F464503

General Info

Members Datasets Scaffolds Average Seq Length
567 256 1134 143

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10648268|Ga0111539_106482682
Length 168
Sequence MTPNQVFSIANGLALVAWLLLIVLPRQRWVTGVLAPVAMPSVFAAIYVAIIATQWKGSTGGFSSLPDVATLFSQPWLLLAGWVHYLAFDLIIGSWEVRDARERGIPHIAVVPCLALTFMFGPAGWLAYSGLRTAYARRTRHGQRLLWPVRVEQGPDRGAWRPVARRDD

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
190 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
193 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.35
Nodule 0
Rhizoplane 3
Rhizosphere 88.71
Stem 0
Stem Tuber 0
Unclassified 25.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10648268 3300009094 Bacteria 1230
2 Ga0065704_10179055 3300005289 Unclassified 1247
3 Ga0065712_10070437 3300005290 Bacteria 6007
4 Ga0065715_10594048 3300005293 Bacteria 712
5 Ga0065707_10136551 3300005295 Unclassified 1833
6 Ga0065707_10428879 3300005295 Unclassified 820
7 Ga0070676_10221368 3300005328 Bacteria 1250
8 Ga0070690_100003925 3300005330 Bacteria 8204
9 Ga0070690_100411569 3300005330 Bacteria 995
10 Ga0070690_100622964 3300005330 Unclassified 821
11 Ga0070677_10213297 3300005333 Bacteria 939
12 Ga0068869_100025385 3300005334 Bacteria 4114
13 Ga0068869_100281748 3300005334 Bacteria 1337
14 Ga0068869_101004667 3300005334 Bacteria 726
15 Ga0068869_101062450 3300005334 Bacteria 707
16 Ga0070666_10003003 3300005335 Bacteria 10228
17 Ga0070666_10175334 3300005335 Bacteria 1503
18 Ga0070680_100490073 3300005336 Bacteria 1051
19 Ga0068868_100451122 3300005338 Bacteria 1119
20 Ga0068868_100806011 3300005338 Bacteria 848
21 Ga0070689_100557807 3300005340 Bacteria 988
22 Ga0070689_100655041 3300005340 Bacteria 914
23 Ga0070691_10340579 3300005341 Bacteria 830
24 Ga0070687_100026011 3300005343 Bacteria 2813
25 Ga0070687_100320164 3300005343 Bacteria 990
26 Ga0070687_100507852 3300005343 Unclassified 813
27 Ga0070687_101385269 3300005343 Bacteria 525
28 Ga0070661_100201726 3300005344 Unclassified 1520
29 Ga0070661_100554729 3300005344 Bacteria 925
30 Ga0070668_100051712 3300005347 Bacteria 3167
31 Ga0070668_100060871 3300005347 Bacteria 2925
32 Ga0070668_100183527 3300005347 Bacteria 1710
33 Ga0070668_101023036 3300005347 Unclassified 743
34 Ga0070669_100058475 3300005353 Bacteria 2829
35 Ga0070669_100114120 3300005353 Unclassified 2054
36 Ga0070669_100115728 3300005353 Bacteria 2040
37 Ga0070669_100380668 3300005353 Bacteria 1151
38 Ga0070669_101314302 3300005353 Unclassified 626
39 Ga0070675_100017173 3300005354 Bacteria 5752
40 Ga0070675_100171267 3300005354 Bacteria 1872
41 Ga0070675_100179570 3300005354 Bacteria 1829
42 Ga0070675_100389445 3300005354 Bacteria 1242
43 Ga0070675_101122494 3300005354 Unclassified 723
44 Ga0070671_100033073 3300005355 Bacteria 4275
45 Ga0070671_100259440 3300005355 Bacteria 1477
46 Ga0070674_100015768 3300005356 Bacteria 4726
47 Ga0070674_100016891 3300005356 Unclassified 4579
48 Ga0070674_100964151 3300005356 Unclassified 746
49 Ga0070674_101325476 3300005356 Bacteria 643
50 Ga0070673_100040001 3300005364 Bacteria 3594
51 Ga0070673_100265288 3300005364 Unclassified 1501
52 Ga0070673_100454242 3300005364 Unclassified 1153
53 Ga0070673_100646419 3300005364 Bacteria 968
54 Ga0070673_100931403 3300005364 Bacteria 807
55 Ga0070659_100166742 3300005366 Bacteria 1802
56 Ga0070659_100795045 3300005366 Unclassified 822
57 Ga0070667_100031715 3300005367 Bacteria 4405
58 Ga0070667_100281375 3300005367 Unclassified 1494
59 Ga0070703_10041707 3300005406 Unclassified 1432
60 Ga0070703_10330246 3300005406 Unclassified 645
61 Ga0070703_10533998 3300005406 Bacteria 532
62 Ga0070713_100649337 3300005436 Unclassified 1005
63 Ga0070701_10170260 3300005438 Unclassified 1268
64 Ga0070711_100089426 3300005439 Bacteria 2215
65 Ga0070705_100378682 3300005440 Bacteria 1041
66 Ga0070705_100382057 3300005440 Unclassified 1037
67 Ga0070705_100608085 3300005440 Bacteria 846
68 Ga0070705_101306816 3300005440 Unclassified 601
69 Ga0070700_100096164 3300005441 Bacteria 1943
70 Ga0070700_101043772 3300005441 Unclassified 674
71 Ga0070700_101828450 3300005441 Unclassified 524
72 Ga0070694_100810235 3300005444 Bacteria 768
73 Ga0070708_100116526 3300005445 Bacteria 2460
74 Ga0070663_100036399 3300005455 Bacteria 3420
75 Ga0070663_100343975 3300005455 Bacteria 1206
76 Ga0070663_100922350 3300005455 Bacteria 756
77 Ga0070678_100255818 3300005456 Bacteria 1470
78 Ga0070678_100269954 3300005456 Bacteria 1434
79 Ga0070662_100272031 3300005457 Bacteria 1368
80 Ga0070662_100805017 3300005457 Bacteria 799
81 Ga0070662_101417900 3300005457 Bacteria 599
82 Ga0070681_11439389 3300005458 Bacteria 613
83 Ga0068867_100013548 3300005459 Bacteria 5774
84 Ga0068867_100060356 3300005459 Bacteria 2813
85 Ga0070707_100000407 3300005468 Bacteria 42543
86 Ga0070707_100055336 3300005468 Bacteria 3804
87 Ga0070707_100776054 3300005468 Bacteria 922
88 Ga0070707_100885474 3300005468 Unclassified 857
89 Ga0070698_100364715 3300005471 Bacteria 1377
90 Ga0070698_100393841 3300005471 Bacteria 1318
91 Ga0070698_101211843 3300005471 Bacteria 704
92 Ga0070699_100175836 3300005518 Bacteria 1898
93 Ga0070699_100411795 3300005518 Bacteria 1223
94 Ga0070672_100123803 3300005543 Bacteria 2119
95 Ga0070686_100023434 3300005544 Bacteria 3689
96 Ga0070686_100121154 3300005544 Bacteria 1796
97 Ga0070686_100218442 3300005544 Bacteria 1376
98 Ga0070686_100683128 3300005544 Bacteria 817
99 Ga0070695_100094059 3300005545 Bacteria 2006
100 Ga0070695_100143993 3300005545 Unclassified 1656
101 Ga0070695_100994721 3300005545 Bacteria 682
102 Ga0070695_101156035 3300005545 Bacteria 635
103 Ga0070696_100126983 3300005546 Bacteria 1852
104 Ga0070696_100205191 3300005546 Bacteria 1473
105 Ga0070696_100274923 3300005546 Bacteria 1282
106 Ga0070696_100641271 3300005546 Bacteria 860
107 Ga0070665_100017312 3300005548 Bacteria 7234
108 Ga0070665_100031210 3300005548 Bacteria 5363
109 Ga0070665_100319799 3300005548 Bacteria 1556
110 Ga0070665_102067286 3300005548 Bacteria 574
111 Ga0070704_100217065 3300005549 Bacteria 1553
112 Ga0070704_100956839 3300005549 Unclassified 773
113 Ga0070664_100042775 3300005564 Bacteria 3823
114 Ga0070664_100064298 3300005564 Unclassified 3129
115 Ga0068857_100657682 3300005577 Bacteria 993
116 Ga0068857_101518955 3300005577 Unclassified 653
117 Ga0068854_100001628 3300005578 Bacteria 13662
118 Ga0068854_100174416 3300005578 Unclassified 1675
119 Ga0068854_100985955 3300005578 Bacteria 745
120 Ga0068852_100458842 3300005616 Bacteria 1263
121 Ga0068859_100007390 3300005617 Bacteria 11149
122 Ga0068859_100056204 3300005617 Bacteria 3960
123 Ga0068859_100129860 3300005617 Bacteria 2591
124 Ga0068859_100213617 3300005617 Unclassified 2016
125 Ga0068859_100492080 3300005617 Bacteria 1322
126 Ga0068859_100526579 3300005617 Unclassified 1277
127 Ga0068859_101552051 3300005617 Unclassified 731
128 Ga0068864_100119527 3300005618 Bacteria 2354
129 Ga0068864_100182144 3300005618 Bacteria 1921
130 Ga0068866_10286213 3300005718 Bacteria 1023
131 Ga0068866_10302328 3300005718 Bacteria 1000
132 Ga0068866_10453822 3300005718 Bacteria 839
133 Ga0068861_100007384 3300005719 Bacteria 7531
134 Ga0068861_100114220 3300005719 Bacteria 2168
135 Ga0068861_100176205 3300005719 Unclassified 1776
136 Ga0068861_100988707 3300005719 Unclassified 802
137 Ga0068861_102260837 3300005719 Bacteria 545
138 Ga0068851_10009050 3300005834 Bacteria 4621
139 Ga0068870_10109262 3300005840 Bacteria 1576
140 Ga0068870_10257751 3300005840 Bacteria 1084
141 Ga0068863_100275509 3300005841 Unclassified 1629
142 Ga0068863_100276011 3300005841 Bacteria 1628
143 Ga0068863_100404716 3300005841 Bacteria 1335
144 Ga0068858_100106373 3300005842 Bacteria 2619
145 Ga0068858_100210027 3300005842 Bacteria 1842
146 Ga0068858_100412835 3300005842 Bacteria 1298
147 Ga0068858_100691950 3300005842 Bacteria 992
148 Ga0068858_100698144 3300005842 Bacteria 987
149 Ga0068858_101301862 3300005842 Bacteria 715
150 Ga0068860_100521061 3300005843 Bacteria 1189
151 Ga0068860_100553255 3300005843 Bacteria 1153
152 Ga0068860_101162071 3300005843 Bacteria 792
153 Ga0068860_101729631 3300005843 Bacteria 647
154 Ga0068860_101908097 3300005843 Bacteria 616
155 Ga0068862_100017625 3300005844 Bacteria 5946
156 Ga0068862_100044529 3300005844 Bacteria 3786
157 Ga0068862_100163236 3300005844 Bacteria 1990
158 Ga0081455_10006386 3300005937 Bacteria 12655
159 Ga0081538_10116573 3300005981 Bacteria 1295
160 Ga0075368_10121575 3300006042 Bacteria 1081
161 Ga0075363_100181519 3300006048 Bacteria 1198
162 Ga0075363_100183690 3300006048 Unclassified 1191
163 Ga0070715_10068229 3300006163 Unclassified 1581
164 Ga0070716_100001567 3300006173 Bacteria 10266
165 Ga0070712_100103837 3300006175 Bacteria 2108
166 Ga0075367_10002462 3300006178 Bacteria 8474
167 Ga0075367_10005014 3300006178 Bacteria 6531
168 Ga0075367_10126359 3300006178 Bacteria 1578
169 Ga0075367_11125931 3300006178 Bacteria 502
170 Ga0075366_10026284 3300006195 Bacteria 3408
171 Ga0075366_10027662 3300006195 Bacteria 3328
172 Ga0075366_10039562 3300006195 Bacteria 2787
173 Ga0075366_10077504 3300006195 Bacteria 1984
174 Ga0075366_10253480 3300006195 Unclassified 1074
175 Ga0075366_10468577 3300006195 Bacteria 778
176 Ga0075366_10834384 3300006195 Bacteria 574
177 Ga0097621_100002959 3300006237 Bacteria 11662
178 Ga0097621_100011272 3300006237 Bacteria 6581
179 Ga0097621_100170522 3300006237 Bacteria 1876
180 Ga0075370_10003003 3300006353 Bacteria 7946
181 Ga0075370_10113012 3300006353 Bacteria 1578
182 Ga0075370_10639165 3300006353 Bacteria 646
183 Ga0068871_100070588 3300006358 Bacteria 2871
184 Ga0068871_100282431 3300006358 Bacteria 1453
185 Ga0068871_100522992 3300006358 Unclassified 1072
186 Ga0075428_100004507 3300006844 Bacteria 15383
187 Ga0075428_100065389 3300006844 Unclassified 3982
188 Ga0075428_100068047 3300006844 Bacteria 3897
189 Ga0075428_100071884 3300006844 Unclassified 3781
190 Ga0075428_100078976 3300006844 Unclassified 3591
191 Ga0075428_100298512 3300006844 Bacteria 1732
192 Ga0075428_101697571 3300006844 Unclassified 659
193 Ga0075430_100000362 3300006846 Bacteria 33272
194 Ga0075430_100105508 3300006846 Bacteria 2351
195 Ga0075430_100111860 3300006846 Unclassified 2276
196 Ga0075431_100001714 3300006847 Bacteria 20610
197 Ga0075431_100005371 3300006847 Bacteria 12648
198 Ga0075431_100037023 3300006847 Bacteria 5026
199 Ga0075433_10120631 3300006852 Unclassified 2328
200 Ga0075433_10840195 3300006852 Bacteria 802
201 Ga0075433_10975806 3300006852 Bacteria 738
202 Ga0075434_100583731 3300006871 Bacteria 1137
203 Ga0075434_101242723 3300006871 Bacteria 756
204 Ga0075429_100005618 3300006880 Bacteria 10808
205 Ga0075429_100016728 3300006880 Bacteria 6352
206 Ga0075429_100157062 3300006880 Bacteria 1992
207 Ga0075429_100230864 3300006880 Bacteria 1621
208 Ga0075429_100400382 3300006880 Bacteria 1202
209 Ga0075429_100475927 3300006880 Unclassified 1094
210 Ga0068865_100014884 3300006881 Bacteria 4951
211 Ga0068865_100056229 3300006881 Bacteria 2740
212 Ga0068865_100340244 3300006881 Bacteria 1212
213 Ga0068865_100498011 3300006881 Bacteria 1015
214 Ga0097620_100007390 3300006931 Bacteria 11149
215 Ga0097620_100056204 3300006931 Bacteria 3960
216 Ga0097620_100129852 3300006931 Bacteria 2591
217 Ga0097620_100213605 3300006931 Unclassified 2016
218 Ga0097620_100492025 3300006931 Bacteria 1322
219 Ga0097620_100526574 3300006931 Unclassified 1277
220 Ga0097620_101552012 3300006931 Unclassified 731
221 Ga0105240_10001488 3300009093 Bacteria 39873
222 Ga0105240_10770436 3300009093 Bacteria 1044
223 Ga0111539_10057097 3300009094 Bacteria 4637
224 Ga0105245_10004521 3300009098 Bacteria 12287
225 Ga0105245_11317842 3300009098 Bacteria 771
226 Ga0114129_10006475 3300009147 Bacteria 16609
227 Ga0114129_10010233 3300009147 Bacteria 13379
228 Ga0114129_10026150 3300009147 Bacteria 8265
229 Ga0114129_10046101 3300009147 Bacteria 6128
230 Ga0114129_10052207 3300009147 Bacteria 5737
231 Ga0114129_10093670 3300009147 Unclassified 4161
232 Ga0114129_10216642 3300009147 Unclassified 2585
233 Ga0105243_10753257 3300009148 Bacteria 955
234 Ga0105241_10155219 3300009174 Bacteria 1876
235 Ga0105242_10020879 3300009176 Bacteria 5137
236 Ga0105242_10137142 3300009176 Bacteria 2119
237 Ga0105242_10151113 3300009176 Bacteria 2025
238 Ga0105242_10214264 3300009176 Bacteria 1718
239 Ga0105242_12308627 3300009176 Bacteria 584
240 Ga0105248_10011156 3300009177 Bacteria 9914
241 Ga0105248_10113318 3300009177 Bacteria 3058
242 Ga0105248_10119723 3300009177 Bacteria 2969
243 Ga0105248_10125465 3300009177 Bacteria 2896
244 Ga0105238_10023490 3300009551 Bacteria 6284
245 Ga0105238_11162878 3300009551 Bacteria 795
246 Ga0105249_10020361 3300009553 Bacteria 5931
247 Ga0105249_10030895 3300009553 Bacteria 4842
248 Ga0105249_10059162 3300009553 Bacteria 3514
249 Ga0105249_10376623 3300009553 Bacteria 1444
250 Ga0105249_10710968 3300009553 Bacteria 1065
251 Ga0105249_11237370 3300009553 Unclassified 818
252 Ga0105249_11926227 3300009553 Bacteria 664
253 Ga0105239_10520398 3300010375 Bacteria 1353
254 Ga0157371_10956139 3300013102 Bacteria 652
255 Ga0157374_10799058 3300013296 Bacteria 959
256 Ga0157378_10129135 3300013297 Bacteria 2338
257 Ga0163162_10100294 3300013306 Bacteria 2987
258 Ga0163162_10244752 3300013306 Bacteria 1925
259 Ga0157375_10297018 3300013308 Bacteria 1779
260 Ga0157375_11075639 3300013308 Unclassified 941
261 Ga0157375_12092850 3300013308 Bacteria 673
262 Ga0157375_12744360 3300013308 Unclassified 589
263 Ga0163163_10033846 3300014325 Bacteria 4946
264 Ga0163163_10150878 3300014325 Bacteria 2368
265 Ga0163163_10630132 3300014325 Bacteria 1136
266 Ga0163163_10715853 3300014325 Bacteria 1065
267 Ga0157380_10026206 3300014326 Bacteria 4426
268 Ga0157380_10040695 3300014326 Bacteria 3622
269 Ga0157380_10367074 3300014326 Bacteria 1353
270 Ga0157380_10831700 3300014326 Bacteria 943
271 Ga0157380_10854984 3300014326 Unclassified 932
272 Ga0157380_10875928 3300014326 Bacteria 922
273 Ga0157380_11021117 3300014326 Bacteria 862
274 Ga0157380_11453348 3300014326 Bacteria 737
275 Ga0182008_10502978 3300014497 Bacteria 667
276 Ga0157377_10366614 3300014745 Bacteria 971
277 Ga0157379_10615831 3300014968 Bacteria 1014
278 Ga0157379_12459788 3300014968 Bacteria 520
279 Ga0157376_10375553 3300014969 Bacteria 1368
280 Ga0163161_11028817 3300017792 Unclassified 704
281 Ga0213873_10046359 3300021358 Unclassified 1137
282 Ga0213872_10008815 3300021361 Bacteria 4868
283 Ga0213874_10025312 3300021377 Unclassified 1673
284 Ga0213876_10040392 3300021384 Bacteria 2464
285 Ga0213876_10165642 3300021384 Unclassified 1176
286 Ga0213875_10065410 3300021388 Unclassified 1699
287 Ga0207697_10468911 3300025315 Unclassified 557
288 Ga0207656_10004998 3300025321 Bacteria 4659
289 Ga0207653_10075409 3300025885 Unclassified 1159
290 Ga0207653_10193967 3300025885 Unclassified 764
291 Ga0207682_10019384 3300025893 Unclassified 2662
292 Ga0207682_10072759 3300025893 Bacteria 1459
293 Ga0207682_10180359 3300025893 Bacteria 964
294 Ga0207692_10038779 3300025898 Bacteria 2339
295 Ga0207642_10313575 3300025899 Unclassified 913
296 Ga0207642_10652141 3300025899 Unclassified 660
297 Ga0207680_10074296 3300025903 Bacteria 2116
298 Ga0207680_10262881 3300025903 Bacteria 1195
299 Ga0207685_10482232 3300025905 Unclassified 650
300 Ga0207699_10565729 3300025906 Unclassified 825
301 Ga0207645_10197153 3300025907 Bacteria 1324
302 Ga0207643_10042318 3300025908 Bacteria 2568
303 Ga0207643_10158025 3300025908 Bacteria 1362
304 Ga0207643_10248536 3300025908 Bacteria 1095
305 Ga0207684_10130352 3300025910 Bacteria 2158
306 Ga0207707_11102781 3300025912 Bacteria 647
307 Ga0207695_10002549 3300025913 Bacteria 26774
308 Ga0207693_10028785 3300025915 Bacteria 4391
309 Ga0207660_11107652 3300025917 Bacteria 645
310 Ga0207662_10035129 3300025918 Bacteria 2927
311 Ga0207662_10189809 3300025918 Bacteria 1325
312 Ga0207662_10212741 3300025918 Unclassified 1256
313 Ga0207649_10173358 3300025920 Bacteria 1504
314 Ga0207646_10000736 3300025922 Bacteria 42554
315 Ga0207646_10211710 3300025922 Bacteria 1750
316 Ga0207646_10676977 3300025922 Bacteria 923
317 Ga0207646_10689977 3300025922 Bacteria 913
318 Ga0207681_10052744 3300025923 Bacteria 2759
319 Ga0207681_10092639 3300025923 Bacteria 2161
320 Ga0207681_10144457 3300025923 Bacteria 1776
321 Ga0207681_10770899 3300025923 Unclassified 802
322 Ga0207681_11064436 3300025923 Unclassified 679
323 Ga0207694_10118996 3300025924 Unclassified 2108
324 Ga0207694_10912822 3300025924 Bacteria 743
325 Ga0207694_11259434 3300025924 Unclassified 626
326 Ga0207650_11532851 3300025925 Unclassified 566
327 Ga0207659_10033399 3300025926 Unclassified 3541
328 Ga0207659_10053318 3300025926 Bacteria 2884
329 Ga0207659_10151378 3300025926 Bacteria 1812
330 Ga0207687_10003734 3300025927 Bacteria 10239
331 Ga0207687_11732409 3300025927 Bacteria 535
332 Ga0207700_10285601 3300025928 Unclassified 1421
333 Ga0207644_10350293 3300025931 Unclassified 1199
334 Ga0207690_10481455 3300025932 Bacteria 1002
335 Ga0207690_11126045 3300025932 Unclassified 655
336 Ga0207706_10145073 3300025933 Bacteria 2088
337 Ga0207706_10263440 3300025933 Unclassified 1504
338 Ga0207706_10534393 3300025933 Bacteria 1010
339 Ga0207686_10008705 3300025934 Bacteria 5482
340 Ga0207686_10224090 3300025934 Bacteria 1359
341 Ga0207686_10491470 3300025934 Bacteria 951
342 Ga0207709_10309978 3300025935 Unclassified 1177
343 Ga0207670_10463970 3300025936 Bacteria 1023
344 Ga0207670_10626902 3300025936 Bacteria 885
345 Ga0207670_11430224 3300025936 Unclassified 587
346 Ga0207669_10619665 3300025937 Bacteria 881
347 Ga0207669_10818628 3300025937 Unclassified 773
348 Ga0207669_10859985 3300025937 Bacteria 755
349 Ga0207704_10013160 3300025938 Bacteria 4132
350 Ga0207704_10031474 3300025938 Bacteria 2990
351 Ga0207665_10010065 3300025939 Bacteria 6211
352 Ga0207691_10176777 3300025940 Bacteria 1867
353 Ga0207711_10076101 3300025941 Bacteria 2922
354 Ga0207711_10080209 3300025941 Bacteria 2850
355 Ga0207711_10221605 3300025941 Bacteria 1730
356 Ga0207711_11140715 3300025941 Unclassified 720
357 Ga0207689_10015134 3300025942 Bacteria 6539
358 Ga0207689_10071142 3300025942 Bacteria 2857
359 Ga0207689_10417306 3300025942 Bacteria 1120
360 Ga0207689_10512199 3300025942 Unclassified 1006
361 Ga0207689_10992897 3300025942 Bacteria 708
362 Ga0207679_10033860 3300025945 Unclassified 3599
363 Ga0207651_10060910 3300025960 Bacteria 2622
364 Ga0207651_10207482 3300025960 Unclassified 1575
365 Ga0207651_10246990 3300025960 Bacteria 1458
366 Ga0207651_10253902 3300025960 Bacteria 1440
367 Ga0207712_10067440 3300025961 Bacteria 2561
368 Ga0207712_10098972 3300025961 Unclassified 2164
369 Ga0207712_11193999 3300025961 Unclassified 679
370 Ga0207668_10138025 3300025972 Bacteria 1871
371 Ga0207668_10471229 3300025972 Bacteria 1075
372 Ga0207668_10618378 3300025972 Bacteria 945
373 Ga0207640_10028883 3300025981 Bacteria 3397
374 Ga0207640_10269945 3300025981 Bacteria 1330
375 Ga0207640_11843309 3300025981 Unclassified 547
376 Ga0207658_10022590 3300025986 Bacteria 4382
377 Ga0207677_10288140 3300026023 Bacteria 1351
378 Ga0207703_10055505 3300026035 Bacteria 3223
379 Ga0207703_10071190 3300026035 Bacteria 2872
380 Ga0207703_10459190 3300026035 Bacteria 1191
381 Ga0207703_10723273 3300026035 Bacteria 947
382 Ga0207703_12001126 3300026035 Bacteria 556
383 Ga0207678_10056501 3300026067 Bacteria 3378
384 Ga0207678_10059208 3300026067 Bacteria 3296
385 Ga0207678_10257787 3300026067 Bacteria 1494
386 Ga0207708_10156422 3300026075 Bacteria 1798
387 Ga0207708_10254041 3300026075 Unclassified 1417
388 Ga0207708_11274515 3300026075 Bacteria 643
389 Ga0207708_11530553 3300026075 Unclassified 586
390 Ga0207641_10163573 3300026088 Bacteria 2025
391 Ga0207641_10293838 3300026088 Unclassified 1532
392 Ga0207641_10514769 3300026088 Bacteria 1163
393 Ga0207641_10755818 3300026088 Bacteria 960
394 Ga0207641_11148716 3300026088 Unclassified 776
395 Ga0207648_10010441 3300026089 Bacteria 8799
396 Ga0207648_10041855 3300026089 Bacteria 4023
397 Ga0207676_10020982 3300026095 Bacteria 4788
398 Ga0207676_10215418 3300026095 Bacteria 1707
399 Ga0207674_10417900 3300026116 Unclassified 1296
400 Ga0207675_100013808 3300026118 Bacteria 7531
401 Ga0207675_100037069 3300026118 Bacteria 4549
402 Ga0207675_100083194 3300026118 Bacteria 3001
403 Ga0207675_100341120 3300026118 Bacteria 1467
404 Ga0207675_100524438 3300026118 Bacteria 1181
405 Ga0207675_100564921 3300026118 Unclassified 1138
406 Ga0207675_100762383 3300026118 Bacteria 979
407 Ga0207675_101102630 3300026118 Bacteria 813
408 Ga0207675_101416266 3300026118 Unclassified 716
409 Ga0207683_10155657 3300026121 Bacteria 2064
410 Ga0207683_10161732 3300026121 Bacteria 2024
411 Ga0207683_10219682 3300026121 Unclassified 1731
412 Ga0209971_1029908 3300027682 Bacteria 1304
413 Ga0207428_10188388 3300027907 Unclassified 1556
414 Ga0268266_10782570 3300028379 Bacteria 921
415 Ga0268265_10065400 3300028380 Bacteria 2806
416 Ga0268265_10447877 3300028380 Archaea 1205
417 Ga0268265_11309434 3300028380 Bacteria 725
418 Ga0268265_11375290 3300028380 Unclassified 707
419 Ga0268265_12064958 3300028380 Bacteria 577
420 Ga0268264_10243992 3300028381 Bacteria 1665
421 Ga0268264_10804084 3300028381 Bacteria 939
422 Ga0307513_10438421 3300031456 Unclassified 1033
423 Ga0307408_100322364 3300031548 Bacteria 1302
424 Ga0307413_10588410 3300031824 Bacteria 909
425 Ga0307413_11374592 3300031824 Bacteria 620
426 Ga0307412_10855103 3300031911 Bacteria 794
427 Ga0307416_100237182 3300032002 Bacteria 1764
428 Ga0373926_0027646 3300035083 Bacteria 1989
429 Ga0373956_0503199 3300035119 Unclassified 578
430 Ga0373957_0308358 3300035120 Unclassified 672
431 Ga0373955_0568625 3300035172 Unclassified 694
432 Ga0373935_0264045 3300035692 Bacteria 1208
433 Ga0373927_0046612 3300035695 Bacteria 2804
434 Ga0373933_0113135 3300035724 Bacteria 1695
435 Ga0373937_0301959 3300036401 Bacteria 1513
436 Ga0373925_0040123 3300037068 Bacteria 3465
437 Ga0436364_0192446 3300037853 Bacteria 7674
438 Ga0436364_0317997 3300037853 Unclassified 884
439 Ga0436365_0841532 3300039437 Bacteria 2853
440 Ga0436365_0982865 3300039437 Unclassified 3616
441 Ga0436361_0683315 3300039447 Bacteria 65588
442 Ga0436363_0235780 3300039450 Bacteria 1071
443 Ga0436363_0611047 3300039450 Bacteria 5009
444 Ga0436362_0274195 3300039453 Bacteria 3217
445 Ga0436362_1279004 3300039453 Unclassified 683
446 Ga0439453_0009371 3300041408 Bacteria 1594
447 Ga0439465_0372762 3300041413 Unclassified 541
448 Ga0451793_0847080 3300041452 Bacteria 576
449 Ga0451807_0392687 3300041486 Bacteria 667
450 Ga0451807_1967097 3300041486 Bacteria 584
451 Ga0450919_043050 3300042121 Bacteria 525
452 Ga0450920_021780 3300042122 Bacteria 1240
453 Ga0450923_095145 3300042125 Unclassified 682
454 Ga0450910_045954 3300042147 Unclassified 714
455 Ga0450908_001854 3300042184 Bacteria 4136
456 Ga0439435_0028281 3300042436 Unclassified 1506
457 Ga0439444_0146896 3300042437 Unclassified 567
458 Ga0495629_0392344 3300046459 Bacteria 944
459 Ga0495651_0881475 3300046462 Unclassified 548
460 Ga0495580_0004230 3300046472 Bacteria 12074
461 Ga0495639_0276623 3300046475 Unclassified 834
462 Ga0495584_0459561 3300046491 Unclassified 648
463 Ga0495594_0248586 3300046499 Bacteria 1013
464 Ga0495632_0191125 3300046519 Bacteria 935
465 Ga0495598_0066703 3300046537 Bacteria 1123
466 Ga0495645_0182210 3300046543 Bacteria 1438
467 Ga0495656_0109788 3300046615 Bacteria 1288
468 Ga0495668_0184225 3300046616 Unclassified 1144
469 Ga0495588_0055933 3300046674 Bacteria 2037
470 Ga0495647_0043174 3300046681 Bacteria 1724
471 Ga0495581_0467611 3300047315 Bacteria 734
472 Ga0496101_0055217 3300048904 Bacteria 2868
473 Ga0496101_0670368 3300048904 Bacteria 819
474 Ga0496104_0027504 3300048907 Bacteria 5264
475 Ga0496105_0225074 3300048908 Bacteria 1526
476 Ga0496105_0367372 3300048908 Bacteria 1147
477 Ga0496106_0083565 3300048909 Bacteria 2456
478 Ga0496106_0568997 3300048909 Bacteria 909
479 Ga0496107_0015328 3300048910 Bacteria 5371
480 Ga0496108_0380802 3300048911 Unclassified 1232
481 Ga0496109_0122399 3300048912 Unclassified 2424
482 Ga0496110_1141647 3300048913 Unclassified 688
483 Ga0496113_0039754 3300048916 Unclassified 3464
484 Ga0496114_0000407 3300048917 Bacteria 31857
485 Ga0496115_0624774 3300048918 Bacteria 854
486 Ga0501031_0514966 3300049568 Unclassified 771
487 Ga0501039_0009871 3300049575 Bacteria 7281
488 Ga0501039_0836130 3300049575 Unclassified 718
489 Ga0501040_1319027 3300049576 Unclassified 524
490 Ga0501041_0011149 3300049577 Bacteria 5309
491 Ga0501046_0107507 3300049580 Unclassified 2134
492 Ga0501048_0265129 3300049582 Unclassified 1220
493 Ga0501067_0183929 3300049583 Unclassified 1164
494 Ga0501068_0234483 3300049584 Unclassified 1167
495 Ga0501071_0183920 3300049587 Unclassified 1566
496 Ga0501071_0261249 3300049587 Bacteria 1308
497 Ga0501071_0646080 3300049587 Unclassified 814
498 Ga0501072_0905995 3300049588 Bacteria 689
499 Ga0501074_0390845 3300049590 Bacteria 986
500 Ga0501074_0406994 3300049590 Bacteria 965
501 Ga0501074_0431770 3300049590 Unclassified 934
502 Ga0501074_1148697 3300049590 Unclassified 545
503 Ga0501075_0853149 3300049591 Unclassified 693
504 Ga0501075_0913826 3300049591 Unclassified 667
505 Ga0501077_0048016 3300049593 Bacteria 2712
506 Ga0501079_0018309 3300049741 Bacteria 5353
507 Ga0501079_0147211 3300049741 Bacteria 1836
508 Ga0501080_0109532 3300049742 Unclassified 2560
509 Ga0501080_0688614 3300049742 Bacteria 902
510 Ga0501081_0007969 3300049743 Bacteria 6873
511 Ga0501045_1190929 3300049824 Unclassified 556
512 nmdc:mga03n38_412067_c1 3300050490 Bacteria 746
513 nmdc:mga03n38_429737_c1 3300050490 Bacteria 731
514 nmdc:mga00v17_327237_c1 3300050491 Bacteria 996
515 nmdc:mga00v17_360877_c1 3300050491 Bacteria 944
516 nmdc:mga00v17_37916_c1 3300050491 Bacteria 2880
517 nmdc:mga0yw44_342099_c1 3300050492 Bacteria 1006
518 nmdc:mga0k408_190772_c1 3300050493 Bacteria 1223
519 nmdc:mga0k408_22506_c1 3300050493 Bacteria 3549
520 nmdc:mga0k408_487297_c1 3300050493 Bacteria 731
521 nmdc:mga0k408_50789_c1 3300050493 Bacteria 2401
522 nmdc:mga0k408_516724_c1 3300050493 Unclassified 707
523 nmdc:mga0k408_78980_c1 3300050493 Bacteria 1926
524 nmdc:mga06z11_250920_c1 3300050494 Bacteria 1042
525 nmdc:mga06z11_67344_c1 3300050494 Bacteria 1885
526 nmdc:mga06z11_709476_c1 3300050494 Bacteria 613
527 nmdc:mga04h51_236182_c1 3300050495 Bacteria 729
528 nmdc:mga07m45_45619_c1 3300050496 Bacteria 2461
529 nmdc:mga07m45_86609_c1 3300050496 Bacteria 1792
530 nmdc:mga07m45_91093_c1 3300050496 Bacteria 1747
531 nmdc:mga05p37_124936_c1 3300050507 Unclassified 3160
532 nmdc:mga05p37_134620_c1 3300050507 Bacteria 3032
533 nmdc:mga05p37_188539_c1 3300050507 Bacteria 2505
534 nmdc:mga05p37_230912_c1 3300050507 Unclassified 2229
535 nmdc:mga05p37_2569_c1 3300050507 Bacteria 21101
536 nmdc:mga05p37_46586_c1 3300050507 Bacteria 5331
537 nmdc:mga09592_1151_c1 3300050508 Bacteria 21071
538 nmdc:mga09592_28549_c1 3300050508 Bacteria 4635
539 nmdc:mga09592_378660_c1 3300050508 Bacteria 1224
540 nmdc:mga09592_434570_c1 3300050508 Unclassified 1133
541 nmdc:mga09592_51244_c1 3300050508 Bacteria 3482
542 nmdc:mga09592_759414_c1 3300050508 Bacteria 822
543 nmdc:mga0qj67_124003_c2 3300050509 Unclassified 870
544 nmdc:mga0qj67_33216_c1 3300050509 Bacteria 4026
545 nmdc:mga0qj67_4437_c1 3300050509 Bacteria 10164
546 nmdc:mga0qj67_492000_c1 3300050509 Bacteria 986
547 nmdc:mga06r32_110510_c1 3300050510 Bacteria 2704
548 nmdc:mga06r32_302439_c1 3300050510 Bacteria 1585
549 nmdc:mga06r32_3433_c1 3300050510 Bacteria 14177
550 nmdc:mga06r32_85037_c1 3300050510 Unclassified 3084
551 nmdc:mga08y16_139213_c1 3300050511 Bacteria 2523
552 nmdc:mga08y16_348862_c1 3300050511 Unclassified 1521
553 nmdc:mga08y16_56802_c1 3300050511 Unclassified 4090
554 nmdc:mga0n895_1030392_c1 3300050512 Bacteria 803
555 nmdc:mga0n895_191627_c1 3300050512 Unclassified 2075
556 nmdc:mga0rr50_1161432_c1 3300050513 Bacteria 656
557 nmdc:mga0a205_1487702_c1 3300050515 Bacteria 525
558 nmdc:mga0a205_22853_c2 3300050515 Unclassified 2734
559 nmdc:mga0a205_69640_c1 3300050515 Bacteria 3396
560 Ga0495619_0295650 3300053085 Bacteria 1122
561 Ga0501084_0048420 3300054114 Bacteria 3558
562 Ga0501084_0162376 3300054114 Bacteria 1885
563 Ga0501084_0221090 3300054114 Bacteria 1598
564 Ga0501082_0079567 3300060353 Bacteria 2828
565 Ga0501082_0268058 3300060353 Bacteria 1486
566 Ga0530510_0299811 3300061734 Unclassified 1202
567 Ga0530510_0849403 3300061734 Unclassified 697
568 Ga0111539_10648268
569 Ga0065704_10179055
570 Ga0065712_10070437
571 Ga0065715_10594048
572 Ga0065707_10136551
573 Ga0065707_10428879
574 Ga0070676_10221368
575 Ga0070690_100003925
576 Ga0070690_100411569
577 Ga0070690_100622964
578 Ga0070677_10213297
579 Ga0068869_100025385
580 Ga0068869_100281748
581 Ga0068869_101004667
582 Ga0068869_101062450
583 Ga0070666_10003003
584 Ga0070666_10175334
585 Ga0070680_100490073
586 Ga0068868_100451122
587 Ga0068868_100806011
588 Ga0070689_100557807
589 Ga0070689_100655041
590 Ga0070691_10340579
591 Ga0070687_100026011
592 Ga0070687_100320164
593 Ga0070687_100507852
594 Ga0070687_101385269
595 Ga0070661_100201726
596 Ga0070661_100554729
597 Ga0070668_100051712
598 Ga0070668_100060871
599 Ga0070668_100183527
600 Ga0070668_101023036
601 Ga0070669_100058475
602 Ga0070669_100114120
603 Ga0070669_100115728
604 Ga0070669_100380668
605 Ga0070669_101314302
606 Ga0070675_100017173
607 Ga0070675_100171267
608 Ga0070675_100179570
609 Ga0070675_100389445
610 Ga0070675_101122494
611 Ga0070671_100033073
612 Ga0070671_100259440
613 Ga0070674_100015768
614 Ga0070674_100016891
615 Ga0070674_100964151
616 Ga0070674_101325476
617 Ga0070673_100040001
618 Ga0070673_100265288
619 Ga0070673_100454242
620 Ga0070673_100646419
621 Ga0070673_100931403
622 Ga0070659_100166742
623 Ga0070659_100795045
624 Ga0070667_100031715
625 Ga0070667_100281375
626 Ga0070703_10041707
627 Ga0070703_10330246
628 Ga0070703_10533998
629 Ga0070713_100649337
630 Ga0070701_10170260
631 Ga0070711_100089426
632 Ga0070705_100378682
633 Ga0070705_100382057
634 Ga0070705_100608085
635 Ga0070705_101306816
636 Ga0070700_100096164
637 Ga0070700_101043772
638 Ga0070700_101828450
639 Ga0070694_100810235
640 Ga0070708_100116526
641 Ga0070663_100036399
642 Ga0070663_100343975
643 Ga0070663_100922350
644 Ga0070678_100255818
645 Ga0070678_100269954
646 Ga0070662_100272031
647 Ga0070662_100805017
648 Ga0070662_101417900
649 Ga0070681_11439389
650 Ga0068867_100013548
651 Ga0068867_100060356
652 Ga0070707_100000407
653 Ga0070707_100055336
654 Ga0070707_100776054
655 Ga0070707_100885474
656 Ga0070698_100364715
657 Ga0070698_100393841
658 Ga0070698_101211843
659 Ga0070699_100175836
660 Ga0070699_100411795
661 Ga0070672_100123803
662 Ga0070686_100023434
663 Ga0070686_100121154
664 Ga0070686_100218442
665 Ga0070686_100683128
666 Ga0070695_100094059
667 Ga0070695_100143993
668 Ga0070695_100994721
669 Ga0070695_101156035
670 Ga0070696_100126983
671 Ga0070696_100205191
672 Ga0070696_100274923
673 Ga0070696_100641271
674 Ga0070665_100017312
675 Ga0070665_100031210
676 Ga0070665_100319799
677 Ga0070665_102067286
678 Ga0070704_100217065
679 Ga0070704_100956839
680 Ga0070664_100042775
681 Ga0070664_100064298
682 Ga0068857_100657682
683 Ga0068857_101518955
684 Ga0068854_100001628
685 Ga0068854_100174416
686 Ga0068854_100985955
687 Ga0068852_100458842
688 Ga0068859_100007390
689 Ga0068859_100056204
690 Ga0068859_100129860
691 Ga0068859_100213617
692 Ga0068859_100492080
693 Ga0068859_100526579
694 Ga0068859_101552051
695 Ga0068864_100119527
696 Ga0068864_100182144
697 Ga0068866_10286213
698 Ga0068866_10302328
699 Ga0068866_10453822
700 Ga0068861_100007384
701 Ga0068861_100114220
702 Ga0068861_100176205
703 Ga0068861_100988707
704 Ga0068861_102260837
705 Ga0068851_10009050
706 Ga0068870_10109262
707 Ga0068870_10257751
708 Ga0068863_100275509
709 Ga0068863_100276011
710 Ga0068863_100404716
711 Ga0068858_100106373
712 Ga0068858_100210027
713 Ga0068858_100412835
714 Ga0068858_100691950
715 Ga0068858_100698144
716 Ga0068858_101301862
717 Ga0068860_100521061
718 Ga0068860_100553255
719 Ga0068860_101162071
720 Ga0068860_101729631
721 Ga0068860_101908097
722 Ga0068862_100017625
723 Ga0068862_100044529
724 Ga0068862_100163236
725 Ga0081455_10006386
726 Ga0081538_10116573
727 Ga0075368_10121575
728 Ga0075363_100181519
729 Ga0075363_100183690
730 Ga0070715_10068229
731 Ga0070716_100001567
732 Ga0070712_100103837
733 Ga0075367_10002462
734 Ga0075367_10005014
735 Ga0075367_10126359
736 Ga0075367_11125931
737 Ga0075366_10026284
738 Ga0075366_10027662
739 Ga0075366_10039562
740 Ga0075366_10077504
741 Ga0075366_10253480
742 Ga0075366_10468577
743 Ga0075366_10834384
744 Ga0097621_100002959
745 Ga0097621_100011272
746 Ga0097621_100170522
747 Ga0075370_10003003
748 Ga0075370_10113012
749 Ga0075370_10639165
750 Ga0068871_100070588
751 Ga0068871_100282431
752 Ga0068871_100522992
753 Ga0075428_100004507
754 Ga0075428_100065389
755 Ga0075428_100068047
756 Ga0075428_100071884
757 Ga0075428_100078976
758 Ga0075428_100298512
759 Ga0075428_101697571
760 Ga0075430_100000362
761 Ga0075430_100105508
762 Ga0075430_100111860
763 Ga0075431_100001714
764 Ga0075431_100005371
765 Ga0075431_100037023
766 Ga0075433_10120631
767 Ga0075433_10840195
768 Ga0075433_10975806
769 Ga0075434_100583731
770 Ga0075434_101242723
771 Ga0075429_100005618
772 Ga0075429_100016728
773 Ga0075429_100157062
774 Ga0075429_100230864
775 Ga0075429_100400382
776 Ga0075429_100475927
777 Ga0068865_100014884
778 Ga0068865_100056229
779 Ga0068865_100340244
780 Ga0068865_100498011
781 Ga0097620_100007390
782 Ga0097620_100056204
783 Ga0097620_100129852
784 Ga0097620_100213605
785 Ga0097620_100492025
786 Ga0097620_100526574
787 Ga0097620_101552012
788 Ga0105240_10001488
789 Ga0105240_10770436
790 Ga0111539_10057097
791 Ga0105245_10004521
792 Ga0105245_11317842
793 Ga0114129_10006475
794 Ga0114129_10010233
795 Ga0114129_10026150
796 Ga0114129_10046101
797 Ga0114129_10052207
798 Ga0114129_10093670
799 Ga0114129_10216642
800 Ga0105243_10753257
801 Ga0105241_10155219
802 Ga0105242_10020879
803 Ga0105242_10137142
804 Ga0105242_10151113
805 Ga0105242_10214264
806 Ga0105242_12308627
807 Ga0105248_10011156
808 Ga0105248_10113318
809 Ga0105248_10119723
810 Ga0105248_10125465
811 Ga0105238_10023490
812 Ga0105238_11162878
813 Ga0105249_10020361
814 Ga0105249_10030895
815 Ga0105249_10059162
816 Ga0105249_10376623
817 Ga0105249_10710968
818 Ga0105249_11237370
819 Ga0105249_11926227
820 Ga0105239_10520398
821 Ga0157371_10956139
822 Ga0157374_10799058
823 Ga0157378_10129135
824 Ga0163162_10100294
825 Ga0163162_10244752
826 Ga0157375_10297018
827 Ga0157375_11075639
828 Ga0157375_12092850
829 Ga0157375_12744360
830 Ga0163163_10033846
831 Ga0163163_10150878
832 Ga0163163_10630132
833 Ga0163163_10715853
834 Ga0157380_10026206
835 Ga0157380_10040695
836 Ga0157380_10367074
837 Ga0157380_10831700
838 Ga0157380_10854984
839 Ga0157380_10875928
840 Ga0157380_11021117
841 Ga0157380_11453348
842 Ga0182008_10502978
843 Ga0157377_10366614
844 Ga0157379_10615831
845 Ga0157379_12459788
846 Ga0157376_10375553
847 Ga0163161_11028817
848 Ga0213873_10046359
849 Ga0213872_10008815
850 Ga0213874_10025312
851 Ga0213876_10040392
852 Ga0213876_10165642
853 Ga0213875_10065410
854 Ga0207697_10468911
855 Ga0207656_10004998
856 Ga0207653_10075409
857 Ga0207653_10193967
858 Ga0207682_10019384
859 Ga0207682_10072759
860 Ga0207682_10180359
861 Ga0207692_10038779
862 Ga0207642_10313575
863 Ga0207642_10652141
864 Ga0207680_10074296
865 Ga0207680_10262881
866 Ga0207685_10482232
867 Ga0207699_10565729
868 Ga0207645_10197153
869 Ga0207643_10042318
870 Ga0207643_10158025
871 Ga0207643_10248536
872 Ga0207684_10130352
873 Ga0207707_11102781
874 Ga0207695_10002549
875 Ga0207693_10028785
876 Ga0207660_11107652
877 Ga0207662_10035129
878 Ga0207662_10189809
879 Ga0207662_10212741
880 Ga0207649_10173358
881 Ga0207646_10000736
882 Ga0207646_10211710
883 Ga0207646_10676977
884 Ga0207646_10689977
885 Ga0207681_10052744
886 Ga0207681_10092639
887 Ga0207681_10144457
888 Ga0207681_10770899
889 Ga0207681_11064436
890 Ga0207694_10118996
891 Ga0207694_10912822
892 Ga0207694_11259434
893 Ga0207650_11532851
894 Ga0207659_10033399
895 Ga0207659_10053318
896 Ga0207659_10151378
897 Ga0207687_10003734
898 Ga0207687_11732409
899 Ga0207700_10285601
900 Ga0207644_10350293
901 Ga0207690_10481455
902 Ga0207690_11126045
903 Ga0207706_10145073
904 Ga0207706_10263440
905 Ga0207706_10534393
906 Ga0207686_10008705
907 Ga0207686_10224090
908 Ga0207686_10491470
909 Ga0207709_10309978
910 Ga0207670_10463970
911 Ga0207670_10626902
912 Ga0207670_11430224
913 Ga0207669_10619665
914 Ga0207669_10818628
915 Ga0207669_10859985
916 Ga0207704_10013160
917 Ga0207704_10031474
918 Ga0207665_10010065
919 Ga0207691_10176777
920 Ga0207711_10076101
921 Ga0207711_10080209
922 Ga0207711_10221605
923 Ga0207711_11140715
924 Ga0207689_10015134
925 Ga0207689_10071142
926 Ga0207689_10417306
927 Ga0207689_10512199
928 Ga0207689_10992897
929 Ga0207679_10033860
930 Ga0207651_10060910
931 Ga0207651_10207482
932 Ga0207651_10246990
933 Ga0207651_10253902
934 Ga0207712_10067440
935 Ga0207712_10098972
936 Ga0207712_11193999
937 Ga0207668_10138025
938 Ga0207668_10471229
939 Ga0207668_10618378
940 Ga0207640_10028883
941 Ga0207640_10269945
942 Ga0207640_11843309
943 Ga0207658_10022590
944 Ga0207677_10288140
945 Ga0207703_10055505
946 Ga0207703_10071190
947 Ga0207703_10459190
948 Ga0207703_10723273
949 Ga0207703_12001126
950 Ga0207678_10056501
951 Ga0207678_10059208
952 Ga0207678_10257787
953 Ga0207708_10156422
954 Ga0207708_10254041
955 Ga0207708_11274515
956 Ga0207708_11530553
957 Ga0207641_10163573
958 Ga0207641_10293838
959 Ga0207641_10514769
960 Ga0207641_10755818
961 Ga0207641_11148716
962 Ga0207648_10010441
963 Ga0207648_10041855
964 Ga0207676_10020982
965 Ga0207676_10215418
966 Ga0207674_10417900
967 Ga0207675_100013808
968 Ga0207675_100037069
969 Ga0207675_100083194
970 Ga0207675_100341120
971 Ga0207675_100524438
972 Ga0207675_100564921
973 Ga0207675_100762383
974 Ga0207675_101102630
975 Ga0207675_101416266
976 Ga0207683_10155657
977 Ga0207683_10161732
978 Ga0207683_10219682
979 Ga0209971_1029908
980 Ga0207428_10188388
981 Ga0268266_10782570
982 Ga0268265_10065400
983 Ga0268265_10447877
984 Ga0268265_11309434
985 Ga0268265_11375290
986 Ga0268265_12064958
987 Ga0268264_10243992
988 Ga0268264_10804084
989 Ga0307513_10438421
990 Ga0307408_100322364
991 Ga0307413_10588410
992 Ga0307413_11374592
993 Ga0307412_10855103
994 Ga0307416_100237182
995 Ga0373926_0027646
996 Ga0373956_0503199
997 Ga0373957_0308358
998 Ga0373955_0568625
999 Ga0373935_0264045
1000 Ga0373927_0046612
1001 Ga0373933_0113135
1002 Ga0373937_0301959
1003 Ga0373925_0040123
1004 Ga0436364_0192446
1005 Ga0436364_0317997
1006 Ga0436365_0841532
1007 Ga0436365_0982865
1008 Ga0436361_0683315
1009 Ga0436363_0235780
1010 Ga0436363_0611047
1011 Ga0436362_0274195
1012 Ga0436362_1279004
1013 Ga0439453_0009371
1014 Ga0439465_0372762
1015 Ga0451793_0847080
1016 Ga0451807_0392687
1017 Ga0451807_1967097
1018 Ga0450919_043050
1019 Ga0450920_021780
1020 Ga0450923_095145
1021 Ga0450910_045954
1022 Ga0450908_001854
1023 Ga0439435_0028281
1024 Ga0439444_0146896
1025 Ga0495629_0392344
1026 Ga0495651_0881475
1027 Ga0495580_0004230
1028 Ga0495639_0276623
1029 Ga0495584_0459561
1030 Ga0495594_0248586
1031 Ga0495632_0191125
1032 Ga0495598_0066703
1033 Ga0495645_0182210
1034 Ga0495656_0109788
1035 Ga0495668_0184225
1036 Ga0495588_0055933
1037 Ga0495647_0043174
1038 Ga0495581_0467611
1039 Ga0496101_0055217
1040 Ga0496101_0670368
1041 Ga0496104_0027504
1042 Ga0496105_0225074
1043 Ga0496105_0367372
1044 Ga0496106_0083565
1045 Ga0496106_0568997
1046 Ga0496107_0015328
1047 Ga0496108_0380802
1048 Ga0496109_0122399
1049 Ga0496110_1141647
1050 Ga0496113_0039754
1051 Ga0496114_0000407
1052 Ga0496115_0624774
1053 Ga0501031_0514966
1054 Ga0501039_0009871
1055 Ga0501039_0836130
1056 Ga0501040_1319027
1057 Ga0501041_0011149
1058 Ga0501046_0107507
1059 Ga0501048_0265129
1060 Ga0501067_0183929
1061 Ga0501068_0234483
1062 Ga0501071_0183920
1063 Ga0501071_0261249
1064 Ga0501071_0646080
1065 Ga0501072_0905995
1066 Ga0501074_0390845
1067 Ga0501074_0406994
1068 Ga0501074_0431770
1069 Ga0501074_1148697
1070 Ga0501075_0853149
1071 Ga0501075_0913826
1072 Ga0501077_0048016
1073 Ga0501079_0018309
1074 Ga0501079_0147211
1075 Ga0501080_0109532
1076 Ga0501080_0688614
1077 Ga0501081_0007969
1078 Ga0501045_1190929
1079 nmdc:mga03n38_412067_c1
1080 nmdc:mga03n38_429737_c1
1081 nmdc:mga00v17_327237_c1
1082 nmdc:mga00v17_360877_c1
1083 nmdc:mga00v17_37916_c1
1084 nmdc:mga0yw44_342099_c1
1085 nmdc:mga0k408_190772_c1
1086 nmdc:mga0k408_22506_c1
1087 nmdc:mga0k408_487297_c1
1088 nmdc:mga0k408_50789_c1
1089 nmdc:mga0k408_516724_c1
1090 nmdc:mga0k408_78980_c1
1091 nmdc:mga06z11_250920_c1
1092 nmdc:mga06z11_67344_c1
1093 nmdc:mga06z11_709476_c1
1094 nmdc:mga04h51_236182_c1
1095 nmdc:mga07m45_45619_c1
1096 nmdc:mga07m45_86609_c1
1097 nmdc:mga07m45_91093_c1
1098 nmdc:mga05p37_124936_c1
1099 nmdc:mga05p37_134620_c1
1100 nmdc:mga05p37_188539_c1
1101 nmdc:mga05p37_230912_c1
1102 nmdc:mga05p37_2569_c1
1103 nmdc:mga05p37_46586_c1
1104 nmdc:mga09592_1151_c1
1105 nmdc:mga09592_28549_c1
1106 nmdc:mga09592_378660_c1
1107 nmdc:mga09592_434570_c1
1108 nmdc:mga09592_51244_c1
1109 nmdc:mga09592_759414_c1
1110 nmdc:mga0qj67_124003_c2
1111 nmdc:mga0qj67_33216_c1
1112 nmdc:mga0qj67_4437_c1
1113 nmdc:mga0qj67_492000_c1
1114 nmdc:mga06r32_110510_c1
1115 nmdc:mga06r32_302439_c1
1116 nmdc:mga06r32_3433_c1
1117 nmdc:mga06r32_85037_c1
1118 nmdc:mga08y16_139213_c1
1119 nmdc:mga08y16_348862_c1
1120 nmdc:mga08y16_56802_c1
1121 nmdc:mga0n895_1030392_c1
1122 nmdc:mga0n895_191627_c1
1123 nmdc:mga0rr50_1161432_c1
1124 nmdc:mga0a205_1487702_c1
1125 nmdc:mga0a205_22853_c2
1126 nmdc:mga0a205_69640_c1
1127 Ga0495619_0295650
1128 Ga0501084_0048420
1129 Ga0501084_0162376
1130 Ga0501084_0221090
1131 Ga0501082_0079567
1132 Ga0501082_0268058
1133 Ga0530510_0299811
1134 Ga0530510_0849403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14108

ABA4-like

ABA DEFICIENT 4-like

5

128

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.5309 40 130
2wdr-assembly1.cif.gz_D e. coli succinate:quinone oxidoreductase (sqr) with pentachlorophenol bound 0.53 40 130
2ws3-assembly3.cif.gz_D crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd tyr83phe mutant 0.5293 40 130
2wdq-assembly3.cif.gz_H e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound 0.528 40 130
7coy-assembly1.cif.gz_aL structure of the far-red light utilizing photosystem i of acaryochloris marina 0.5151 26 102
ID Description Score Start End Superfamily
af_Q8RXY4_271_371_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6052 3 104 1.20.1280.290
af_Q9CPV7_94_244_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5661 40 108 1.10.287.70
af_Q8RXY4_271_371_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5524 3 104 1.20.1280.290
2wdrL00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.5298 40 130 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.529 40 130 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A7Y4SM66-F1-model_v4 DUF4281 domain-containing protein 0.9969 1 133 GO:0016020
AF-A0A1G6AIU9-F1-model_v4 DUF4281 domain-containing protein 0.986 1 135 GO:0016020
AF-A0A1Q3NTP0-F1-model_v4 deleted 0.9826 2 133
AF-A0A3D4B7T9-F1-model_v4 DUF4281 domain-containing protein 0.9805 39 132 GO:0016020
AF-A0A543NQZ5-F1-model_v4 deleted 0.9798 1 133

Map