F464490

General Info

Members Datasets Scaffolds Average Seq Length
567 280 558 257

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100305037|Ga0068855_1003050373
Length 280
Sequence VTLGGQERSDPGSGLSHPAYGQLRRVTDTASVLLCDNPGLMTLDGTNTWVLQGPGSDEMVIVDPXPDDDEHIGRIASLGKIPLVLISHKHEDHTGAIDKIVDRTGAVVRAVGSGFLRGLGGPLSDGEVIDAAGLRITVMATPGHTADSLSFLVDVWGERSDGRGGAVLTADTVLGRGTTVIDTEDGSLRDYLESLRRLHGLGQRVVLPGHGPELGDLEAVAAMYLAHREERLGQVRDALRVLGEDATARQVVEHVYTDVDEKLWDAAEKSTEAQLTYLRS

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
6 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
7 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
8 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
9 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
184 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
275 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
276 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.76
Nodule 0.18
Rhizoplane 13.05
Rhizosphere 63.84
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001331 3300001977 Bacteria 3934
2 JGI24739J22299_10026914 3300001989 Bacteria 2014
3 JGI24743J22301_10021971 3300001991 Bacteria 1221
4 JGI24750J21931_1002875 3300002070 Bacteria 2068
5 JGI24744J21845_10000036 3300002077 Bacteria 15776
6 JGI24744J21845_10008210 3300002077 Bacteria 2156
7 JGI24034J26672_10029769 3300002239 Bacteria 885
8 JGI24751J29686_10017327 3300002459 Bacteria 1488
9 Ga0055540_1000128 3300003792 Bacteria 77207
10 Ga0055540_1003523 3300003792 Bacteria 7514
11 Ga0055540_1007880 3300003792 Bacteria 3935
12 Ga0055540_1029390 3300003792 Bacteria 1287
13 Ga0070676_10026368 3300005328 Bacteria 3291
14 Ga0070683_100260923 3300005329 Bacteria 1648
15 Ga0070690_100087509 3300005330 Bacteria 2046
16 Ga0068869_100043910 3300005334 Bacteria 3213
17 Ga0070680_100597889 3300005336 Bacteria 947
18 Ga0070682_100010609 3300005337 Bacteria 5233
19 Ga0068868_100004397 3300005338 Bacteria 9879
20 Ga0068868_100137557 3300005338 Bacteria 2003
21 Ga0070660_100027175 3300005339 Bacteria 4268
22 Ga0070660_100578559 3300005339 Bacteria 938
23 Ga0070689_100503171 3300005340 Bacteria 1038
24 Ga0070689_100596503 3300005340 Bacteria 956
25 Ga0070691_10003792 3300005341 Bacteria 6824
26 Ga0070668_100000612 3300005347 Bacteria 23913
27 Ga0070668_100023325 3300005347 Bacteria 4680
28 Ga0070668_100276404 3300005347 Bacteria 1401
29 Ga0070669_100000503 3300005353 Bacteria 29454
30 Ga0070669_100008403 3300005353 Bacteria 7368
31 Ga0070671_100024864 3300005355 Bacteria 4907
32 Ga0070671_100147393 3300005355 Bacteria 1987
33 Ga0070674_100000542 3300005356 Bacteria 18928
34 Ga0070674_100074625 3300005356 Bacteria 2407
35 Ga0070688_100016773 3300005365 Bacteria 4193
36 Ga0070659_100006875 3300005366 Bacteria 8239
37 Ga0070659_100237365 3300005366 Bacteria 1508
38 Ga0070667_100000054 3300005367 Bacteria 151864
39 Ga0070667_100068274 3300005367 Bacteria 3024
40 Ga0070703_10022064 3300005406 Bacteria 1865
41 Ga0070709_10007859 3300005434 Bacteria 5857
42 Ga0070714_100079160 3300005435 Bacteria 2857
43 Ga0070713_100132018 3300005436 Bacteria 2203
44 Ga0070710_10004514 3300005437 Bacteria 6585
45 Ga0070710_10018699 3300005437 Bacteria 3569
46 Ga0070701_10000355 3300005438 Bacteria 15231
47 Ga0070711_100006966 3300005439 Bacteria 6855
48 Ga0070711_100061391 3300005439 Bacteria 2617
49 Ga0070705_100243040 3300005440 Bacteria 1259
50 Ga0070700_100086304 3300005441 Bacteria 2037
51 Ga0070700_100136563 3300005441 Bacteria 1661
52 Ga0070694_100027260 3300005444 Bacteria 3709
53 Ga0070663_100329166 3300005455 Bacteria 1231
54 Ga0070678_100000240 3300005456 Bacteria 25075
55 Ga0070662_100011661 3300005457 Bacteria 5802
56 Ga0070662_100041482 3300005457 Bacteria 3283
57 Ga0070681_10461212 3300005458 Bacteria 1183
58 Ga0068867_100001913 3300005459 Bacteria 14498
59 Ga0068867_100337025 3300005459 Bacteria 1254
60 Ga0070685_10132366 3300005466 Bacteria 1561
61 Ga0070684_100614208 3300005535 Bacteria 1011
62 Ga0068853_100009813 3300005539 Bacteria 7725
63 Ga0070695_100058033 3300005545 Bacteria 2502
64 Ga0070696_100003869 3300005546 Bacteria 9998
65 Ga0070693_100008151 3300005547 Bacteria 5148
66 Ga0070665_100005662 3300005548 Bacteria 12842
67 Ga0070665_100036847 3300005548 Bacteria 4918
68 Ga0070665_100069247 3300005548 Bacteria 3536
69 Ga0070665_100083917 3300005548 Bacteria 3190
70 Ga0070704_100023640 3300005549 Bacteria 4019
71 Ga0068855_100202536 3300005563 Bacteria 2234
72 Ga0068855_100305037 3300005563 Bacteria 1763
73 Ga0070664_100488010 3300005564 Bacteria 1134
74 Ga0068854_100006177 3300005578 Bacteria 7603
75 Ga0068856_100264692 3300005614 Bacteria 1735
76 Ga0070702_100000643 3300005615 Bacteria 12971
77 Ga0068852_100178699 3300005616 Bacteria 1994
78 Ga0068859_100038030 3300005617 Bacteria 4829
79 Ga0068859_100168536 3300005617 Bacteria 2270
80 Ga0068859_100246688 3300005617 Bacteria 1875
81 Ga0068864_100220721 3300005618 Bacteria 1749
82 Ga0068866_10001606 3300005718 Bacteria 9578
83 Ga0068861_100002075 3300005719 Bacteria 12996
84 Ga0068861_100171741 3300005719 Bacteria 1797
85 Ga0068870_10348967 3300005840 Bacteria 949
86 Ga0068863_100026655 3300005841 Bacteria 5511
87 Ga0068863_100101108 3300005841 Bacteria 2740
88 Ga0068863_100503700 3300005841 Bacteria 1192
89 Ga0068858_100006020 3300005842 Bacteria 11829
90 Ga0068858_100020079 3300005842 Bacteria 6249
91 Ga0068858_100686070 3300005842 Bacteria 996
92 Ga0068860_100000246 3300005843 Bacteria 81869
93 Ga0068860_100000986 3300005843 Bacteria 31453
94 Ga0068860_100193334 3300005843 Bacteria 1969
95 Ga0068862_100000024 3300005844 Bacteria 197686
96 Ga0068862_100026059 3300005844 Bacteria 4914
97 Ga0068862_100040538 3300005844 Bacteria 3958
98 Ga0068862_100221035 3300005844 Bacteria 1715
99 Ga0081455_10044246 3300005937 Bacteria 3887
100 Ga0081455_10069414 3300005937 Bacteria 2930
101 Ga0081538_10089489 3300005981 Bacteria 1598
102 Ga0075365_10001760 3300006038 Bacteria 10087
103 Ga0075365_10003855 3300006038 Bacteria 7832
104 Ga0075365_10004009 3300006038 Bacteria 7719
105 Ga0075365_10125455 3300006038 Bacteria 1774
106 Ga0075363_100000617 3300006048 Bacteria 11761
107 Ga0075363_100000889 3300006048 Bacteria 10521
108 Ga0075363_100001162 3300006048 Bacteria 9654
109 Ga0075363_100087858 3300006048 Bacteria 1708
110 Ga0075364_10000442 3300006051 Bacteria 20783
111 Ga0075364_10002781 3300006051 Bacteria 9834
112 Ga0075364_10006806 3300006051 Bacteria 6743
113 Ga0075364_10061147 3300006051 Bacteria 2470
114 Ga0075364_10088435 3300006051 Bacteria 2054
115 Ga0075364_10109947 3300006051 Bacteria 1838
116 Ga0075364_10116214 3300006051 Bacteria 1788
117 Ga0075364_10165052 3300006051 Bacteria 1496
118 Ga0075364_10215278 3300006051 Bacteria 1303
119 Ga0075364_10330098 3300006051 Bacteria 1039
120 Ga0070715_10001419 3300006163 Bacteria 6932
121 Ga0070716_100067343 3300006173 Bacteria 2092
122 Ga0070716_100182416 3300006173 Bacteria 1379
123 Ga0070712_100001832 3300006175 Bacteria 12940
124 Ga0070712_100193410 3300006175 Bacteria 1593
125 Ga0070712_100385927 3300006175 Bacteria 1154
126 Ga0075367_10004774 3300006178 Bacteria 6664
127 Ga0075369_10008637 3300006186 Bacteria 3929
128 Ga0075369_10022055 3300006186 Bacteria 2624
129 Ga0075369_10025646 3300006186 Bacteria 2453
130 Ga0075369_10031921 3300006186 Bacteria 2226
131 Ga0075369_10088139 3300006186 Bacteria 1382
132 Ga0075370_10028907 3300006353 Bacteria 3084
133 Ga0075428_100142898 3300006844 Bacteria 2602
134 Ga0075430_100211572 3300006846 Bacteria 1609
135 Ga0068865_100006081 3300006881 Bacteria 7362
136 Ga0097620_100038030 3300006931 Bacteria 4829
137 Ga0097620_100168536 3300006931 Bacteria 2270
138 Ga0097620_100246708 3300006931 Bacteria 1875
139 Ga0105250_10041987 3300009092 Bacteria 1833
140 Ga0105245_10000550 3300009098 Bacteria 34123
141 Ga0105245_10844809 3300009098 Bacteria 955
142 Ga0105245_10890445 3300009098 Bacteria 931
143 Ga0105247_10000073 3300009101 Bacteria 113714
144 Ga0105247_10000477 3300009101 Bacteria 33443
145 Ga0105247_10109146 3300009101 Bacteria 1778
146 Ga0105247_10278592 3300009101 Bacteria 1153
147 Ga0114129_10028302 3300009147 Bacteria 7940
148 Ga0105243_10001265 3300009148 Bacteria 22712
149 Ga0105243_10194533 3300009148 Bacteria 1774
150 Ga0105241_10011776 3300009174 Bacteria 6424
151 Ga0105242_10000552 3300009176 Bacteria 29645
152 Ga0105248_10000088 3300009177 Bacteria 103505
153 Ga0105248_10002522 3300009177 Bacteria 20377
154 Ga0105248_10122691 3300009177 Bacteria 2931
155 Ga0105248_10445147 3300009177 Bacteria 1460
156 Ga0105237_10004938 3300009545 Bacteria 15240
157 Ga0105237_10011693 3300009545 Bacteria 9284
158 Ga0105238_10024176 3300009551 Bacteria 6195
159 Ga0105249_10000126 3300009553 Bacteria 103461
160 Ga0105249_10001282 3300009553 Bacteria 22065
161 Ga0105249_10002446 3300009553 Bacteria 16120
162 Ga0105249_10114651 3300009553 Bacteria 2552
163 Ga0105147_105718 3300009982 Bacteria 1047
164 Ga0099796_10020122 3300010159 Bacteria 2035
165 Ga0105239_10003697 3300010375 Bacteria 18631
166 Ga0105239_10209312 3300010375 Bacteria 2186
167 Ga0105239_10249003 3300010375 Bacteria 1995
168 Ga0105239_10263228 3300010375 Bacteria 1938
169 Ga0105246_10081470 3300011119 Bacteria 2307
170 Ga0157369_10355282 3300013105 Bacteria 1522
171 Ga0157378_10002494 3300013297 Bacteria 16374
172 Ga0163162_10003098 3300013306 Bacteria 15877
173 Ga0163162_10176374 3300013306 Bacteria 2263
174 Ga0163162_10654078 3300013306 Bacteria 1174
175 Ga0157372_10041447 3300013307 Bacteria 5091
176 Ga0157375_10000957 3300013308 Bacteria 24989
177 Ga0157375_10350244 3300013308 Bacteria 1643
178 Ga0157375_10486874 3300013308 Bacteria 1398
179 Ga0157375_10490284 3300013308 Bacteria 1393
180 Ga0163163_10011130 3300014325 Bacteria 8146
181 Ga0163163_10016288 3300014325 Bacteria 6903
182 Ga0163163_10336008 3300014325 Bacteria 1566
183 Ga0157380_10000206 3300014326 Bacteria 34907
184 Ga0157377_10107030 3300014745 Bacteria 1676
185 Ga0157376_10131720 3300014969 Bacteria 2232
186 Ga0163161_10003884 3300017792 Bacteria 10476
187 Ga0163161_10520670 3300017792 Bacteria 971
188 Ga0213876_10001338 3300021384 Bacteria 15444
189 Ga0213876_10084618 3300021384 Bacteria 1678
190 Ga0213875_10018646 3300021388 Bacteria 3344
191 Ga0213875_10037672 3300021388 Bacteria 2279
192 Ga0209673_1053251 3300025273 Bacteria 1057
193 Ga0209051_1000305 3300025303 Bacteria 77260
194 Ga0209051_1000915 3300025303 Bacteria 29327
195 Ga0209051_1001195 3300025303 Bacteria 23470
196 Ga0209051_1002539 3300025303 Bacteria 12897
197 Ga0209051_1021035 3300025303 Bacteria 2791
198 Ga0207696_1045693 3300025711 Bacteria 1265
199 Ga0207692_10075972 3300025898 Bacteria 1783
200 Ga0207642_10000198 3300025899 Bacteria 17601
201 Ga0207642_10016053 3300025899 Bacteria 2810
202 Ga0207642_10194343 3300025899 Bacteria 1116
203 Ga0207710_10000099 3300025900 Bacteria 113735
204 Ga0207710_10003628 3300025900 Bacteria 6841
205 Ga0207688_10001328 3300025901 Bacteria 12857
206 Ga0207688_10008625 3300025901 Bacteria 5549
207 Ga0207680_10173387 3300025903 Bacteria 1454
208 Ga0207647_10013376 3300025904 Bacteria 5692
209 Ga0207647_10112689 3300025904 Bacteria 1607
210 Ga0207685_10021368 3300025905 Bacteria 2168
211 Ga0207699_10008199 3300025906 Bacteria 5144
212 Ga0207645_10015927 3300025907 Bacteria 4983
213 Ga0207643_10334635 3300025908 Bacteria 948
214 Ga0207707_10676088 3300025912 Bacteria 868
215 Ga0207671_10012097 3300025914 Bacteria 6968
216 Ga0207693_10002328 3300025915 Bacteria 16509
217 Ga0207693_10118056 3300025915 Bacteria 2083
218 Ga0207663_10046886 3300025916 Bacteria 2665
219 Ga0207663_10053188 3300025916 Bacteria 2529
220 Ga0207649_10200066 3300025920 Bacteria 1411
221 Ga0207681_10006366 3300025923 Bacteria 7250
222 Ga0207681_10017597 3300025923 Bacteria 4490
223 Ga0207694_10025538 3300025924 Bacteria 4490
224 Ga0207694_10266277 3300025924 Bacteria 1405
225 Ga0207659_10154693 3300025926 Bacteria 1794
226 Ga0207687_10002843 3300025927 Bacteria 11753
227 Ga0207664_10019094 3300025929 Bacteria 5060
228 Ga0207644_10132476 3300025931 Bacteria 1910
229 Ga0207706_10028700 3300025933 Bacteria 4967
230 Ga0207706_10029573 3300025933 Bacteria 4890
231 Ga0207709_10001153 3300025935 Bacteria 19244
232 Ga0207670_10531221 3300025936 Bacteria 959
233 Ga0207669_10000469 3300025937 Bacteria 17615
234 Ga0207669_10043292 3300025937 Bacteria 2636
235 Ga0207704_10000572 3300025938 Bacteria 16393
236 Ga0207704_10310343 3300025938 Bacteria 1212
237 Ga0207665_10003687 3300025939 Bacteria 10229
238 Ga0207665_10024579 3300025939 Bacteria 3973
239 Ga0207711_10000386 3300025941 Bacteria 46700
240 Ga0207711_10094512 3300025941 Bacteria 2635
241 Ga0207711_10155639 3300025941 Bacteria 2065
242 Ga0207689_10014963 3300025942 Bacteria 6583
243 Ga0207689_10260054 3300025942 Bacteria 1436
244 Ga0207667_10258811 3300025949 Bacteria 1780
245 Ga0207712_10000093 3300025961 Bacteria 103470
246 Ga0207712_10003821 3300025961 Bacteria 9508
247 Ga0207712_10111231 3300025961 Bacteria 2055
248 Ga0207668_10001310 3300025972 Bacteria 14773
249 Ga0207668_10002201 3300025972 Bacteria 11374
250 Ga0207668_10223633 3300025972 Bacteria 1513
251 Ga0207640_10002689 3300025981 Bacteria 9514
252 Ga0207640_10039294 3300025981 Bacteria 2994
253 Ga0207640_10084629 3300025981 Bacteria 2178
254 Ga0207658_10000096 3300025986 Bacteria 98147
255 Ga0207658_10003389 3300025986 Bacteria 11281
256 Ga0207677_10000944 3300026023 Bacteria 16222
257 Ga0207677_10160554 3300026023 Bacteria 1746
258 Ga0207703_10005058 3300026035 Bacteria 10675
259 Ga0207703_10186821 3300026035 Bacteria 1832
260 Ga0207703_10319480 3300026035 Bacteria 1421
261 Ga0207639_10058665 3300026041 Bacteria 2961
262 Ga0207678_10008585 3300026067 Bacteria 9000
263 Ga0207708_10133015 3300026075 Bacteria 1946
264 Ga0207708_10191734 3300026075 Bacteria 1627
265 Ga0207702_10244705 3300026078 Bacteria 1682
266 Ga0207702_10619712 3300026078 Bacteria 1062
267 Ga0207641_10000164 3300026088 Bacteria 93616
268 Ga0207641_10001427 3300026088 Bacteria 23500
269 Ga0207641_10023522 3300026088 Bacteria 5075
270 Ga0207641_10204943 3300026088 Bacteria 1821
271 Ga0207648_10372609 3300026089 Bacteria 1290
272 Ga0207676_10117826 3300026095 Bacteria 2234
273 Ga0207675_100006606 3300026118 Bacteria 10971
274 Ga0207675_100228274 3300026118 Bacteria 1795
275 Ga0207683_10003649 3300026121 Bacteria 13390
276 Ga0207683_10028797 3300026121 Bacteria 4805
277 Ga0268266_10007067 3300028379 Bacteria 10193
278 Ga0268266_10011869 3300028379 Bacteria 7547
279 Ga0268266_10061133 3300028379 Bacteria 3248
280 Ga0268266_10499313 3300028379 Bacteria 1161
281 Ga0268266_10671526 3300028379 Bacteria 998
282 Ga0268265_10000012 3300028380 Bacteria 343132
283 Ga0268265_10145740 3300028380 Bacteria 1989
284 Ga0268264_10000104 3300028381 Bacteria 217837
285 Ga0268264_10000885 3300028381 Bacteria 31559
286 Ga0268264_10089172 3300028381 Bacteria 2655
287 Ga0268264_10177815 3300028381 Bacteria 1930
288 Ga0265327_10002144 3300031251 Bacteria 21784
289 Ga0307405_10043201 3300031731 Bacteria 2748
290 Ga0307413_10007279 3300031824 Bacteria 5126
291 Ga0307413_10644072 3300031824 Bacteria 873
292 Ga0307410_10001244 3300031852 Bacteria 11319
293 Ga0307409_100007355 3300031995 Bacteria 6580
294 Ga0307415_100106207 3300032126 Bacteria 2072
295 Ga0373951_0084038 3300035091 Bacteria 827
296 Ga0373955_0380796 3300035172 Bacteria 856
297 Ga0373931_0105860 3300035691 Bacteria 1589
298 Ga0373935_0289485 3300035692 Bacteria 1155
299 Ga0373947_0317874 3300035725 Bacteria 1041
300 Ga0436364_0636171 3300037853 Bacteria 12590
301 Ga0436364_0718930 3300037853 Bacteria 3527
302 Ga0436364_0839437 3300037853 Bacteria 1159
303 Ga0436364_1341984 3300037853 Bacteria 4577
304 Ga0436365_0065786 3300039437 Bacteria 16053
305 Ga0436365_0095204 3300039437 Bacteria 1890
306 Ga0436365_1041061 3300039437 Bacteria 87934
307 Ga0436365_1482123 3300039437 Bacteria 3645
308 Ga0436365_1488292 3300039437 Bacteria 1403
309 Ga0436365_1878623 3300039437 Bacteria 4636
310 Ga0436361_0026174 3300039447 Bacteria 994
311 Ga0436363_0364332 3300039450 Bacteria 2077
312 Ga0439466_0014229 3300041411 Bacteria 2900
313 Ga0439466_0018038 3300041411 Bacteria 2536
314 Ga0439465_0004754 3300041413 Bacteria 4377
315 Ga0451793_1219293 3300041452 Bacteria 4418
316 Ga0451795_0217691 3300041456 Bacteria 1545
317 Ga0451853_0703928 3300041512 Bacteria 1733
318 Ga0439431_0006954 3300041997 Bacteria 2517
319 Ga0439435_0015936 3300042436 Bacteria 1877
320 Ga0466972_0025208 3300044658 Bacteria 2949
321 Ga0466972_0028299 3300044658 Bacteria 2765
322 Ga0466972_0042512 3300044658 Bacteria 2209
323 Ga0466972_0053152 3300044658 Bacteria 1951
324 Ga0466965_0031369 3300044683 Bacteria 2591
325 Ga0466966_0008762 3300044684 Bacteria 6698
326 Ga0466966_0021213 3300044684 Bacteria 4266
327 Ga0466961_0005380 3300044693 Bacteria 8057
328 Ga0466964_0017279 3300044706 Bacteria 2760
329 Ga0466964_0049714 3300044706 Bacteria 1717
330 Ga0466971_0021210 3300044719 Bacteria 2890
331 Ga0466968_0003727 3300044735 Bacteria 5651
332 Ga0466968_0012387 3300044735 Bacteria 3338
333 Ga0466970_0170370 3300044765 Bacteria 1206
334 Ga0466957_0002195 3300044842 Bacteria 10462
335 Ga0466957_0012311 3300044842 Bacteria 4952
336 Ga0466957_0019571 3300044842 Bacteria 3982
337 Ga0466957_0276237 3300044842 Bacteria 1123
338 Ga0466960_0000049 3300044901 Bacteria 39790
339 Ga0466960_0010081 3300044901 Bacteria 3915
340 Ga0466960_0025588 3300044901 Bacteria 2671
341 Ga0466960_0196977 3300044901 Bacteria 1099
342 Ga0466959_0001637 3300045049 Bacteria 13837
343 Ga0466959_0019063 3300045049 Bacteria 5043
344 Ga0466959_0029222 3300045049 Bacteria 4084
345 Ga0466958_0001405 3300045836 Bacteria 11385
346 Ga0466958_0069018 3300045836 Bacteria 2161
347 Ga0466958_0234601 3300045836 Bacteria 1172
348 Ga0466967_0007714 3300045976 Bacteria 7801
349 Ga0466967_0009033 3300045976 Bacteria 7366
350 Ga0466967_0029240 3300045976 Bacteria 4610
351 Ga0466967_0186261 3300045976 Bacteria 1960
352 Ga0466967_0191221 3300045976 Bacteria 1934
353 Ga0466967_0228656 3300045976 Bacteria 1770
354 Ga0466967_0258348 3300045976 Bacteria 1666
355 Ga0466967_0433903 3300045976 Bacteria 1282
356 Ga0466967_0501947 3300045976 Bacteria 1191
357 Ga0466967_0541518 3300045976 Bacteria 1145
358 Ga0495629_0015395 3300046459 Bacteria 5493
359 Ga0495638_0044489 3300046460 Bacteria 2796
360 Ga0495638_0074298 3300046460 Bacteria 2073
361 Ga0495639_0125189 3300046475 Bacteria 1228
362 Ga0495606_0028973 3300046507 Bacteria 3895
363 Ga0495644_0109509 3300046523 Bacteria 1048
364 Ga0495648_0031033 3300046524 Bacteria 3524
365 Ga0495654_0039254 3300046530 Bacteria 2364
366 Ga0495635_0050893 3300046663 Bacteria 2855
367 Ga0495658_0010953 3300046683 Bacteria 4547
368 Ga0495581_0100170 3300047315 Bacteria 1683
369 Ga0495672_0004621 3300047320 Bacteria 11172
370 Ga0495672_0062044 3300047320 Bacteria 2152
371 Ga0495676_0068959 3300047321 Bacteria 2730
372 Ga0495673_0000739 3300047469 Bacteria 31175
373 Ga0495686_0005119 3300047472 Bacteria 10476
374 Ga0495686_0010294 3300047472 Bacteria 6661
375 Ga0496100_0000021 3300048903 Bacteria 140074
376 Ga0496100_0000176 3300048903 Bacteria 35625
377 Ga0496100_0007574 3300048903 Bacteria 6000
378 Ga0496100_0254206 3300048903 Bacteria 1301
379 Ga0496100_0322637 3300048903 Bacteria 1160
380 Ga0496101_0000043 3300048904 Bacteria 161643
381 Ga0496101_0000071 3300048904 Bacteria 119709
382 Ga0496101_0000910 3300048904 Bacteria 17422
383 Ga0496101_0061464 3300048904 Bacteria 2728
384 Ga0496101_0067751 3300048904 Bacteria 2607
385 Ga0496101_0098819 3300048904 Bacteria 2181
386 Ga0496101_0099009 3300048904 Bacteria 2179
387 Ga0496102_0000026 3300048905 Bacteria 227176
388 Ga0496102_0000133 3300048905 Bacteria 101632
389 Ga0496102_0002253 3300048905 Bacteria 16518
390 Ga0496102_0008456 3300048905 Bacteria 8824
391 Ga0496102_0012410 3300048905 Bacteria 7372
392 Ga0496102_0051223 3300048905 Bacteria 3761
393 Ga0496102_0229705 3300048905 Bacteria 1749
394 Ga0496102_0276234 3300048905 Bacteria 1583
395 Ga0496103_0000023 3300048906 Bacteria 227174
396 Ga0496103_0000410 3300048906 Bacteria 38075
397 Ga0496103_0000421 3300048906 Bacteria 37035
398 Ga0496103_0001048 3300048906 Bacteria 19317
399 Ga0496103_0044040 3300048906 Bacteria 2749
400 Ga0496104_0024378 3300048907 Bacteria 5565
401 Ga0496104_0030688 3300048907 Bacteria 4996
402 Ga0496104_0186816 3300048907 Bacteria 1983
403 Ga0496104_0316378 3300048907 Bacteria 1474
404 Ga0496104_0542124 3300048907 Bacteria 1074
405 Ga0496105_0010447 3300048908 Bacteria 7298
406 Ga0496105_0417456 3300048908 Bacteria 1063
407 Ga0496106_0002575 3300048909 Bacteria 13503
408 Ga0496106_0004008 3300048909 Bacteria 11008
409 Ga0496106_0004169 3300048909 Bacteria 10777
410 Ga0496106_0014348 3300048909 Bacteria 5854
411 Ga0496106_0025293 3300048909 Bacteria 4417
412 Ga0496106_0058966 3300048909 Bacteria 2907
413 Ga0496107_0006173 3300048910 Bacteria 8231
414 Ga0496107_0009575 3300048910 Bacteria 6720
415 Ga0496107_0011924 3300048910 Bacteria 6069
416 Ga0496107_0046645 3300048910 Bacteria 3118
417 Ga0496107_0057810 3300048910 Bacteria 2804
418 Ga0496108_0000541 3300048911 Bacteria 29566
419 Ga0496108_0001274 3300048911 Bacteria 19729
420 Ga0496108_0024033 3300048911 Bacteria 5017
421 Ga0496108_0032477 3300048911 Bacteria 4336
422 Ga0496108_0051545 3300048911 Bacteria 3448
423 Ga0496108_0142876 3300048911 Bacteria 2062
424 Ga0496109_0000308 3300048912 Bacteria 46150
425 Ga0496109_0000822 3300048912 Bacteria 25887
426 Ga0496109_0178906 3300048912 Bacteria 1991
427 Ga0496109_0220373 3300048912 Bacteria 1784
428 Ga0496109_0538781 3300048912 Bacteria 1101
429 Ga0496110_0037112 3300048913 Bacteria 4234
430 Ga0496110_0070593 3300048913 Bacteria 3095
431 Ga0496111_0008116 3300048914 Bacteria 6935
432 Ga0496111_0177909 3300048914 Bacteria 1581
433 Ga0496112_0003772 3300048915 Bacteria 12648
434 Ga0496112_0040966 3300048915 Bacteria 4530
435 Ga0496112_0056214 3300048915 Bacteria 3872
436 Ga0496112_0073525 3300048915 Bacteria 3379
437 Ga0496113_0003363 3300048916 Bacteria 9557
438 Ga0496113_0004604 3300048916 Bacteria 8503
439 Ga0496113_0108527 3300048916 Bacteria 2158
440 Ga0496114_0000052 3300048917 Bacteria 101539
441 Ga0496114_0001069 3300048917 Bacteria 20603
442 Ga0496114_0004138 3300048917 Bacteria 11223
443 Ga0496114_0280192 3300048917 Bacteria 1470
444 Ga0496115_0000351 3300048918 Bacteria 38720
445 Ga0496115_0002431 3300048918 Bacteria 13370
446 Ga0496115_0004793 3300048918 Bacteria 9815
447 Ga0496116_0000018 3300048919 Bacteria 545877
448 Ga0496116_0000799 3300048919 Bacteria 39896
449 Ga0496116_0049588 3300048919 Bacteria 2805
450 Ga0496117_0000015 3300048920 Bacteria 583316
451 Ga0496117_0002015 3300048920 Bacteria 26922
452 Ga0496117_0023942 3300048920 Bacteria 4847
453 Ga0496118_0000012 3300048921 Bacteria 583316
454 Ga0496118_0000295 3300048921 Bacteria 86668
455 Ga0496118_0000825 3300048921 Bacteria 49332
456 Ga0496118_0050623 3300048921 Bacteria 3185
457 Ga0496119_0000238 3300048922 Bacteria 77684
458 Ga0496119_0007632 3300048922 Bacteria 9700
459 Ga0496119_0008330 3300048922 Bacteria 9137
460 Ga0496119_0072866 3300048922 Bacteria 2005
461 Ga0496120_0000352 3300048923 Bacteria 75803
462 Ga0496120_0035234 3300048923 Bacteria 2992
463 Ga0496121_0000002 3300048924 Bacteria 1494588
464 Ga0496121_0000062 3300048924 Bacteria 274819
465 Ga0496121_0001660 3300048924 Bacteria 36727
466 Ga0496121_0085278 3300048924 Bacteria 2487
467 Ga0496122_0000048 3300048925 Bacteria 269532
468 Ga0496122_0015720 3300048925 Bacteria 7216
469 Ga0496124_0000002 3300048927 Bacteria 1494588
470 Ga0496125_0000002 3300048928 Bacteria 1480920
471 Ga0496125_0049706 3300048928 Bacteria 3480
472 Ga0496126_0000009 3300048929 Bacteria 750350
473 Ga0496126_0000227 3300048929 Bacteria 122133
474 Ga0496126_0002056 3300048929 Bacteria 28267
475 Ga0496126_0003125 3300048929 Bacteria 21349
476 Ga0501032_0001315 3300049569 Bacteria 19909
477 Ga0501032_0003186 3300049569 Bacteria 12624
478 Ga0501033_0005654 3300049570 Bacteria 9876
479 Ga0501033_0062952 3300049570 Bacteria 2731
480 Ga0501034_0024479 3300049571 Bacteria 6142
481 Ga0501036_0005200 3300049572 Bacteria 10523
482 Ga0501036_0016844 3300049572 Bacteria 6105
483 Ga0501037_0000898 3300049573 Bacteria 22178
484 Ga0501037_0003607 3300049573 Bacteria 11219
485 Ga0501038_0256612 3300049574 Bacteria 1383
486 Ga0501039_0000130 3300049575 Bacteria 52419
487 Ga0501043_0005985 3300049579 Bacteria 9776
488 Ga0501043_0112604 3300049579 Bacteria 2136
489 Ga0501046_0009717 3300049580 Bacteria 8297
490 Ga0501046_0207575 3300049580 Bacteria 1455
491 Ga0501047_0001766 3300049581 Bacteria 20901
492 Ga0501047_0009655 3300049581 Bacteria 9120
493 Ga0501047_0272729 3300049581 Bacteria 1538
494 Ga0501048_0001594 3300049582 Bacteria 17223
495 Ga0501069_0047676 3300049585 Bacteria 2378
496 Ga0501070_0001879 3300049586 Bacteria 18565
497 Ga0501070_0009592 3300049586 Bacteria 8177
498 Ga0501070_0064189 3300049586 Bacteria 3041
499 Ga0501071_0082108 3300049587 Bacteria 2360
500 Ga0501073_0082965 3300049589 Bacteria 2230
501 Ga0501080_0023016 3300049742 Bacteria 5778
502 Ga0501080_0042303 3300049742 Bacteria 4243
503 Ga0501080_0639857 3300049742 Bacteria 942
504 Ga0501035_0000834 3300049822 Bacteria 32953
505 Ga0501035_0528897 3300049822 Bacteria 968
506 Ga0501044_0000388 3300049823 Bacteria 54487
507 Ga0501044_0006239 3300049823 Bacteria 13181
508 Ga0501044_0008193 3300049823 Bacteria 11468
509 Ga0501044_0033302 3300049823 Bacteria 5416
510 Ga0501045_0370604 3300049824 Bacteria 1066
511 nmdc:mga03n38_105291_c1 3300050490 Bacteria 1366
512 nmdc:mga03n38_1795_c1 3300050490 Bacteria 6365
513 nmdc:mga03n38_2219_c1 3300050490 Bacteria 5931
514 nmdc:mga03n38_6069_c1 3300050490 Bacteria 4170
515 nmdc:mga00v17_1070_c1 3300050491 Bacteria 14406
516 nmdc:mga00v17_11326_c1 3300050491 Bacteria 4903
517 nmdc:mga00v17_116379_c1 3300050491 Bacteria 1167
518 nmdc:mga00v17_168871_c1 3300050491 Bacteria 1410
519 nmdc:mga00v17_182031_c1 3300050491 Bacteria 1356
520 nmdc:mga00v17_2717_c1 3300050491 Bacteria 9083
521 nmdc:mga00v17_515187_c1 3300050491 Bacteria 775
522 nmdc:mga00v17_5316_c1 3300050491 Bacteria 6782
523 nmdc:mga0yw44_17379_c1 3300050492 Bacteria 3913
524 nmdc:mga0yw44_294289_c1 3300050492 Bacteria 1087
525 nmdc:mga0yw44_311305_c1 3300050492 Bacteria 1056
526 nmdc:mga0yw44_70697_c1 3300050492 Bacteria 2165
527 nmdc:mga0yw44_758_c1 3300050492 Bacteria 11976
528 nmdc:mga0k408_237468_c1 3300050493 Bacteria 1088
529 nmdc:mga06z11_10067_c1 3300050494 Bacteria 4012
530 nmdc:mga06z11_83641_c1 3300050494 Bacteria 1718
531 nmdc:mga04h51_91256_c1 3300050495 Bacteria 1096
532 nmdc:mga07m45_126811_c1 3300050496 Bacteria 1476
533 nmdc:mga07m45_157859_c1 3300050496 Bacteria 1316
534 nmdc:mga07m45_2105_c1 3300050496 Bacteria 9255
535 nmdc:mga07m45_260533_c1 3300050496 Bacteria 1009
536 nmdc:mga05p37_102075_c1 3300050507 Bacteria 3532
537 nmdc:mga0qj67_21879_c1 3300050509 Bacteria 4906
538 nmdc:mga08y16_857835_c1 3300050511 Bacteria 897
539 nmdc:mga0sz30_1254_c1 3300050516 Bacteria 9065
540 nmdc:mga0sz30_27484_c1 3300050516 Bacteria 2337
541 nmdc:mga0sz30_3078_c1 3300050516 Bacteria 5973
542 nmdc:mga0sz30_49022_c1 3300050516 Bacteria 1219
543 nmdc:mga0sz30_8324_c2 3300050516 Bacteria 3555
544 nmdc:mga0sz30_966_c3 3300050516 Bacteria 5425
545 Ga0500635_0000793 3300053080 Bacteria 7843
546 Ga0500643_001006 3300053087 Bacteria 17262
547 Ga0500643_028398 3300053087 Bacteria 1731
548 Ga0500643_028739 3300053087 Bacteria 1717
549 Ga0500641_0063686 3300053096 Bacteria 1539
550 Ga0500556_0005321 3300053104 Bacteria 3639
551 Ga0500642_0059270 3300053130 Bacteria 1714
552 Ga0500652_000692 3300053131 Bacteria 11466
553 Ga0500616_0002446 3300053153 Bacteria 15432
554 Ga0500616_0030461 3300053153 Bacteria 2963
555 Ga0500616_0112772 3300053153 Bacteria 1311
556 Ga0500627_0168920 3300053158 Bacteria 986
557 Ga0501084_0079105 3300054114 Bacteria 2756
558 Ga0466962_0016386 3300061719 Bacteria 3574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0015720 Ga0496122_0015720_10_705 221
2 3300048903 Ga0496100_0000021 Ga0496100_0000021_137807_138580 225
3 3300048904 Ga0496101_0000043 Ga0496101_0000043_6560_7333 225
4 3300048905 Ga0496102_0012410 Ga0496102_0012410_2471_3244 225
5 3300048906 Ga0496103_0000410 Ga0496103_0000410_8778_9551 225
6 3300048909 Ga0496106_0025293 Ga0496106_0025293_3113_3886 225
7 3300048910 Ga0496107_0009575 Ga0496107_0009575_3490_4263 225
8 3300048911 Ga0496108_0001274 Ga0496108_0001274_3710_4483 225
9 3300048912 Ga0496109_0000308 Ga0496109_0000308_28567_29340 225
10 3300048913 Ga0496110_0037112 Ga0496110_0037112_2197_2970 225
11 3300048914 Ga0496111_0008116 Ga0496111_0008116_2062_2835 225
12 3300048917 Ga0496114_0000052 Ga0496114_0000052_25712_26485 225
13 3300048918 Ga0496115_0004793 Ga0496115_0004793_3789_4562 225
14 3300048919 Ga0496116_0000799 Ga0496116_0000799_20906_21679 225
15 3300048920 Ga0496117_0023942 Ga0496117_0023942_2398_3171 225
16 3300048921 Ga0496118_0050623 Ga0496118_0050623_736_1509 225
17 3300048922 Ga0496119_0008330 Ga0496119_0008330_6231_7004 225
18 3300048923 Ga0496120_0035234 Ga0496120_0035234_814_1587 225
19 3300048924 Ga0496121_0000002 Ga0496121_0000002_154323_155096 225
20 3300048925 Ga0496122_0000048 Ga0496122_0000048_112769_113542 225
21 3300048927 Ga0496124_0000002 Ga0496124_0000002_1339493_1340266 225
22 3300048928 Ga0496125_0000002 Ga0496125_0000002_154323_155096 225
23 3300048929 Ga0496126_0000009 Ga0496126_0000009_595255_596028 225
24 3300045976 Ga0466967_0186261 Ga0466967_0186261_490_1212 226
25 3300013308 Ga0157375_10490284 Ga0157375_104902842 230
26 3300035091 Ga0373951_0084038 Ga0373951_0084038_22_714 230
27 3300039437 Ga0436365_1878623 Ga0436365_1878623_3929_4624 230
28 3300044706 Ga0466964_0049714 Ga0466964_0049714_1003_1695 230
29 3300046507 Ga0495606_0028973 Ga0495606_0028973_20_742 230
30 3300046523 Ga0495644_0109509 Ga0495644_0109509_336_1028 230
31 3300050491 nmdc:mga00v17_515187_c1 nmdc:mga00v17_515187_c1_19_714 230
32 3300050492 nmdc:mga0yw44_311305_c1 nmdc:mga0yw44_311305_c1_23_715 230
33 3300053087 Ga0500643_028739 Ga0500643_028739_958_1650 230
34 3300053096 Ga0500641_0063686 Ga0500641_0063686_42_734 230
35 3300053130 Ga0500642_0059270 Ga0500642_0059270_56_748 230
36 3300053153 Ga0500616_0030461 Ga0500616_0030461_659_1396 237
37 3300006051 Ga0075364_10088435 Ga0075364_100884354 239
38 3300010159 Ga0099796_10020122 Ga0099796_100201224 239
39 3300048916 Ga0496113_0108527 Ga0496113_0108527_1423_2142 239
40 3300045049 Ga0466959_0019063 Ga0466959_0019063_689_1459 241
41 3300025981 Ga0207640_10039294 Ga0207640_100392944 242
42 3300044658 Ga0466972_0028299 Ga0466972_0028299_320_1090 243
43 3300044735 Ga0466968_0003727 Ga0466968_0003727_1936_2706 243
44 3300044765 Ga0466970_0170370 Ga0466970_0170370_227_997 243
45 3300044842 Ga0466957_0002195 Ga0466957_0002195_370_1140 243
46 3300044901 Ga0466960_0025588 Ga0466960_0025588_182_952 243
47 3300045976 Ga0466967_0191221 Ga0466967_0191221_152_922 243
48 3300031251 Ga0265327_10002144 Ga0265327_1000214417 244
49 3300048912 Ga0496109_0538781 Ga0496109_0538781_87_863 244
50 3300048915 Ga0496112_0040966 Ga0496112_0040966_1710_2486 244
51 3300048916 Ga0496113_0004604 Ga0496113_0004604_202_978 244
52 3300002239 JGI24034J26672_10029769 JGI24034J26672_100297691 245
53 3300005617 Ga0068859_100246688 Ga0068859_1002466884 245
54 3300005841 Ga0068863_100101108 Ga0068863_1001011081 245
55 3300006038 Ga0075365_10125455 Ga0075365_101254553 245
56 3300006931 Ga0097620_100246708 Ga0097620_1002467082 245
57 3300009177 Ga0105248_10445147 Ga0105248_104451473 245
58 3300009553 Ga0105249_10000126 Ga0105249_1000012628 245
59 3300009553 Ga0105249_10002446 Ga0105249_1000244611 245
60 3300010375 Ga0105239_10263228 Ga0105239_102632282 245
61 3300013306 Ga0163162_10654078 Ga0163162_106540782 245
62 3300025961 Ga0207712_10111231 Ga0207712_101112312 245
63 3300026088 Ga0207641_10204943 Ga0207641_102049432 245
64 3300037853 Ga0436364_0636171 Ga0436364_0636171_9098_9838 245
65 3300048904 Ga0496101_0067751 Ga0496101_0067751_780_1547 245
66 3300048905 Ga0496102_0000133 Ga0496102_0000133_74945_75712 245
67 3300048906 Ga0496103_0000421 Ga0496103_0000421_5322_6089 245
68 3300048910 Ga0496107_0057810 Ga0496107_0057810_820_1587 245
69 3300048911 Ga0496108_0024033 Ga0496108_0024033_689_1465 245
70 3300048911 Ga0496108_0032477 Ga0496108_0032477_702_1469 245
71 3300048919 Ga0496116_0049588 Ga0496116_0049588_260_1027 245
72 3300048920 Ga0496117_0002015 Ga0496117_0002015_235_1002 245
73 3300048921 Ga0496118_0000825 Ga0496118_0000825_33033_33800 245
74 3300048922 Ga0496119_0007632 Ga0496119_0007632_6539_7306 245
75 3300048924 Ga0496121_0001660 Ga0496121_0001660_25913_26680 245
76 3300048928 Ga0496125_0049706 Ga0496125_0049706_2436_3203 245
77 3300009545 Ga0105237_10011693 Ga0105237_100116937 246
78 3300010375 Ga0105239_10209312 Ga0105239_102093123 246
79 3300025914 Ga0207671_10012097 Ga0207671_100120975 246
80 3300045976 Ga0466967_0228656 Ga0466967_0228656_408_1181 246
81 3300047472 Ga0495686_0005119 Ga0495686_0005119_1117_1923 248
82 3300049579 Ga0501043_0112604 Ga0501043_0112604_494_1240 248
83 3300050492 nmdc:mga0yw44_758_c1 nmdc:mga0yw44_758_c1_6148_6894 248
84 3300005347 Ga0070668_100023325 Ga0070668_1000233257 249
85 3300025972 Ga0207668_10002201 Ga0207668_100022017 249
86 3300035172 Ga0373955_0380796 Ga0373955_0380796_92_841 249
87 3300046460 Ga0495638_0044489 Ga0495638_0044489_1752_2525 249
88 3300046475 Ga0495639_0125189 Ga0495639_0125189_214_963 249
89 3300047315 Ga0495581_0100170 Ga0495581_0100170_797_1546 249
90 3300048921 Ga0496118_0000295 Ga0496118_0000295_62119_62871 249
91 3300048922 Ga0496119_0072866 Ga0496119_0072866_1084_1863 249
92 3300053158 Ga0500627_0168920 Ga0500627_0168920_193_969 249
93 3300003792 Ga0055540_1003523 Ga0055540_10035238 250
94 3300003792 Ga0055540_1029390 Ga0055540_10293901 250
95 3300005340 Ga0070689_100503171 Ga0070689_1005031711 250
96 3300005356 Ga0070674_100074625 Ga0070674_1000746254 250
97 3300006051 Ga0075364_10165052 Ga0075364_101650522 250
98 3300006186 Ga0075369_10088139 Ga0075369_100881392 250
99 3300009177 Ga0105248_10002522 Ga0105248_100025226 250
100 3300013308 Ga0157375_10350244 Ga0157375_103502442 250
101 3300025303 Ga0209051_1001195 Ga0209051_10011956 250
102 3300025303 Ga0209051_1002539 Ga0209051_100253914 250
103 3300025937 Ga0207669_10043292 Ga0207669_100432922 250
104 3300025941 Ga0207711_10094512 Ga0207711_100945124 250
105 3300048903 Ga0496100_0000176 Ga0496100_0000176_3848_4693 250
106 3300048904 Ga0496101_0061464 Ga0496101_0061464_774_1619 250
107 3300048907 Ga0496104_0024378 Ga0496104_0024378_2333_3178 250
108 3300048908 Ga0496105_0010447 Ga0496105_0010447_4442_5287 250
109 3300048909 Ga0496106_0014348 Ga0496106_0014348_3775_4620 250
110 3300048910 Ga0496107_0006173 Ga0496107_0006173_3713_4558 250
111 3300048917 Ga0496114_0004138 Ga0496114_0004138_1525_2370 250
112 3300048918 Ga0496115_0000351 Ga0496115_0000351_28846_29691 250
113 3300050491 nmdc:mga00v17_182031_c1 nmdc:mga00v17_182031_c1_122_916 250
114 3300050496 nmdc:mga07m45_157859_c1 nmdc:mga07m45_157859_c1_78_872 250
115 3300050516 nmdc:mga0sz30_27484_c1 nmdc:mga0sz30_27484_c1_100_894 250
116 3300046524 Ga0495648_0031033 Ga0495648_0031033_1242_2018 251
117 3300046530 Ga0495654_0039254 Ga0495654_0039254_866_1642 251
118 3300047320 Ga0495672_0004621 Ga0495672_0004621_3410_4186 251
119 3300047469 Ga0495673_0000739 Ga0495673_0000739_28893_29669 251
120 3300050496 nmdc:mga07m45_126811_c1 nmdc:mga07m45_126811_c1_307_1083 252
121 iso_pu_bacteria 2738541264 2738664067 252
122 iso_pu_bacteria 2738541356 2739143202 252
123 iso_pu_bacteria 2902837492 2902842717 252
124 3300049586 Ga0501070_0064189 Ga0501070_0064189_1430_2206 253
125 3300049742 Ga0501080_0023016 Ga0501080_0023016_4345_5121 253
126 3300053087 Ga0500643_001006 Ga0500643_001006_4253_5065 253
127 iso_pu_bacteria 2738541274 2738703419 253
128 iso_pu_bacteria 2738543028 2739329120 253
129 iso_pu_bacteria 2902792274 2902795539 254
130 3300053080 Ga0500635_0000793 Ga0500635_0000793_2632_3399 255
131 3300053131 Ga0500652_000692 Ga0500652_000692_8692_9459 255
132 iso_pu_bacteria 2643221687 2644488572 255
133 iso_pu_bacteria 2842134933 2842136374 255
134 3300003792 Ga0055540_1000128 Ga0055540_100012843 256
135 3300003792 Ga0055540_1007880 Ga0055540_10078805 256
136 3300005329 Ga0070683_100260923 Ga0070683_1002609232 256
137 3300005337 Ga0070682_100010609 Ga0070682_1000106093 256
138 3300005339 Ga0070660_100578559 Ga0070660_1005785591 256
139 3300005435 Ga0070714_100079160 Ga0070714_1000791602 256
140 3300005436 Ga0070713_100132018 Ga0070713_1001320183 256
141 3300005564 Ga0070664_100488010 Ga0070664_1004880102 256
142 3300006038 Ga0075365_10003855 Ga0075365_100038557 256
143 3300006051 Ga0075364_10330098 Ga0075364_103300981 256
144 3300009551 Ga0105238_10024176 Ga0105238_100241765 256
145 3300013105 Ga0157369_10355282 Ga0157369_103552822 256
146 3300025273 Ga0209673_1053251 Ga0209673_10532512 256
147 3300025303 Ga0209051_1000305 Ga0209051_100030544 256
148 3300025303 Ga0209051_1000915 Ga0209051_10009153 256
149 3300025303 Ga0209051_1021035 Ga0209051_10210354 256
150 3300025899 Ga0207642_10194343 Ga0207642_101943431 256
151 3300025920 Ga0207649_10200066 Ga0207649_102000662 256
152 3300025924 Ga0207694_10025538 Ga0207694_100255386 256
153 3300025929 Ga0207664_10019094 Ga0207664_100190946 256
154 3300025981 Ga0207640_10084629 Ga0207640_100846292 256
155 3300026067 Ga0207678_10008585 Ga0207678_100085854 256
156 3300039437 Ga0436365_1488292 Ga0436365_1488292_512_1297 256
157 3300039447 Ga0436361_0026174 Ga0436361_0026174_26_808 256
158 3300041452 Ga0451793_1219293 Ga0451793_1219293_1680_2450 256
159 3300041456 Ga0451795_0217691 Ga0451795_0217691_419_1189 256
160 3300041512 Ga0451853_0703928 Ga0451853_0703928_338_1108 256
161 3300044684 Ga0466966_0008762 Ga0466966_0008762_685_1479 256
162 3300044842 Ga0466957_0012311 Ga0466957_0012311_1109_1903 256
163 3300045049 Ga0466959_0001637 Ga0466959_0001637_5152_5946 256
164 3300045836 Ga0466958_0069018 Ga0466958_0069018_175_969 256
165 3300045976 Ga0466967_0501947 Ga0466967_0501947_146_919 256
166 3300046663 Ga0495635_0050893 Ga0495635_0050893_212_988 256
167 3300047472 Ga0495686_0010294 Ga0495686_0010294_5823_6614 256
168 3300048903 Ga0496100_0007574 Ga0496100_0007574_3779_4549 256
169 3300048903 Ga0496100_0254206 Ga0496100_0254206_181_981 256
170 3300048904 Ga0496101_0000910 Ga0496101_0000910_3184_3954 256
171 3300048904 Ga0496101_0098819 Ga0496101_0098819_1222_2022 256
172 3300048905 Ga0496102_0002253 Ga0496102_0002253_8821_9591 256
173 3300048906 Ga0496103_0001048 Ga0496103_0001048_11308_12078 256
174 3300048907 Ga0496104_0316378 Ga0496104_0316378_301_1071 256
175 3300048909 Ga0496106_0004169 Ga0496106_0004169_2957_3727 256
176 3300048910 Ga0496107_0011924 Ga0496107_0011924_472_1242 256
177 3300048911 Ga0496108_0051545 Ga0496108_0051545_2422_3192 256
178 3300048912 Ga0496109_0178906 Ga0496109_0178906_873_1643 256
179 3300048915 Ga0496112_0003772 Ga0496112_0003772_7787_8557 256
180 3300048915 Ga0496112_0073525 Ga0496112_0073525_1084_1884 256
181 3300048916 Ga0496113_0003363 Ga0496113_0003363_7078_7878 256
182 3300048917 Ga0496114_0001069 Ga0496114_0001069_7354_8124 256
183 3300048918 Ga0496115_0002431 Ga0496115_0002431_1914_2684 256
184 3300048929 Ga0496126_0002056 Ga0496126_0002056_7998_8798 256
185 3300050490 nmdc:mga03n38_6069_c1 nmdc:mga03n38_6069_c1_2995_3768 256
186 3300050491 nmdc:mga00v17_5316_c1 nmdc:mga00v17_5316_c1_5810_6583 256
187 3300006048 Ga0075363_100000617 Ga0075363_1000006172 257
188 3300006051 Ga0075364_10000442 Ga0075364_100004426 257
189 3300006186 Ga0075369_10008637 Ga0075369_100086374 257
190 3300021388 Ga0213875_10037672 Ga0213875_100376722 257
191 3300037853 Ga0436364_1341984 Ga0436364_1341984_556_1347 257
192 3300046460 Ga0495638_0074298 Ga0495638_0074298_992_1765 257
193 3300047320 Ga0495672_0062044 Ga0495672_0062044_1116_1889 257
194 3300050516 nmdc:mga0sz30_966_c3 nmdc:mga0sz30_966_c3_3377_4168 257
195 3300053104 Ga0500556_0005321 Ga0500556_0005321_810_1583 257
196 3300001977 JGI24746J21847_1001331 JGI24746J21847_10013313 258
197 3300001989 JGI24739J22299_10026914 JGI24739J22299_100269143 258
198 3300001991 JGI24743J22301_10021971 JGI24743J22301_100219712 258
199 3300002070 JGI24750J21931_1002875 JGI24750J21931_10028753 258
200 3300002077 JGI24744J21845_10000036 JGI24744J21845_100000367 258
201 3300002077 JGI24744J21845_10008210 JGI24744J21845_100082102 258
202 3300002459 JGI24751J29686_10017327 JGI24751J29686_100173272 258
203 3300005328 Ga0070676_10026368 Ga0070676_100263684 258
204 3300005330 Ga0070690_100087509 Ga0070690_1000875092 258
205 3300005334 Ga0068869_100043910 Ga0068869_1000439105 258
206 3300005336 Ga0070680_100597889 Ga0070680_1005978891 258
207 3300005338 Ga0068868_100004397 Ga0068868_1000043979 258
208 3300005338 Ga0068868_100137557 Ga0068868_1001375573 258
209 3300005339 Ga0070660_100027175 Ga0070660_1000271756 258
210 3300005340 Ga0070689_100596503 Ga0070689_1005965031 258
211 3300005341 Ga0070691_10003792 Ga0070691_100037924 258
212 3300005347 Ga0070668_100000612 Ga0070668_10000061214 258
213 3300005347 Ga0070668_100276404 Ga0070668_1002764042 258
214 3300005353 Ga0070669_100000503 Ga0070669_10000050325 258
215 3300005353 Ga0070669_100008403 Ga0070669_1000084037 258
216 3300005355 Ga0070671_100024864 Ga0070671_1000248646 258
217 3300005355 Ga0070671_100147393 Ga0070671_1001473932 258
218 3300005356 Ga0070674_100000542 Ga0070674_10000054215 258
219 3300005365 Ga0070688_100016773 Ga0070688_1000167735 258
220 3300005366 Ga0070659_100006875 Ga0070659_1000068754 258
221 3300005366 Ga0070659_100237365 Ga0070659_1002373652 258
222 3300005367 Ga0070667_100000054 Ga0070667_10000005429 258
223 3300005367 Ga0070667_100068274 Ga0070667_1000682742 258
224 3300005406 Ga0070703_10022064 Ga0070703_100220644 258
225 3300005434 Ga0070709_10007859 Ga0070709_100078594 258
226 3300005437 Ga0070710_10004514 Ga0070710_100045148 258
227 3300005437 Ga0070710_10018699 Ga0070710_100186995 258
228 3300005438 Ga0070701_10000355 Ga0070701_1000035510 258
229 3300005439 Ga0070711_100006966 Ga0070711_1000069666 258
230 3300005439 Ga0070711_100061391 Ga0070711_1000613914 258
231 3300005440 Ga0070705_100243040 Ga0070705_1002430401 258
232 3300005441 Ga0070700_100086304 Ga0070700_1000863042 258
233 3300005441 Ga0070700_100136563 Ga0070700_1001365632 258
234 3300005444 Ga0070694_100027260 Ga0070694_1000272604 258
235 3300005455 Ga0070663_100329166 Ga0070663_1003291661 258
236 3300005456 Ga0070678_100000240 Ga0070678_10000024014 258
237 3300005457 Ga0070662_100011661 Ga0070662_1000116612 258
238 3300005457 Ga0070662_100041482 Ga0070662_1000414824 258
239 3300005458 Ga0070681_10461212 Ga0070681_104612122 258
240 3300005459 Ga0068867_100001913 Ga0068867_10000191314 258
241 3300005459 Ga0068867_100337025 Ga0068867_1003370251 258
242 3300005466 Ga0070685_10132366 Ga0070685_101323661 258
243 3300005535 Ga0070684_100614208 Ga0070684_1006142081 258
244 3300005539 Ga0068853_100009813 Ga0068853_1000098138 258
245 3300005545 Ga0070695_100058033 Ga0070695_1000580333 258
246 3300005546 Ga0070696_100003869 Ga0070696_1000038699 258
247 3300005547 Ga0070693_100008151 Ga0070693_1000081515 258
248 3300005548 Ga0070665_100005662 Ga0070665_1000056628 258
249 3300005548 Ga0070665_100036847 Ga0070665_1000368472 258
250 3300005548 Ga0070665_100069247 Ga0070665_1000692474 258
251 3300005548 Ga0070665_100083917 Ga0070665_1000839175 258
252 3300005549 Ga0070704_100023640 Ga0070704_1000236402 258
253 3300005563 Ga0068855_100202536 Ga0068855_1002025362 258
254 3300005563 Ga0068855_100305037 Ga0068855_1003050373 258
255 3300005578 Ga0068854_100006177 Ga0068854_1000061778 258
256 3300005614 Ga0068856_100264692 Ga0068856_1002646922 258
257 3300005615 Ga0070702_100000643 Ga0070702_1000006431 258
258 3300005616 Ga0068852_100178699 Ga0068852_1001786992 258
259 3300005617 Ga0068859_100038030 Ga0068859_1000380305 258
260 3300005617 Ga0068859_100168536 Ga0068859_1001685363 258
261 3300005618 Ga0068864_100220721 Ga0068864_1002207212 258
262 3300005718 Ga0068866_10001606 Ga0068866_100016067 258
263 3300005719 Ga0068861_100002075 Ga0068861_10000207513 258
264 3300005719 Ga0068861_100171741 Ga0068861_1001717411 258
265 3300005840 Ga0068870_10348967 Ga0068870_103489672 258
266 3300005841 Ga0068863_100026655 Ga0068863_1000266553 258
267 3300005841 Ga0068863_100503700 Ga0068863_1005037002 258
268 3300005842 Ga0068858_100006020 Ga0068858_10000602014 258
269 3300005842 Ga0068858_100020079 Ga0068858_1000200797 258
270 3300005842 Ga0068858_100686070 Ga0068858_1006860702 258
271 3300005843 Ga0068860_100000246 Ga0068860_10000024656 258
272 3300005843 Ga0068860_100000986 Ga0068860_1000009866 258
273 3300005843 Ga0068860_100193334 Ga0068860_1001933344 258
274 3300005844 Ga0068862_100000024 Ga0068862_10000002474 258
275 3300005844 Ga0068862_100026059 Ga0068862_1000260593 258
276 3300005844 Ga0068862_100040538 Ga0068862_1000405383 258
277 3300005844 Ga0068862_100221035 Ga0068862_1002210351 258
278 3300005937 Ga0081455_10044246 Ga0081455_100442461 258
279 3300005937 Ga0081455_10069414 Ga0081455_100694142 258
280 3300005981 Ga0081538_10089489 Ga0081538_100894892 258
281 3300006038 Ga0075365_10001760 Ga0075365_1000176011 258
282 3300006038 Ga0075365_10004009 Ga0075365_100040098 258
283 3300006048 Ga0075363_100000889 Ga0075363_1000008898 258
284 3300006048 Ga0075363_100001162 Ga0075363_1000011627 258
285 3300006048 Ga0075363_100087858 Ga0075363_1000878582 258
286 3300006051 Ga0075364_10002781 Ga0075364_100027819 258
287 3300006051 Ga0075364_10006806 Ga0075364_100068065 258
288 3300006051 Ga0075364_10061147 Ga0075364_100611472 258
289 3300006051 Ga0075364_10109947 Ga0075364_101099472 258
290 3300006051 Ga0075364_10116214 Ga0075364_101162142 258
291 3300006051 Ga0075364_10215278 Ga0075364_102152782 258
292 3300006163 Ga0070715_10001419 Ga0070715_100014192 258
293 3300006173 Ga0070716_100067343 Ga0070716_1000673434 258
294 3300006173 Ga0070716_100182416 Ga0070716_1001824161 258
295 3300006175 Ga0070712_100001832 Ga0070712_1000018323 258
296 3300006175 Ga0070712_100193410 Ga0070712_1001934102 258
297 3300006175 Ga0070712_100385927 Ga0070712_1003859271 258
298 3300006178 Ga0075367_10004774 Ga0075367_100047745 258
299 3300006186 Ga0075369_10022055 Ga0075369_100220551 258
300 3300006186 Ga0075369_10025646 Ga0075369_100256462 258
301 3300006186 Ga0075369_10031921 Ga0075369_100319211 258
302 3300006353 Ga0075370_10028907 Ga0075370_100289075 258
303 3300006844 Ga0075428_100142898 Ga0075428_1001428981 258
304 3300006846 Ga0075430_100211572 Ga0075430_1002115724 258
305 3300006881 Ga0068865_100006081 Ga0068865_1000060817 258
306 3300006931 Ga0097620_100038030 Ga0097620_1000380305 258
307 3300006931 Ga0097620_100168536 Ga0097620_1001685362 258
308 3300009092 Ga0105250_10041987 Ga0105250_100419872 258
309 3300009098 Ga0105245_10000550 Ga0105245_1000055011 258
310 3300009098 Ga0105245_10844809 Ga0105245_108448091 258
311 3300009098 Ga0105245_10890445 Ga0105245_108904451 258
312 3300009101 Ga0105247_10000073 Ga0105247_1000007328 258
313 3300009101 Ga0105247_10000477 Ga0105247_1000047728 258
314 3300009101 Ga0105247_10109146 Ga0105247_101091462 258
315 3300009101 Ga0105247_10278592 Ga0105247_102785922 258
316 3300009147 Ga0114129_10028302 Ga0114129_100283024 258
317 3300009148 Ga0105243_10001265 Ga0105243_1000126514 258
318 3300009148 Ga0105243_10194533 Ga0105243_101945332 258
319 3300009174 Ga0105241_10011776 Ga0105241_100117761 258
320 3300009176 Ga0105242_10000552 Ga0105242_1000055220 258
321 3300009177 Ga0105248_10000088 Ga0105248_1000008873 258
322 3300009177 Ga0105248_10122691 Ga0105248_101226913 258
323 3300009545 Ga0105237_10004938 Ga0105237_1000493811 258
324 3300009553 Ga0105249_10001282 Ga0105249_1000128221 258
325 3300009553 Ga0105249_10114651 Ga0105249_101146513 258
326 3300009982 Ga0105147_105718 Ga0105147_1057182 258
327 3300010375 Ga0105239_10003697 Ga0105239_1000369719 258
328 3300010375 Ga0105239_10249003 Ga0105239_102490034 258
329 3300011119 Ga0105246_10081470 Ga0105246_100814702 258
330 3300013297 Ga0157378_10002494 Ga0157378_100024948 258
331 3300013306 Ga0163162_10003098 Ga0163162_1000309812 258
332 3300013306 Ga0163162_10176374 Ga0163162_101763744 258
333 3300013307 Ga0157372_10041447 Ga0157372_100414473 258
334 3300013308 Ga0157375_10000957 Ga0157375_100009574 258
335 3300013308 Ga0157375_10486874 Ga0157375_104868741 258
336 3300014325 Ga0163163_10011130 Ga0163163_1001113010 258
337 3300014325 Ga0163163_10016288 Ga0163163_100162886 258
338 3300014325 Ga0163163_10336008 Ga0163163_103360082 258
339 3300014326 Ga0157380_10000206 Ga0157380_1000020627 258
340 3300014745 Ga0157377_10107030 Ga0157377_101070304 258
341 3300014969 Ga0157376_10131720 Ga0157376_101317203 258
342 3300017792 Ga0163161_10003884 Ga0163161_1000388411 258
343 3300017792 Ga0163161_10520670 Ga0163161_105206701 258
344 3300021384 Ga0213876_10001338 Ga0213876_100013387 258
345 3300021384 Ga0213876_10084618 Ga0213876_100846182 258
346 3300021388 Ga0213875_10018646 Ga0213875_100186465 258
347 3300025711 Ga0207696_1045693 Ga0207696_10456932 258
348 3300025898 Ga0207692_10075972 Ga0207692_100759722 258
349 3300025899 Ga0207642_10000198 Ga0207642_100001986 258
350 3300025899 Ga0207642_10016053 Ga0207642_100160533 258
351 3300025900 Ga0207710_10000099 Ga0207710_1000009929 258
352 3300025900 Ga0207710_10003628 Ga0207710_100036287 258
353 3300025901 Ga0207688_10001328 Ga0207688_1000132811 258
354 3300025901 Ga0207688_10008625 Ga0207688_100086251 258
355 3300025903 Ga0207680_10173387 Ga0207680_101733871 258
356 3300025904 Ga0207647_10013376 Ga0207647_100133764 258
357 3300025904 Ga0207647_10112689 Ga0207647_101126893 258
358 3300025905 Ga0207685_10021368 Ga0207685_100213681 258
359 3300025906 Ga0207699_10008199 Ga0207699_100081994 258
360 3300025907 Ga0207645_10015927 Ga0207645_100159275 258
361 3300025908 Ga0207643_10334635 Ga0207643_103346352 258
362 3300025912 Ga0207707_10676088 Ga0207707_106760881 258
363 3300025915 Ga0207693_10002328 Ga0207693_1000232817 258
364 3300025915 Ga0207693_10118056 Ga0207693_101180561 258
365 3300025916 Ga0207663_10046886 Ga0207663_100468862 258
366 3300025916 Ga0207663_10053188 Ga0207663_100531884 258
367 3300025923 Ga0207681_10006366 Ga0207681_100063667 258
368 3300025923 Ga0207681_10017597 Ga0207681_100175975 258
369 3300025924 Ga0207694_10266277 Ga0207694_102662772 258
370 3300025926 Ga0207659_10154693 Ga0207659_101546932 258
371 3300025927 Ga0207687_10002843 Ga0207687_1000284313 258
372 3300025931 Ga0207644_10132476 Ga0207644_101324762 258
373 3300025933 Ga0207706_10028700 Ga0207706_100287003 258
374 3300025933 Ga0207706_10029573 Ga0207706_100295733 258
375 3300025935 Ga0207709_10001153 Ga0207709_1000115315 258
376 3300025936 Ga0207670_10531221 Ga0207670_105312212 258
377 3300025937 Ga0207669_10000469 Ga0207669_1000046917 258
378 3300025938 Ga0207704_10000572 Ga0207704_100005728 258
379 3300025938 Ga0207704_10310343 Ga0207704_103103432 258
380 3300025939 Ga0207665_10003687 Ga0207665_100036875 258
381 3300025939 Ga0207665_10024579 Ga0207665_100245794 258
382 3300025941 Ga0207711_10000386 Ga0207711_1000038641 258
383 3300025941 Ga0207711_10155639 Ga0207711_101556394 258
384 3300025942 Ga0207689_10014963 Ga0207689_100149637 258
385 3300025942 Ga0207689_10260054 Ga0207689_102600542 258
386 3300025949 Ga0207667_10258811 Ga0207667_102588113 258
387 3300025961 Ga0207712_10000093 Ga0207712_1000009372 258
388 3300025961 Ga0207712_10003821 Ga0207712_100038216 258
389 3300025972 Ga0207668_10001310 Ga0207668_100013105 258
390 3300025972 Ga0207668_10223633 Ga0207668_102236332 258
391 3300025981 Ga0207640_10002689 Ga0207640_100026896 258
392 3300025986 Ga0207658_10000096 Ga0207658_1000009667 258
393 3300025986 Ga0207658_10003389 Ga0207658_100033893 258
394 3300026023 Ga0207677_10000944 Ga0207677_100009445 258
395 3300026023 Ga0207677_10160554 Ga0207677_101605542 258
396 3300026035 Ga0207703_10005058 Ga0207703_100050582 258
397 3300026035 Ga0207703_10186821 Ga0207703_101868212 258
398 3300026035 Ga0207703_10319480 Ga0207703_103194801 258
399 3300026041 Ga0207639_10058665 Ga0207639_100586651 258
400 3300026075 Ga0207708_10133015 Ga0207708_101330153 258
401 3300026075 Ga0207708_10191734 Ga0207708_101917342 258
402 3300026078 Ga0207702_10244705 Ga0207702_102447052 258
403 3300026078 Ga0207702_10619712 Ga0207702_106197121 258
404 3300026088 Ga0207641_10000164 Ga0207641_1000016431 258
405 3300026088 Ga0207641_10001427 Ga0207641_1000142727 258
406 3300026088 Ga0207641_10023522 Ga0207641_100235226 258
407 3300026089 Ga0207648_10372609 Ga0207648_103726092 258
408 3300026095 Ga0207676_10117826 Ga0207676_101178262 258
409 3300026118 Ga0207675_100006606 Ga0207675_1000066064 258
410 3300026118 Ga0207675_100228274 Ga0207675_1002282742 258
411 3300026121 Ga0207683_10003649 Ga0207683_100036494 258
412 3300026121 Ga0207683_10028797 Ga0207683_100287973 258
413 3300028379 Ga0268266_10007067 Ga0268266_100070677 258
414 3300028379 Ga0268266_10011869 Ga0268266_100118697 258
415 3300028379 Ga0268266_10061133 Ga0268266_100611334 258
416 3300028379 Ga0268266_10499313 Ga0268266_104993132 258
417 3300028379 Ga0268266_10671526 Ga0268266_106715262 258
418 3300028380 Ga0268265_10000012 Ga0268265_10000012188 258
419 3300028380 Ga0268265_10145740 Ga0268265_101457402 258
420 3300028381 Ga0268264_10000104 Ga0268264_1000010429 258
421 3300028381 Ga0268264_10000885 Ga0268264_1000088530 258
422 3300028381 Ga0268264_10089172 Ga0268264_100891724 258
423 3300028381 Ga0268264_10177815 Ga0268264_101778153 258
424 3300031731 Ga0307405_10043201 Ga0307405_100432013 258
425 3300031824 Ga0307413_10007279 Ga0307413_100072797 258
426 3300031824 Ga0307413_10644072 Ga0307413_106440721 258
427 3300031852 Ga0307410_10001244 Ga0307410_100012446 258
428 3300031995 Ga0307409_100007355 Ga0307409_1000073555 258
429 3300032126 Ga0307415_100106207 Ga0307415_1001062071 258
430 3300035691 Ga0373931_0105860 Ga0373931_0105860_50_826 258
431 3300035692 Ga0373935_0289485 Ga0373935_0289485_25_807 258
432 3300035725 Ga0373947_0317874 Ga0373947_0317874_167_949 258
433 3300037853 Ga0436364_0718930 Ga0436364_0718930_826_1626 258
434 3300037853 Ga0436364_0839437 Ga0436364_0839437_184_963 258
435 3300039437 Ga0436365_0065786 Ga0436365_0065786_4918_5712 258
436 3300039437 Ga0436365_0095204 Ga0436365_0095204_726_1520 258
437 3300039437 Ga0436365_1041061 Ga0436365_1041061_9713_10513 258
438 3300039437 Ga0436365_1482123 Ga0436365_1482123_2402_3181 258
439 3300039450 Ga0436363_0364332 Ga0436363_0364332_309_1091 258
440 3300041411 Ga0439466_0014229 Ga0439466_0014229_1905_2681 258
441 3300041411 Ga0439466_0018038 Ga0439466_0018038_909_1685 258
442 3300041413 Ga0439465_0004754 Ga0439465_0004754_2265_3041 258
443 3300041997 Ga0439431_0006954 Ga0439431_0006954_359_1135 258
444 3300042436 Ga0439435_0015936 Ga0439435_0015936_825_1601 258
445 3300044658 Ga0466972_0025208 Ga0466972_0025208_898_1674 258
446 3300044658 Ga0466972_0042512 Ga0466972_0042512_700_1539 258
447 3300044658 Ga0466972_0053152 Ga0466972_0053152_565_1359 258
448 3300044683 Ga0466965_0031369 Ga0466965_0031369_237_1013 258
449 3300044684 Ga0466966_0021213 Ga0466966_0021213_1758_2534 258
450 3300044693 Ga0466961_0005380 Ga0466961_0005380_2721_3515 258
451 3300044706 Ga0466964_0017279 Ga0466964_0017279_1582_2358 258
452 3300044719 Ga0466971_0021210 Ga0466971_0021210_1760_2536 258
453 3300044735 Ga0466968_0012387 Ga0466968_0012387_1616_2392 258
454 3300044842 Ga0466957_0019571 Ga0466957_0019571_2264_3040 258
455 3300044842 Ga0466957_0276237 Ga0466957_0276237_62_841 258
456 3300044901 Ga0466960_0000049 Ga0466960_0000049_9128_9922 258
457 3300044901 Ga0466960_0010081 Ga0466960_0010081_2973_3776 258
458 3300044901 Ga0466960_0196977 Ga0466960_0196977_210_986 258
459 3300045049 Ga0466959_0029222 Ga0466959_0029222_2128_2904 258
460 3300045836 Ga0466958_0001405 Ga0466958_0001405_5829_6623 258
461 3300045836 Ga0466958_0234601 Ga0466958_0234601_311_1114 258
462 3300045976 Ga0466967_0007714 Ga0466967_0007714_992_1792 258
463 3300045976 Ga0466967_0009033 Ga0466967_0009033_3508_4311 258
464 3300045976 Ga0466967_0029240 Ga0466967_0029240_730_1509 258
465 3300045976 Ga0466967_0258348 Ga0466967_0258348_699_1475 258
466 3300045976 Ga0466967_0433903 Ga0466967_0433903_466_1257 258
467 3300045976 Ga0466967_0541518 Ga0466967_0541518_167_943 258
468 3300046459 Ga0495629_0015395 Ga0495629_0015395_1691_2473 258
469 3300046683 Ga0495658_0010953 Ga0495658_0010953_3412_4194 258
470 3300047321 Ga0495676_0068959 Ga0495676_0068959_796_1578 258
471 3300048903 Ga0496100_0322637 Ga0496100_0322637_150_926 258
472 3300048904 Ga0496101_0000071 Ga0496101_0000071_34712_35539 258
473 3300048904 Ga0496101_0099009 Ga0496101_0099009_155_934 258
474 3300048905 Ga0496102_0000026 Ga0496102_0000026_65066_65893 258
475 3300048905 Ga0496102_0008456 Ga0496102_0008456_2474_3250 258
476 3300048905 Ga0496102_0051223 Ga0496102_0051223_206_985 258
477 3300048905 Ga0496102_0229705 Ga0496102_0229705_574_1350 258
478 3300048905 Ga0496102_0276234 Ga0496102_0276234_182_958 258
479 3300048906 Ga0496103_0000023 Ga0496103_0000023_161282_162109 258
480 3300048906 Ga0496103_0044040 Ga0496103_0044040_505_1281 258
481 3300048907 Ga0496104_0030688 Ga0496104_0030688_711_1487 258
482 3300048907 Ga0496104_0186816 Ga0496104_0186816_290_1066 258
483 3300048907 Ga0496104_0542124 Ga0496104_0542124_243_1022 258
484 3300048908 Ga0496105_0417456 Ga0496105_0417456_216_995 258
485 3300048909 Ga0496106_0002575 Ga0496106_0002575_1162_1989 258
486 3300048909 Ga0496106_0004008 Ga0496106_0004008_7927_8703 258
487 3300048909 Ga0496106_0058966 Ga0496106_0058966_1121_1900 258
488 3300048910 Ga0496107_0046645 Ga0496107_0046645_326_1153 258
489 3300048911 Ga0496108_0000541 Ga0496108_0000541_20431_21207 258
490 3300048911 Ga0496108_0142876 Ga0496108_0142876_646_1422 258
491 3300048912 Ga0496109_0000822 Ga0496109_0000822_15952_16728 258
492 3300048912 Ga0496109_0220373 Ga0496109_0220373_721_1497 258
493 3300048913 Ga0496110_0070593 Ga0496110_0070593_990_1766 258
494 3300048914 Ga0496111_0177909 Ga0496111_0177909_504_1280 258
495 3300048915 Ga0496112_0056214 Ga0496112_0056214_2714_3490 258
496 3300048917 Ga0496114_0280192 Ga0496114_0280192_623_1417 258
497 3300048919 Ga0496116_0000018 Ga0496116_0000018_479985_480812 258
498 3300048920 Ga0496117_0000015 Ga0496117_0000015_65066_65893 258
499 3300048921 Ga0496118_0000012 Ga0496118_0000012_65066_65893 258
500 3300048922 Ga0496119_0000238 Ga0496119_0000238_12936_13763 258
501 3300048923 Ga0496120_0000352 Ga0496120_0000352_62041_62868 258
502 3300048924 Ga0496121_0000062 Ga0496121_0000062_117418_118245 258
503 3300048924 Ga0496121_0085278 Ga0496121_0085278_1419_2225 258
504 3300048929 Ga0496126_0000227 Ga0496126_0000227_48758_49585 258
505 3300048929 Ga0496126_0003125 Ga0496126_0003125_18642_19436 258
506 3300049569 Ga0501032_0001315 Ga0501032_0001315_1807_2610 258
507 3300049569 Ga0501032_0003186 Ga0501032_0003186_2506_3306 258
508 3300049570 Ga0501033_0005654 Ga0501033_0005654_7989_8792 258
509 3300049570 Ga0501033_0062952 Ga0501033_0062952_1455_2246 258
510 3300049571 Ga0501034_0024479 Ga0501034_0024479_2986_3777 258
511 3300049572 Ga0501036_0005200 Ga0501036_0005200_1021_1824 258
512 3300049572 Ga0501036_0016844 Ga0501036_0016844_3132_3932 258
513 3300049573 Ga0501037_0000898 Ga0501037_0000898_9456_10256 258
514 3300049573 Ga0501037_0003607 Ga0501037_0003607_6580_7383 258
515 3300049574 Ga0501038_0256612 Ga0501038_0256612_365_1168 258
516 3300049575 Ga0501039_0000130 Ga0501039_0000130_48954_49754 258
517 3300049579 Ga0501043_0005985 Ga0501043_0005985_2107_2907 258
518 3300049580 Ga0501046_0009717 Ga0501046_0009717_50_853 258
519 3300049580 Ga0501046_0207575 Ga0501046_0207575_160_951 258
520 3300049581 Ga0501047_0001766 Ga0501047_0001766_5877_6680 258
521 3300049581 Ga0501047_0009655 Ga0501047_0009655_2234_3025 258
522 3300049581 Ga0501047_0272729 Ga0501047_0272729_361_1164 258
523 3300049582 Ga0501048_0001594 Ga0501048_0001594_8363_9166 258
524 3300049585 Ga0501069_0047676 Ga0501069_0047676_470_1273 258
525 3300049586 Ga0501070_0001879 Ga0501070_0001879_5491_6291 258
526 3300049586 Ga0501070_0009592 Ga0501070_0009592_6557_7360 258
527 3300049587 Ga0501071_0082108 Ga0501071_0082108_458_1246 258
528 3300049589 Ga0501073_0082965 Ga0501073_0082965_1026_1829 258
529 3300049742 Ga0501080_0042303 Ga0501080_0042303_2819_3622 258
530 3300049742 Ga0501080_0639857 Ga0501080_0639857_74_853 258
531 3300049822 Ga0501035_0000834 Ga0501035_0000834_9454_10245 258
532 3300049822 Ga0501035_0528897 Ga0501035_0528897_160_951 258
533 3300049823 Ga0501044_0000388 Ga0501044_0000388_1114_1905 258
534 3300049823 Ga0501044_0006239 Ga0501044_0006239_12228_13031 258
535 3300049823 Ga0501044_0008193 Ga0501044_0008193_5695_6495 258
536 3300049823 Ga0501044_0033302 Ga0501044_0033302_3753_4541 258
537 3300049824 Ga0501045_0370604 Ga0501045_0370604_65_868 258
538 3300050490 nmdc:mga03n38_105291_c1 nmdc:mga03n38_105291_c1_403_1179 258
539 3300050490 nmdc:mga03n38_1795_c1 nmdc:mga03n38_1795_c1_4828_5604 258
540 3300050490 nmdc:mga03n38_2219_c1 nmdc:mga03n38_2219_c1_3440_4216 258
541 3300050491 nmdc:mga00v17_1070_c1 nmdc:mga00v17_1070_c1_10723_11499 258
542 3300050491 nmdc:mga00v17_11326_c1 nmdc:mga00v17_11326_c1_1688_2464 258
543 3300050491 nmdc:mga00v17_116379_c1 nmdc:mga00v17_116379_c1_157_933 258
544 3300050491 nmdc:mga00v17_168871_c1 nmdc:mga00v17_168871_c1_428_1204 258
545 3300050491 nmdc:mga00v17_2717_c1 nmdc:mga00v17_2717_c1_5887_6663 258
546 3300050492 nmdc:mga0yw44_17379_c1 nmdc:mga0yw44_17379_c1_1050_1826 258
547 3300050492 nmdc:mga0yw44_294289_c1 nmdc:mga0yw44_294289_c1_213_989 258
548 3300050492 nmdc:mga0yw44_70697_c1 nmdc:mga0yw44_70697_c1_329_1105 258
549 3300050493 nmdc:mga0k408_237468_c1 nmdc:mga0k408_237468_c1_207_983 258
550 3300050494 nmdc:mga06z11_10067_c1 nmdc:mga06z11_10067_c1_2263_3039 258
551 3300050494 nmdc:mga06z11_83641_c1 nmdc:mga06z11_83641_c1_828_1604 258
552 3300050495 nmdc:mga04h51_91256_c1 nmdc:mga04h51_91256_c1_296_1072 258
553 3300050496 nmdc:mga07m45_2105_c1 nmdc:mga07m45_2105_c1_5531_6307 258
554 3300050496 nmdc:mga07m45_260533_c1 nmdc:mga07m45_260533_c1_116_892 258
555 3300050507 nmdc:mga05p37_102075_c1 nmdc:mga05p37_102075_c1_623_1399 258
556 3300050509 nmdc:mga0qj67_21879_c1 nmdc:mga0qj67_21879_c1_2383_3159 258
557 3300050511 nmdc:mga08y16_857835_c1 nmdc:mga08y16_857835_c1_55_837 258
558 3300050516 nmdc:mga0sz30_1254_c1 nmdc:mga0sz30_1254_c1_2382_3197 258
559 3300050516 nmdc:mga0sz30_3078_c1 nmdc:mga0sz30_3078_c1_5142_5918 258
560 3300050516 nmdc:mga0sz30_49022_c1 nmdc:mga0sz30_49022_c1_237_1013 258
561 3300050516 nmdc:mga0sz30_8324_c2 nmdc:mga0sz30_8324_c2_1287_2063 258
562 3300053087 Ga0500643_028398 Ga0500643_028398_141_917 258
563 3300053153 Ga0500616_0002446 Ga0500616_0002446_3925_4737 258
564 3300053153 Ga0500616_0112772 Ga0500616_0112772_62_838 258
565 3300054114 Ga0501084_0079105 Ga0501084_0079105_1215_2018 258
566 3300061719 Ga0466962_0016386 Ga0466962_0016386_1763_2539 258
567 iso_pu_bacteria 2939582691 2939583945 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

41

210

0.95

PF17778

BLACT_WH

Beta-lactamase associated winged helix domain

247

280

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ad9-assembly2.cif.gz_E crystal structure of human lactb2. 0.8387 11 257
4ad9-assembly2.cif.gz_F crystal structure of human lactb2. 0.834 11 257
6ao1-assembly3.cif.gz_C crystal structure of a beta-lactamase from burkholderia phymatum 0.829 5 257
4ad9-assembly1.cif.gz_B crystal structure of human lactb2. 0.8267 11 257
6ao1-assembly2.cif.gz_B crystal structure of a beta-lactamase from burkholderia phymatum 0.8267 5 257
ID Description Score Start End Superfamily
af_I6XHY3_12_197_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9759 7 192 3.60.15.10
af_I6XHY3_12_197_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9708 7 192 3.60.15.10
af_Q6NYF0_205_289_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9236 194 257 1.10.10.10
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8978 110 193 3.60.15.10
af_Q9VLS9_206_284_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8954 200 257 1.10.10.10
ID Description Score Start End GO Terms
AF-X8EDK6-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.9858 7 96 GO:0016787
GO:0046872
AF-A0A7I9WYM2-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9821 14 112 GO:0016787
GO:0046872
AF-A0A2S9GMA5-F1-model_v4 MBL fold metallo-hydrolase 0.9749 47 125 GO:0016787
AF-A0A2Z5YN19-F1-model_v4 deleted 0.9741 5 94
AF-A0A841NQ02-F1-model_v4 deleted 0.9642 5 258

Feature Viewer

pLDDT pTM Quality
90.36 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map