100136947 | |||
| 724 | Ga0068859_100168398 | |||
| 725 | Ga0068859_100212184 | |||
| 726 | Ga0068859_100220117 | |||
| 727 | Ga0068859_100242736 | |||
| 728 | Ga0068859_100260873 | |||
| 729 | Ga0068859_100744048 | |||
| 730 | Ga0068864_100001530 | |||
| 731 | Ga0068864_100022149 | |||
| 732 | Ga0068864_100133936 | |||
| 733 | Ga0068864_100148639 | |||
| 734 | Ga0068864_100282137 | |||
| 735 | Ga0068864_100368629 | |||
| 736 | Ga0068864_101195686 | |||
| 737 | Ga0068866_10012456 | |||
| 738 | Ga0068866_10016431 | |||
| 739 | Ga0068861_100002479 | |||
| 740 | Ga0068861_100015170 | |||
| 741 | Ga0068861_100064328 | |||
| 742 | Ga0068861_100090638 | |||
| 743 | Ga0068861_100574003 | |||
| 744 | Ga0068851_10000602 | |||
| 745 | Ga0068870_10005617 | |||
| 746 | Ga0068870_10012218 | |||
| 747 | Ga0068870_10141602 | |||
| 748 | Ga0068863_100039560 | |||
| 749 | Ga0068863_100102348 | |||
| 750 | Ga0068858_100018216 | |||
| 751 | Ga0068858_100063191 | |||
| 752 | Ga0068858_100065198 | |||
| 753 | Ga0068858_100180580 | |||
| 754 | Ga0068858_100264220 | |||
| 755 | Ga0068858_100316135 | |||
| 756 | Ga0068860_100014889 | |||
| 757 | Ga0068860_100056661 | |||
| 758 | Ga0068860_100090477 | |||
| 759 | Ga0068860_100192851 | |||
| 760 | Ga0068860_100327698 | |||
| 761 | Ga0068860_100340314 | |||
| 762 | Ga0068860_100518085 | |||
| 763 | Ga0068860_100575214 | |||
| 764 | Ga0068862_100002424 | |||
| 765 | Ga0068862_100428767 | |||
| 766 | Ga0081539_10000043 | |||
| 767 | Ga0081539_10205041 | |||
| 768 | Ga0097621_100000998 | |||
| 769 | Ga0097621_100059911 | |||
| 770 | Ga0097621_100284425 | |||
| 771 | Ga0068871_100011234 | |||
| 772 | Ga0068871_100016501 | |||
| 773 | Ga0075428_100122412 | |||
| 774 | Ga0075428_100224857 | |||
| 775 | Ga0075433_10028824 | |||
| 776 | Ga0075433_10395491 | |||
| 777 | Ga0075433_10427128 | |||
| 778 | Ga0075434_100064748 | |||
| 779 | Ga0075434_100165629 | |||
| 780 | Ga0075434_100207408 | |||
| 781 | Ga0068865_100013756 | |||
| 782 | Ga0068865_100055199 | |||
| 783 | Ga0068865_100086504 | |||
| 784 | Ga0097620_100022692 | |||
| 785 | Ga0097620_100023895 | |||
| 786 | Ga0097620_100032365 | |||
| 787 | Ga0097620_100056714 | |||
| 788 | Ga0097620_100086056 | |||
| 789 | Ga0097620_100087973 | |||
| 790 | Ga0097620_100095940 | |||
| 791 | Ga0097620_100136936 | |||
| 792 | Ga0097620_100168404 | |||
| 793 | Ga0097620_100212177 | |||
| 794 | Ga0097620_100220110 | |||
| 795 | Ga0097620_100242724 | |||
| 796 | Ga0097620_100260883 | |||
| 797 | Ga0097620_100744025 | |||
| 798 | Ga0075435_100221459 | |||
| 799 | Ga0075435_100428543 | |||
| 800 | Ga0099794_10046319 | |||
| 801 | Ga0105240_10037067 | |||
| 802 | Ga0111539_10117315 | |||
| 803 | Ga0111539_10649599 | |||
| 804 | Ga0105245_10012480 | |||
| 805 | Ga0105245_10411729 | |||
| 806 | Ga0105245_10933738 | |||
| 807 | Ga0105247_10001416 | |||
| 808 | Ga0105247_10052943 | |||
| 809 | Ga0114129_10002712 | |||
| 810 | Ga0114129_10019782 | |||
| 811 | Ga0114129_10101911 | |||
| 812 | Ga0114129_10170208 | |||
| 813 | Ga0114129_10306882 | |||
| 814 | Ga0105243_10027561 | |||
| 815 | Ga0105243_10086254 | |||
| 816 | Ga0105243_10479963 | |||
| 817 | Ga0105243_10586167 | |||
| 818 | Ga0105241_10160595 | |||
| 819 | Ga0105241_10532648 | |||
| 820 | Ga0105241_11144838 | |||
| 821 | Ga0105242_10005503 | |||
| 822 | Ga0105248_10011583 | |||
| 823 | Ga0105248_10017988 | |||
| 824 | Ga0105248_10039136 | |||
| 825 | Ga0105248_10045072 | |||
| 826 | Ga0105248_10078569 | |||
| 827 | Ga0105248_10112798 | |||
| 828 | Ga0105248_10650518 | |||
| 829 | Ga0105248_10971173 | |||
| 830 | Ga0105237_10100798 | |||
| 831 | Ga0105237_10150370 | |||
| 832 | Ga0105237_11204191 | |||
| 833 | Ga0105238_11328017 | |||
| 834 | Ga0105249_10031120 | |||
| 835 | Ga0105249_10060173 | |||
| 836 | Ga0105249_10109747 | |||
| 837 | Ga0105249_10242496 | |||
| 838 | Ga0105249_11540352 | |||
| 839 | Ga0105239_10048726 | |||
| 840 | Ga0105239_10110007 | |||
| 841 | Ga0105239_10183383 | |||
| 842 | Ga0105239_11128419 | |||
| 843 | Ga0105246_10058497 | |||
| 844 | Ga0105246_10099501 | |||
| 845 | Ga0105246_10286733 | |||
| 846 | Ga0157373_10007433 | |||
| 847 | Ga0157373_10123199 | |||
| 848 | Ga0157373_10235369 | |||
| 849 | Ga0157371_10375688 | |||
| 850 | Ga0157374_10032252 | |||
| 851 | Ga0157374_10070139 | |||
| 852 | Ga0157374_10202752 | |||
| 853 | Ga0157378_10015635 | |||
| 854 | Ga0157378_10028650 | |||
| 855 | Ga0157378_10060862 | |||
| 856 | Ga0157378_10604757 | |||
| 857 | Ga0157378_10612560 | |||
| 858 | Ga0163162_10004771 | |||
| 859 | Ga0163162_10016965 | |||
| 860 | Ga0163162_10078587 | |||
| 861 | Ga0163162_10105054 | |||
| 862 | Ga0163162_10278918 | |||
| 863 | Ga0163162_10408939 | |||
| 864 | Ga0157372_10005906 | |||
| 865 | Ga0157372_10080278 | |||
| 866 | Ga0157372_10623425 | |||
| 867 | Ga0157375_10024635 | |||
| 868 | Ga0157375_10050515 | |||
| 869 | Ga0157375_10052347 | |||
| 870 | Ga0157375_10156589 | |||
| 871 | Ga0157375_11419903 | |||
| 872 | Ga0163163_10001052 | |||
| 873 | Ga0163163_10015350 | |||
| 874 | Ga0163163_10049992 | |||
| 875 | Ga0163163_10066860 | |||
| 876 | Ga0163163_10073975 | |||
| 877 | Ga0163163_10172003 | |||
| 878 | Ga0163163_10641481 | |||
| 879 | Ga0157380_10002253 | |||
| 880 | Ga0157380_10007050 | |||
| 881 | Ga0157380_10011829 | |||
| 882 | Ga0157380_10020643 | |||
| 883 | Ga0157380_10473440 | |||
| 884 | Ga0157377_10003928 | |||
| 885 | Ga0157377_10043192 | |||
| 886 | Ga0157377_10391261 | |||
| 887 | Ga0157379_10025308 | |||
| 888 | Ga0157379_10056961 | |||
| 889 | Ga0163161_10005643 | |||
| 890 | Ga0207666_1016672 | |||
| 891 | Ga0207656_10001847 | |||
| 892 | Ga0207653_10004283 | |||
| 893 | Ga0207642_10006111 | |||
| 894 | Ga0207710_10000788 | |||
| 895 | Ga0207680_10081764 | |||
| 896 | Ga0207680_10187388 | |||
| 897 | Ga0207645_10387718 | |||
| 898 | Ga0207643_10006201 | |||
| 899 | Ga0207643_10013123 | |||
| 900 | Ga0207684_10000131 | |||
| 901 | Ga0207684_10008833 | |||
| 902 | Ga0207684_10125223 | |||
| 903 | Ga0207707_10000017 | |||
| 904 | Ga0207707_10046816 | |||
| 905 | Ga0207707_10057384 | |||
| 906 | Ga0207707_10332701 | |||
| 907 | Ga0207671_10157935 | |||
| 908 | Ga0207660_10020366 | |||
| 909 | Ga0207660_10050214 | |||
| 910 | Ga0207657_10146456 | |||
| 911 | Ga0207652_10000335 | |||
| 912 | Ga0207652_10064169 | |||
| 913 | Ga0207646_10286162 | |||
| 914 | Ga0207646_10373158 | |||
| 915 | Ga0207681_10007936 | |||
| 916 | Ga0207681_10593001 | |||
| 917 | Ga0207650_10047011 | |||
| 918 | Ga0207650_10118157 | |||
| 919 | Ga0207650_10165255 | |||
| 920 | Ga0207659_10040185 | |||
| 921 | Ga0207687_10032307 | |||
| 922 | Ga0207687_10163734 | |||
| 923 | Ga0207644_10011989 | |||
| 924 | Ga0207644_10352174 | |||
| 925 | Ga0207644_10578312 | |||
| 926 | Ga0207690_10036931 | |||
| 927 | Ga0207690_10056970 | |||
| 928 | Ga0207706_10096462 | |||
| 929 | Ga0207706_10112332 | |||
| 930 | Ga0207706_10155909 | |||
| 931 | Ga0207686_10114315 | |||
| 932 | Ga0207686_10202988 | |||
| 933 | Ga0207709_10214799 | |||
| 934 | Ga0207709_10380640 | |||
| 935 | Ga0207709_10810290 | |||
| 936 | Ga0207670_10000242 | |||
| 937 | Ga0207670_10101751 | |||
| 938 | Ga0207669_10097300 | |||
| 939 | Ga0207704_10011998 | |||
| 940 | Ga0207704_10066261 | |||
| 941 | Ga0207691_10002280 | |||
| 942 | Ga0207691_10175902 | |||
| 943 | Ga0207691_10680672 | |||
| 944 | Ga0207711_10027943 | |||
| 945 | Ga0207711_10059483 | |||
| 946 | Ga0207711_10134031 | |||
| 947 | Ga0207711_10162068 | |||
| 948 | Ga0207711_10197499 | |||
| 949 | Ga0207711_10747699 | |||
| 950 | Ga0207689_10004373 | |||
| 951 | Ga0207689_10046282 | |||
| 952 | Ga0207689_10048254 | |||
| 953 | Ga0207689_10131085 | |||
| 954 | Ga0207689_10207081 | |||
| 955 | Ga0207679_10022666 | |||
| 956 | Ga0207679_10068238 | |||
| 957 | Ga0207651_10187267 | |||
| 958 | Ga0207651_10316981 | |||
| 959 | Ga0207651_10326107 | |||
| 960 | Ga0207712_10977828 | |||
| 961 | Ga0207640_10111947 | |||
| 962 | Ga0207640_10190557 | |||
| 963 | Ga0207640_10418454 | |||
| 964 | Ga0207658_10052637 | |||
| 965 | Ga0207677_10008663 | |||
| 966 | Ga0207677_10154424 | |||
| 967 | Ga0207677_10157679 | |||
| 968 | Ga0207703_10024298 | |||
| 969 | Ga0207703_10179296 | |||
| 970 | Ga0207703_10215137 | |||
| 971 | Ga0207703_10287752 | |||
| 972 | Ga0207703_10450497 | |||
| 973 | Ga0207639_10064559 | |||
| 974 | Ga0207639_10343924 | |||
| 975 | Ga0207708_10000101 | |||
| 976 | Ga0207708_10005440 | |||
| 977 | Ga0207708_10221414 | |||
| 978 | Ga0207708_10299502 | |||
| 979 | Ga0207702_10019552 | |||
| 980 | Ga0207641_10145895 | |||
| 981 | Ga0207641_10167139 | |||
| 982 | Ga0207641_10218975 | |||
| 983 | Ga0207641_11046108 | |||
| 984 | Ga0207648_10004088 | |||
| 985 | Ga0207648_10050077 | |||
| 986 | Ga0207648_10204192 | |||
| 987 | Ga0207676_10004584 | |||
| 988 | Ga0207676_10090207 | |||
| 989 | Ga0207676_10126273 | |||
| 990 | Ga0207676_10401792 | |||
| 991 | Ga0207676_10493374 | |||
| 992 | Ga0207674_10002461 | |||
| 993 | Ga0207674_10026113 | |||
| 994 | Ga0207674_10384796 | |||
| 995 | Ga0207674_10472990 | |||
| 996 | Ga0207675_100012549 | |||
| 997 | Ga0207675_100038466 | |||
| 998 | Ga0207675_100077645 | |||
| 999 | Ga0207675_100085384 | |||
| 1000 | Ga0207675_100104151 | |||
| 1001 | Ga0207675_100679864 | |||
| 1002 | Ga0207675_100742669 | |||
| 1003 | Ga0207683_10056753 | |||
| 1004 | Ga0207683_10259203 | |||
| 1005 | Ga0207698_10293758 | |||
| 1006 | Ga0207428_10092335 | |||
| 1007 | Ga0268266_10069122 | |||
| 1008 | Ga0268266_10442923 | |||
| 1009 | Ga0268265_10022851 | |||
| 1010 | Ga0268265_10060840 | |||
| 1011 | Ga0268264_10219441 | |||
| 1012 | Ga0268264_10340786 | |||
| 1013 | Ga0268264_10485634 | |||
| 1014 | Ga0307513_10592409 | |||
| 1015 | Ga0307408_100042333 | |||
| 1016 | Ga0307408_100152860 | |||
| 1017 | Ga0307408_100312249 | |||
| 1018 | Ga0307405_10051978 | |||
| 1019 | Ga0307405_10328298 | |||
| 1020 | Ga0307413_10408375 | |||
| 1021 | Ga0307413_10878909 | |||
| 1022 | Ga0307406_10351847 | |||
| 1023 | Ga0307406_10374840 | |||
| 1024 | Ga0307407_10032736 | |||
| 1025 | Ga0307407_10732548 | |||
| 1026 | Ga0307412_10157335 | |||
| 1027 | Ga0307416_100066197 | |||
| 1028 | Ga0307416_100092718 | |||
| 1029 | Ga0307416_100316348 | |||
| 1030 | Ga0307411_10009995 | |||
| 1031 | Ga0307415_100123944 | |||
| 1032 | Ga0307415_100143019 | |||
| 1033 | Ga0373938_0081715 | |||
| 1034 | Ga0373940_0071669 | |||
| 1035 | Ga0373949_0014785 | |||
| 1036 | Ga0373951_0004187 | |||
| 1037 | Ga0373942_0140062 | |||
| 1038 | Ga0373931_0027389 | |||
| 1039 | Ga0373931_0335888 | |||
| 1040 | Ga0395900_0772725 | |||
| 1041 | Ga0395898_0261763 | |||
| 1042 | Ga0395901_0132074 | |||
| 1043 | Ga0439439_0042875 | |||
| 1044 | Ga0439448_0064469 | |||
| 1045 | Ga0439455_0105782 | |||
| 1046 | Ga0439458_0001673 | |||
| 1047 | Ga0439464_0041620 | |||
| 1048 | Ga0453683_0264275 | |||
| 1049 | Ga0495580_0488143 | |||
| 1050 | Ga0495582_0429987 | |||
| 1051 | Ga0495658_0093535 | |||
| 1052 | Ga0495636_0083145 | |||
| 1053 | Ga0496102_0093217 | |||
| 1054 | Ga0496103_0141208 | |||
| 1055 | Ga0496104_0059278 | |||
| 1056 | Ga0496104_0238477 | |||
| 1057 | Ga0496108_0306455 | |||
| 1058 | Ga0496109_0498098 | |||
| 1059 | Ga0496112_0494492 | |||
| 1060 | Ga0496112_0603044 | |||
| 1061 | Ga0496113_0024552 | |||
| 1062 | Ga0501291_002420 | |||
| 1063 | Ga0501291_012471 | |||
| 1064 | Ga0501292_008045 | |||
| 1065 | Ga0501292_017095 | |||
| 1066 | Ga0501295_018317 | |||
| 1067 | Ga0501298_001233 | |||
| 1068 | Ga0501298_003990 | |||
| 1069 | Ga0501301_002098 | |||
| 1070 | Ga0501038_0006459 | |||
| 1071 | Ga0501077_0137184 | |||
| 1072 | Ga0501201_007298 | |||
| 1073 | Ga0501202_005490 | |||
| 1074 | Ga0501202_022684 | |||
| 1075 | Ga0501207_000093 | |||
| 1076 | Ga0501207_017508 | |||
| 1077 | Ga0501216_003145 | |||
| 1078 | Ga0501216_005618 | |||
| 1079 | Ga0501217_001064 | |||
| 1080 | Ga0501217_002367 | |||
| 1081 | Ga0501217_002649 | |||
| 1082 | Ga0501217_004685 | |||
| 1083 | Ga0501217_038247 | |||
| 1084 | Ga0501223_033561 | |||
| 1085 | Ga0501224_006576 | |||
| 1086 | Ga0501227_014085 | |||
| 1087 | Ga0501233_001810 | |||
| 1088 | Ga0501233_003519 | |||
| 1089 | Ga0501235_004372 | |||
| 1090 | Ga0501235_009065 | |||
| 1091 | Ga0501235_009322 | |||
| 1092 | Ga0501235_009732 | |||
| 1093 | Ga0501235_040236 | |||
| 1094 | Ga0501242_038872 | |||
| 1095 | Ga0501246_004999 | |||
| 1096 | Ga0501249_072263 | |||
| 1097 | Ga0501253_001978 | |||
| 1098 | Ga0501253_015213 | |||
| 1099 | Ga0501257_092539 | |||
| 1100 | Ga0501261_003767 | |||
| 1101 | Ga0501221_002240 | |||
| 1102 | Ga0501221_043227 | |||
| 1103 | Ga0501225_0005132 | |||
| 1104 | Ga0501225_0023797 | |||
| 1105 | Ga0501234_002135 | |||
| 1106 | Ga0501234_008646 | |||
| 1107 | Ga0501234_019150 | |||
| 1108 | Ga0501234_020400 | |||
| 1109 | Ga0501234_031453 | |||
| 1110 | Ga0501079_0784726 | |||
| 1111 | Ga0501241_022038 | |||
| 1112 | Ga0501265_022726 | |||
| 1113 | Ga0501270_010652 | |||
| 1114 | Ga0501271_009207 | |||
| 1115 | Ga0501274_007750 | |||
| 1116 | Ga0501283_001190 | |||
| 1117 | Ga0501283_004889 | |||
| 1118 | Ga0501204_043081 | |||
| 1119 | Ga0501212_000274 | |||
| 1120 | Ga0501212_024579 | |||
| 1121 | Ga0501226_002639 | |||
| 1122 | nmdc:mga05p37_11524_c2 | |||
| 1123 | nmdc:mga05p37_268305_c1 | |||
| 1124 | nmdc:mga05p37_579652_c1 | |||
| 1125 | nmdc:mga05p37_72832_c1 | |||
| 1126 | nmdc:mga05p37_76268_c1 | |||
| 1127 | nmdc:mga06r32_1006642_c1 | |||
| 1128 | nmdc:mga08y16_331323_c1 | |||
| 1129 | nmdc:mga08y16_90887_c1 | |||
| 1130 | nmdc:mga0n895_105117_c1 | |||
| 1131 | nmdc:mga0a205_10241_c1 | |||
| 1132 | nmdc:mga0a205_468082_c1 | |||
| 1133 | nmdc:mga0a205_638994_c1 | |||
| 1134 | nmdc:mga0a205_838487_c1 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy