F464484

General Info

Members Datasets Scaffolds Average Seq Length
567 196 1134 338

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100090121|Ga0070659_1000901213
Length 350
Sequence MSEMGLDEAALVAWLEANVEGFIGPFELTKFPSGQSNPTYRIQAASGDYVLRRKPFGPLLASAHAVDREFRLISALHPLGFPVPRPLALCSDPEVIGAIFYVMELARGRPYANGTLPEFDPPTRRRMYEQLVDTLADLHQIDPVAAELGDFGKPGNYFERQVMRWTRQYRDSETDYLPEMERLISFLPETLPEQSRSAIVHGDYRIDNVTFDGDGALTAVLDWELATLGDPLADFSYLAMQWVMPADGGASLGGLDLGALGIPTLEEIVARYSARSGVPVTGKLDWYFAYNLFRLAGIVQGIKKRVIDGTASHANAQELAERVPMLAQAAWSYAVKAGAKAGRAAAGSPR

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
195 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
196 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.18
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 6.35
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100090121 3300005366 Bacteria 2457
2 JGI24741J21665_1003534 3300001915 Bacteria 3699
3 JGI24740J21852_10001632 3300001979 Bacteria 10338
4 JGI24739J22299_10002101 3300001989 Bacteria 7630
5 JGI24739J22299_10009219 3300001989 Bacteria 3684
6 JGI24737J22298_10003529 3300001990 Bacteria 5511
7 JGI24737J22298_10014122 3300001990 Bacteria 2594
8 JGI24735J21928_10027661 3300002067 Bacteria 1698
9 JGI24744J21845_10006369 3300002077 Bacteria 2451
10 Ga0070658_10001352 3300005327 Bacteria 20951
11 Ga0070658_10018232 3300005327 Bacteria 5617
12 Ga0070658_10019310 3300005327 Bacteria 5458
13 Ga0070658_10049686 3300005327 Bacteria 3398
14 Ga0070658_10078808 3300005327 Bacteria 2705
15 Ga0070658_10116817 3300005327 Bacteria 2214
16 Ga0070683_100020756 3300005329 Bacteria 5851
17 Ga0070683_100023452 3300005329 Bacteria 5520
18 Ga0070683_100085459 3300005329 Bacteria 2957
19 Ga0070683_100120939 3300005329 Bacteria 2474
20 Ga0070683_100303648 3300005329 Bacteria 1519
21 Ga0070690_100035433 3300005330 Bacteria 3131
22 Ga0070690_100096262 3300005330 Bacteria 1956
23 Ga0070690_100113835 3300005330 Bacteria 1808
24 Ga0070670_100009979 3300005331 Bacteria 8104
25 Ga0070670_100035846 3300005331 Bacteria 4271
26 Ga0070670_100063345 3300005331 Bacteria 3174
27 Ga0070670_100086100 3300005331 Bacteria 2700
28 Ga0070670_100297406 3300005331 Bacteria 1411
29 Ga0070677_10081408 3300005333 Bacteria 1386
30 Ga0068869_100018311 3300005334 Bacteria 4766
31 Ga0068869_100030604 3300005334 Bacteria 3780
32 Ga0070666_10002844 3300005335 Bacteria 10459
33 Ga0070666_10020500 3300005335 Bacteria 4273
34 Ga0070680_100312484 3300005336 Bacteria 1333
35 Ga0070682_100052930 3300005337 Bacteria 2542
36 Ga0068868_100005000 3300005338 Bacteria 9316
37 Ga0070660_100000012 3300005339 Bacteria 123961
38 Ga0070660_100054721 3300005339 Bacteria 3082
39 Ga0070660_100170396 3300005339 Bacteria 1758
40 Ga0070660_100331464 3300005339 Bacteria 1251
41 Ga0070661_100000251 3300005344 Bacteria 44128
42 Ga0070661_100014003 3300005344 Bacteria 5640
43 Ga0070661_100268695 3300005344 Bacteria 1320
44 Ga0070692_10065586 3300005345 Bacteria 1923
45 Ga0070668_100006224 3300005347 Bacteria 8841
46 Ga0070668_100063822 3300005347 Bacteria 2855
47 Ga0070668_100165714 3300005347 Bacteria 1796
48 Ga0070669_100284247 3300005353 Bacteria 1326
49 Ga0070669_100334965 3300005353 Bacteria 1225
50 Ga0070675_100010756 3300005354 Bacteria 7158
51 Ga0070675_100090932 3300005354 Bacteria 2556
52 Ga0070675_100129903 3300005354 Bacteria 2146
53 Ga0070675_100248117 3300005354 Bacteria 1557
54 Ga0070675_100412242 3300005354 Bacteria 1207
55 Ga0070671_100000356 3300005355 Bacteria 31426
56 Ga0070671_100003440 3300005355 Bacteria 12355
57 Ga0070671_100004676 3300005355 Bacteria 10862
58 Ga0070671_100013615 3300005355 Bacteria 6559
59 Ga0070671_100065834 3300005355 Bacteria 3019
60 Ga0070671_100164394 3300005355 Bacteria 1876
61 Ga0070671_100225588 3300005355 Bacteria 1590
62 Ga0070674_100006680 3300005356 Bacteria 6746
63 Ga0070674_100017030 3300005356 Bacteria 4563
64 Ga0070674_100139703 3300005356 Bacteria 1816
65 Ga0070673_100008385 3300005364 Bacteria 6870
66 Ga0070673_100072858 3300005364 Bacteria 2763
67 Ga0070673_100272723 3300005364 Bacteria 1481
68 Ga0070673_100363391 3300005364 Bacteria 1287
69 Ga0070659_100000254 3300005366 Bacteria 42101
70 Ga0070659_100021249 3300005366 Bacteria 4939
71 Ga0070659_100067334 3300005366 Bacteria 2840
72 Ga0070659_100154804 3300005366 Bacteria 1871
73 Ga0070659_100204622 3300005366 Bacteria 1626
74 Ga0070659_100237774 3300005366 Bacteria 1506
75 Ga0070667_100001265 3300005367 Bacteria 22928
76 Ga0070667_100008606 3300005367 Bacteria 8459
77 Ga0070667_100042324 3300005367 Bacteria 3822
78 Ga0070667_100072221 3300005367 Bacteria 2940
79 Ga0070709_10267938 3300005434 Bacteria 1236
80 Ga0070714_100052859 3300005435 Bacteria 3466
81 Ga0070714_100115264 3300005435 Bacteria 2385
82 Ga0070713_100012893 3300005436 Bacteria 6150
83 Ga0070713_100308400 3300005436 Bacteria 1459
84 Ga0070663_100000089 3300005455 Bacteria 41316
85 Ga0070663_100004495 3300005455 Bacteria 8213
86 Ga0070663_100041534 3300005455 Bacteria 3227
87 Ga0070663_100124157 3300005455 Bacteria 1954
88 Ga0070663_100165269 3300005455 Bacteria 1706
89 Ga0070678_100005602 3300005456 Bacteria 7286
90 Ga0070678_100012540 3300005456 Bacteria 5275
91 Ga0070662_100000023 3300005457 Bacteria 91833
92 Ga0070662_100014212 3300005457 Bacteria 5313
93 Ga0070662_100020254 3300005457 Bacteria 4527
94 Ga0070662_100030837 3300005457 Bacteria 3756
95 Ga0070662_100058995 3300005457 Bacteria 2794
96 Ga0070662_100112336 3300005457 Bacteria 2077
97 Ga0070662_100227081 3300005457 Bacteria 1492
98 Ga0070662_100230975 3300005457 Bacteria 1480
99 Ga0070662_100236107 3300005457 Bacteria 1464
100 Ga0070662_100400990 3300005457 Bacteria 1132
101 Ga0070681_10126638 3300005458 Bacteria 2486
102 Ga0070681_10130077 3300005458 Bacteria 2450
103 Ga0068867_100118396 3300005459 Bacteria 2043
104 Ga0070679_100194917 3300005530 Bacteria 1993
105 Ga0070679_100280991 3300005530 Bacteria 1617
106 Ga0070684_100014255 3300005535 Bacteria 6433
107 Ga0070684_100016587 3300005535 Bacteria 6023
108 Ga0068853_100000491 3300005539 Bacteria 26988
109 Ga0068853_100195510 3300005539 Bacteria 1839
110 Ga0070672_100005173 3300005543 Bacteria 8623
111 Ga0070672_100024701 3300005543 Bacteria 4446
112 Ga0070672_100076900 3300005543 Bacteria 2667
113 Ga0070672_100185192 3300005543 Bacteria 1736
114 Ga0070686_100027884 3300005544 Bacteria 3421
115 Ga0070695_100205079 3300005545 Bacteria 1412
116 Ga0070696_100022566 3300005546 Bacteria 4277
117 Ga0068855_100010293 3300005563 Bacteria 11279
118 Ga0068855_100015136 3300005563 Bacteria 9288
119 Ga0068855_100086144 3300005563 Bacteria 3633
120 Ga0068855_100096780 3300005563 Bacteria 3400
121 Ga0068855_100291554 3300005563 Bacteria 1809
122 Ga0068855_100315026 3300005563 Bacteria 1730
123 Ga0070664_100000951 3300005564 Bacteria 22639
124 Ga0070664_100005277 3300005564 Bacteria 10368
125 Ga0070664_100070857 3300005564 Bacteria 2986
126 Ga0070664_100343102 3300005564 Bacteria 1357
127 Ga0070664_100351769 3300005564 Bacteria 1340
128 Ga0068857_100007268 3300005577 Bacteria 9537
129 Ga0068857_100038977 3300005577 Bacteria 4207
130 Ga0068857_100221721 3300005577 Bacteria 1727
131 Ga0068854_100012540 3300005578 Bacteria 5554
132 Ga0068854_100109736 3300005578 Bacteria 2079
133 Ga0068854_100267631 3300005578 Bacteria 1371
134 Ga0068856_100000128 3300005614 Bacteria 76603
135 Ga0068856_100011799 3300005614 Bacteria 8469
136 Ga0068856_100078080 3300005614 Bacteria 3282
137 Ga0068856_100166625 3300005614 Bacteria 2214
138 Ga0068856_100275777 3300005614 Bacteria 1698
139 Ga0068852_100000359 3300005616 Bacteria 30741
140 Ga0068852_100046942 3300005616 Bacteria 3682
141 Ga0068852_100049173 3300005616 Bacteria 3606
142 Ga0068859_100003414 3300005617 Bacteria 16158
143 Ga0068859_100023037 3300005617 Bacteria 6245
144 Ga0068859_100074338 3300005617 Bacteria 3437
145 Ga0068859_100102752 3300005617 Bacteria 2916
146 Ga0068859_100266524 3300005617 Bacteria 1805
147 Ga0068859_100471621 3300005617 Bacteria 1351
148 Ga0068864_100000713 3300005618 Bacteria 27896
149 Ga0068864_100033913 3300005618 Bacteria 4340
150 Ga0068864_100069433 3300005618 Bacteria 3064
151 Ga0068851_10003368 3300005834 Bacteria 7112
152 Ga0068851_10046854 3300005834 Bacteria 2188
153 Ga0068863_100002105 3300005841 Bacteria 19733
154 Ga0068863_100010452 3300005841 Bacteria 9022
155 Ga0068863_100018929 3300005841 Bacteria 6590
156 Ga0068863_100037827 3300005841 Bacteria 4592
157 Ga0068863_100042898 3300005841 Bacteria 4296
158 Ga0068863_100167404 3300005841 Bacteria 2108
159 Ga0068858_100001407 3300005842 Bacteria 24703
160 Ga0068858_100005575 3300005842 Bacteria 12316
161 Ga0068858_100019046 3300005842 Bacteria 6421
162 Ga0068858_100092488 3300005842 Bacteria 2815
163 Ga0068860_100009287 3300005843 Bacteria 9771
164 Ga0068860_100013628 3300005843 Bacteria 7969
165 Ga0068860_100193083 3300005843 Bacteria 1971
166 Ga0068862_100021750 3300005844 Bacteria 5363
167 Ga0068862_100425169 3300005844 Bacteria 1247
168 Ga0068862_100459564 3300005844 Bacteria 1202
169 Ga0070717_10002429 3300006028 Bacteria 13152
170 Ga0075364_10159969 3300006051 Bacteria 1520
171 Ga0070712_100049879 3300006175 Bacteria 2909
172 Ga0097621_100007766 3300006237 Bacteria 7692
173 Ga0097621_100036190 3300006237 Bacteria 3949
174 Ga0068871_100007308 3300006358 Bacteria 7884
175 Ga0075428_100251500 3300006844 Bacteria 1905
176 Ga0075433_10063789 3300006852 Bacteria 3228
177 Ga0097620_100003414 3300006931 Bacteria 16158
178 Ga0097620_100023037 3300006931 Bacteria 6245
179 Ga0097620_100074339 3300006931 Bacteria 3437
180 Ga0097620_100102753 3300006931 Bacteria 2916
181 Ga0097620_100266544 3300006931 Bacteria 1805
182 Ga0097620_100471583 3300006931 Bacteria 1351
183 Ga0105240_10001847 3300009093 Bacteria 35457
184 Ga0105240_10388002 3300009093 Bacteria 1576
185 Ga0111539_10132715 3300009094 Bacteria 2916
186 Ga0105247_10092587 3300009101 Bacteria 1920
187 Ga0114129_10622457 3300009147 Bacteria 1396
188 Ga0105241_10064946 3300009174 Bacteria 2819
189 Ga0105242_10222455 3300009176 Bacteria 1688
190 Ga0105248_10000168 3300009177 Bacteria 76376
191 Ga0105248_10001002 3300009177 Bacteria 31241
192 Ga0105248_10001965 3300009177 Bacteria 22859
193 Ga0105248_10041900 3300009177 Bacteria 5134
194 Ga0105248_10042516 3300009177 Bacteria 5097
195 Ga0105248_10130056 3300009177 Bacteria 2840
196 Ga0105248_10162954 3300009177 Bacteria 2514
197 Ga0105238_10292880 3300009551 Bacteria 1610
198 Ga0157373_10031370 3300013100 Bacteria 3826
199 Ga0157373_10055372 3300013100 Bacteria 2817
200 Ga0157371_10000765 3300013102 Bacteria 37140
201 Ga0157371_10013052 3300013102 Bacteria 6325
202 Ga0157371_10086220 3300013102 Bacteria 2224
203 Ga0157371_10123176 3300013102 Bacteria 1844
204 Ga0157371_10247809 3300013102 Bacteria 1282
205 Ga0157370_10000534 3300013104 Bacteria 47653
206 Ga0157370_10094779 3300013104 Bacteria 2800
207 Ga0157369_10144877 3300013105 Bacteria 2512
208 Ga0157369_10281589 3300013105 Bacteria 1732
209 Ga0157369_10284141 3300013105 Bacteria 1723
210 Ga0157369_10348100 3300013105 Bacteria 1539
211 Ga0157369_10513808 3300013105 Bacteria 1239
212 Ga0157374_10038314 3300013296 Bacteria 4406
213 Ga0157374_10152924 3300013296 Bacteria 2244
214 Ga0157378_10130925 3300013297 Bacteria 2322
215 Ga0163162_10013333 3300013306 Bacteria 8029
216 Ga0163162_10014270 3300013306 Bacteria 7761
217 Ga0163162_10054089 3300013306 Bacteria 4036
218 Ga0163162_10384574 3300013306 Bacteria 1537
219 Ga0157375_10007560 3300013308 Bacteria 9501
220 Ga0157375_10093017 3300013308 Bacteria 3080
221 Ga0157375_10194189 3300013308 Bacteria 2185
222 Ga0163163_10000151 3300014325 Bacteria 72496
223 Ga0163163_10000991 3300014325 Bacteria 24023
224 Ga0163163_10095092 3300014325 Bacteria 2999
225 Ga0163163_10129357 3300014325 Bacteria 2565
226 Ga0157377_10003012 3300014745 Bacteria 7550
227 Ga0157379_10001787 3300014968 Bacteria 17755
228 Ga0157379_10121365 3300014968 Bacteria 2351
229 Ga0206353_10048212 3300020082 Bacteria 1808
230 Ga0207697_10013790 3300025315 Bacteria 3366
231 Ga0207697_10081670 3300025315 Bacteria 1362
232 Ga0207656_10031573 3300025321 Bacteria 2196
233 Ga0207656_10076845 3300025321 Bacteria 1494
234 Ga0207682_10019838 3300025893 Bacteria 2635
235 Ga0207688_10022604 3300025901 Bacteria 3442
236 Ga0207688_10042413 3300025901 Bacteria 2533
237 Ga0207688_10062699 3300025901 Bacteria 2096
238 Ga0207680_10000271 3300025903 Bacteria 24747
239 Ga0207680_10027566 3300025903 Bacteria 3165
240 Ga0207647_10013159 3300025904 Bacteria 5748
241 Ga0207647_10084072 3300025904 Bacteria 1905
242 Ga0207699_10174313 3300025906 Bacteria 1441
243 Ga0207645_10000896 3300025907 Bacteria 24720
244 Ga0207645_10012249 3300025907 Bacteria 5825
245 Ga0207705_10000694 3300025909 Bacteria 27899
246 Ga0207705_10001792 3300025909 Bacteria 16928
247 Ga0207705_10001965 3300025909 Bacteria 16037
248 Ga0207705_10020893 3300025909 Bacteria 4672
249 Ga0207705_10027999 3300025909 Bacteria 4017
250 Ga0207705_10169354 3300025909 Bacteria 1644
251 Ga0207707_10044718 3300025912 Bacteria 3859
252 Ga0207660_10029261 3300025917 Bacteria 3776
253 Ga0207660_10057612 3300025917 Bacteria 2783
254 Ga0207660_10245679 3300025917 Bacteria 1411
255 Ga0207657_10000038 3300025919 Bacteria 123940
256 Ga0207657_10001185 3300025919 Bacteria 27703
257 Ga0207657_10002057 3300025919 Bacteria 21773
258 Ga0207657_10018539 3300025919 Bacteria 6638
259 Ga0207657_10044947 3300025919 Bacteria 3880
260 Ga0207657_10080628 3300025919 Bacteria 2735
261 Ga0207657_10111868 3300025919 Bacteria 2254
262 Ga0207657_10158384 3300025919 Bacteria 1840
263 Ga0207657_10191859 3300025919 Bacteria 1648
264 Ga0207649_10051015 3300025920 Bacteria 2561
265 Ga0207649_10065561 3300025920 Bacteria 2299
266 Ga0207652_10008636 3300025921 Bacteria 8199
267 Ga0207652_10044274 3300025921 Bacteria 3791
268 Ga0207681_10025491 3300025923 Bacteria 3804
269 Ga0207681_10124455 3300025923 Bacteria 1896
270 Ga0207681_10148525 3300025923 Bacteria 1754
271 Ga0207650_10024990 3300025925 Bacteria 4253
272 Ga0207650_10030898 3300025925 Bacteria 3863
273 Ga0207650_10095236 3300025925 Bacteria 2282
274 Ga0207650_10182205 3300025925 Bacteria 1674
275 Ga0207659_10026990 3300025926 Bacteria 3882
276 Ga0207659_10060116 3300025926 Bacteria 2734
277 Ga0207659_10336647 3300025926 Bacteria 1249
278 Ga0207687_10053701 3300025927 Bacteria 2816
279 Ga0207700_10079587 3300025928 Bacteria 2553
280 Ga0207664_10062451 3300025929 Bacteria 2975
281 Ga0207664_10202666 3300025929 Bacteria 1713
282 Ga0207664_10248486 3300025929 Bacteria 1552
283 Ga0207644_10000794 3300025931 Bacteria 20032
284 Ga0207644_10001261 3300025931 Bacteria 16268
285 Ga0207644_10002807 3300025931 Bacteria 11229
286 Ga0207644_10006303 3300025931 Bacteria 7727
287 Ga0207644_10006565 3300025931 Bacteria 7578
288 Ga0207644_10013382 3300025931 Bacteria 5467
289 Ga0207644_10013741 3300025931 Bacteria 5406
290 Ga0207690_10000149 3300025932 Bacteria 55374
291 Ga0207690_10012995 3300025932 Bacteria 4993
292 Ga0207690_10045922 3300025932 Bacteria 2889
293 Ga0207690_10112663 3300025932 Bacteria 1962
294 Ga0207690_10199647 3300025932 Bacteria 1518
295 Ga0207690_10275768 3300025932 Bacteria 1308
296 Ga0207706_10000061 3300025933 Bacteria 109447
297 Ga0207706_10000675 3300025933 Bacteria 35813
298 Ga0207706_10004182 3300025933 Bacteria 13591
299 Ga0207706_10019015 3300025933 Bacteria 6179
300 Ga0207706_10034041 3300025933 Bacteria 4534
301 Ga0207706_10034214 3300025933 Bacteria 4521
302 Ga0207706_10037251 3300025933 Bacteria 4320
303 Ga0207706_10049572 3300025933 Bacteria 3711
304 Ga0207706_10165720 3300025933 Bacteria 1942
305 Ga0207706_10167371 3300025933 Bacteria 1932
306 Ga0207706_10394936 3300025933 Bacteria 1199
307 Ga0207709_10045463 3300025935 Bacteria 2659
308 Ga0207669_10013957 3300025937 Bacteria 4012
309 Ga0207704_10045315 3300025938 Bacteria 2612
310 Ga0207691_10005337 3300025940 Bacteria 12408
311 Ga0207691_10011187 3300025940 Bacteria 8611
312 Ga0207691_10106515 3300025940 Bacteria 2497
313 Ga0207691_10149724 3300025940 Bacteria 2052
314 Ga0207691_10172575 3300025940 Bacteria 1893
315 Ga0207691_10295898 3300025940 Bacteria 1391
316 Ga0207711_10000044 3300025941 Bacteria 157113
317 Ga0207711_10000823 3300025941 Bacteria 30322
318 Ga0207711_10001606 3300025941 Bacteria 20889
319 Ga0207711_10005580 3300025941 Bacteria 10638
320 Ga0207711_10056130 3300025941 Bacteria 3383
321 Ga0207711_10169903 3300025941 Bacteria 1978
322 Ga0207689_10005456 3300025942 Bacteria 11379
323 Ga0207689_10222908 3300025942 Bacteria 1558
324 Ga0207661_10015991 3300025944 Bacteria 5530
325 Ga0207661_10173287 3300025944 Bacteria 1879
326 Ga0207679_10000149 3300025945 Bacteria 57484
327 Ga0207679_10020953 3300025945 Bacteria 4423
328 Ga0207679_10021288 3300025945 Bacteria 4394
329 Ga0207679_10065306 3300025945 Bacteria 2722
330 Ga0207679_10136300 3300025945 Bacteria 1977
331 Ga0207679_10165182 3300025945 Bacteria 1817
332 Ga0207667_10008269 3300025949 Bacteria 12381
333 Ga0207667_10062028 3300025949 Bacteria 3910
334 Ga0207667_10089697 3300025949 Bacteria 3177
335 Ga0207667_10556614 3300025949 Bacteria 1160
336 Ga0207651_10008324 3300025960 Bacteria 5595
337 Ga0207651_10016590 3300025960 Bacteria 4320
338 Ga0207651_10050147 3300025960 Bacteria 2832
339 Ga0207651_10074504 3300025960 Bacteria 2418
340 Ga0207651_10324239 3300025960 Bacteria 1288
341 Ga0207668_10000070 3300025972 Bacteria 78666
342 Ga0207668_10029230 3300025972 Bacteria 3611
343 Ga0207640_10010448 3300025981 Bacteria 5229
344 Ga0207640_10114317 3300025981 Bacteria 1920
345 Ga0207640_10115380 3300025981 Bacteria 1913
346 Ga0207658_10006101 3300025986 Bacteria 8228
347 Ga0207658_10013515 3300025986 Bacteria 5579
348 Ga0207658_10014061 3300025986 Bacteria 5479
349 Ga0207658_10028486 3300025986 Bacteria 3933
350 Ga0207658_10056077 3300025986 Bacteria 2922
351 Ga0207677_10022701 3300026023 Bacteria 3861
352 Ga0207677_10029235 3300026023 Bacteria 3499
353 Ga0207677_10115739 3300026023 Bacteria 2006
354 Ga0207677_10285040 3300026023 Bacteria 1358
355 Ga0207703_10001894 3300026035 Bacteria 18548
356 Ga0207703_10004651 3300026035 Bacteria 11214
357 Ga0207703_10020613 3300026035 Bacteria 5157
358 Ga0207703_10051450 3300026035 Bacteria 3338
359 Ga0207703_10391599 3300026035 Bacteria 1287
360 Ga0207639_10000754 3300026041 Bacteria 22067
361 Ga0207639_10039305 3300026041 Bacteria 3524
362 Ga0207678_10002682 3300026067 Bacteria 16154
363 Ga0207678_10003724 3300026067 Bacteria 13714
364 Ga0207678_10006723 3300026067 Bacteria 10198
365 Ga0207678_10036604 3300026067 Bacteria 4272
366 Ga0207678_10087151 3300026067 Bacteria 2668
367 Ga0207678_10128907 3300026067 Bacteria 2157
368 Ga0207702_10000323 3300026078 Bacteria 54764
369 Ga0207702_10020794 3300026078 Bacteria 5428
370 Ga0207702_10272183 3300026078 Bacteria 1598
371 Ga0207641_10001621 3300026088 Bacteria 21953
372 Ga0207641_10012721 3300026088 Bacteria 6899
373 Ga0207641_10040447 3300026088 Bacteria 3904
374 Ga0207648_10009738 3300026089 Bacteria 9188
375 Ga0207648_10065088 3300026089 Bacteria 3178
376 Ga0207648_10254026 3300026089 Bacteria 1567
377 Ga0207676_10000446 3300026095 Bacteria 34960
378 Ga0207676_10095426 3300026095 Bacteria 2452
379 Ga0207674_10000308 3300026116 Bacteria 62120
380 Ga0207674_10006404 3300026116 Bacteria 13848
381 Ga0207674_10009135 3300026116 Bacteria 11373
382 Ga0207674_10017639 3300026116 Bacteria 7785
383 Ga0207674_10017868 3300026116 Bacteria 7730
384 Ga0207675_100070452 3300026118 Bacteria 3268
385 Ga0207675_100143220 3300026118 Bacteria 2271
386 Ga0207675_100392426 3300026118 Bacteria 1366
387 Ga0207683_10010518 3300026121 Bacteria 7895
388 Ga0207683_10288500 3300026121 Bacteria 1500
389 Ga0207698_10001389 3300026142 Bacteria 14067
390 Ga0207698_10048191 3300026142 Bacteria 3233
391 Ga0207698_10058348 3300026142 Bacteria 2991
392 Ga0207698_10063233 3300026142 Bacteria 2895
393 Ga0207698_10151944 3300026142 Bacteria 2011
394 Ga0207698_10250348 3300026142 Bacteria 1621
395 Ga0268266_10022686 3300028379 Bacteria 5344
396 Ga0268266_10027920 3300028379 Bacteria 4800
397 Ga0268264_10001254 3300028381 Bacteria 24199
398 Ga0268264_10054786 3300028381 Bacteria 3331
399 Ga0307405_10058451 3300031731 Bacteria 2426
400 Ga0307405_10061804 3300031731 Bacteria 2369
401 Ga0307410_10005219 3300031852 Bacteria 6841
402 Ga0307410_10047522 3300031852 Bacteria 2868
403 Ga0307407_10077708 3300031903 Bacteria 1997
404 Ga0307412_10118133 3300031911 Bacteria 1904
405 Ga0307412_10175224 3300031911 Bacteria 1607
406 Ga0307409_100014270 3300031995 Bacteria 5158
407 Ga0307409_100026619 3300031995 Bacteria 4082
408 Ga0307416_100221316 3300032002 Bacteria 1816
409 Ga0307414_10150570 3300032004 Bacteria 1835
410 Ga0307411_10002066 3300032005 Bacteria 8629
411 Ga0307411_10003991 3300032005 Bacteria 6971
412 Ga0307411_10044787 3300032005 Bacteria 2841
413 Ga0307411_10058870 3300032005 Bacteria 2545
414 Ga0307415_100046790 3300032126 Bacteria 2908
415 Ga0373946_0022230 3300035171 Bacteria 2467
416 Ga0373955_0001801 3300035172 Bacteria 9205
417 Ga0373935_0019723 3300035692 Bacteria 4112
418 Ga0373933_0035774 3300035724 Bacteria 2903
419 Ga0395899_0001198 3300037312 Bacteria 22796
420 Ga0395899_0037217 3300037312 Bacteria 3648
421 Ga0395899_0046049 3300037312 Bacteria 3249
422 Ga0395899_0093332 3300037312 Bacteria 2178
423 Ga0395899_0118462 3300037312 Bacteria 1898
424 Ga0395899_0187972 3300037312 Bacteria 1446
425 Ga0395899_0200997 3300037312 Bacteria 1389
426 Ga0395900_0000093 3300037418 Bacteria 166505
427 Ga0395900_0007133 3300037418 Bacteria 11578
428 Ga0395900_0018451 3300037418 Bacteria 7115
429 Ga0395900_0018682 3300037418 Bacteria 7069
430 Ga0395900_0020612 3300037418 Bacteria 6734
431 Ga0395900_0022739 3300037418 Bacteria 6417
432 Ga0395900_0024132 3300037418 Bacteria 6226
433 Ga0395900_0038255 3300037418 Bacteria 4945
434 Ga0395900_0039372 3300037418 Bacteria 4870
435 Ga0395900_0041349 3300037418 Bacteria 4752
436 Ga0395900_0046971 3300037418 Bacteria 4446
437 Ga0395900_0052801 3300037418 Bacteria 4184
438 Ga0395900_0060057 3300037418 Bacteria 3913
439 Ga0395900_0130898 3300037418 Bacteria 2571
440 Ga0395900_0133830 3300037418 Bacteria 2539
441 Ga0395900_0157703 3300037418 Bacteria 2317
442 Ga0395900_0194479 3300037418 Bacteria 2055
443 Ga0395900_0236737 3300037418 Bacteria 1833
444 Ga0395900_0293111 3300037418 Bacteria 1615
445 Ga0395900_0299875 3300037418 Bacteria 1593
446 Ga0395900_0347548 3300037418 Bacteria 1457
447 Ga0395898_0000053 3300037466 Bacteria 279600
448 Ga0395898_0001084 3300037466 Bacteria 42107
449 Ga0395898_0008780 3300037466 Bacteria 10649
450 Ga0395898_0016261 3300037466 Bacteria 7613
451 Ga0395898_0039628 3300037466 Bacteria 4662
452 Ga0395898_0062232 3300037466 Bacteria 3624
453 Ga0395898_0081796 3300037466 Bacteria 3113
454 Ga0395898_0149500 3300037466 Bacteria 2235
455 Ga0395898_0246012 3300037466 Bacteria 1705
456 Ga0395898_0413583 3300037466 Bacteria 1285
457 Ga0395905_0000031 3300037471 Bacteria 286757
458 Ga0395905_0001268 3300037471 Bacteria 31200
459 Ga0395905_0002525 3300037471 Bacteria 20191
460 Ga0395905_0002788 3300037471 Bacteria 19144
461 Ga0395905_0004604 3300037471 Bacteria 14271
462 Ga0395905_0005106 3300037471 Bacteria 13488
463 Ga0395905_0007657 3300037471 Bacteria 10718
464 Ga0395905_0028397 3300037471 Bacteria 5275
465 Ga0395905_0030204 3300037471 Bacteria 5108
466 Ga0395905_0035236 3300037471 Bacteria 4699
467 Ga0395905_0047489 3300037471 Bacteria 4024
468 Ga0395905_0048729 3300037471 Bacteria 3969
469 Ga0395905_0057427 3300037471 Bacteria 3640
470 Ga0395905_0058348 3300037471 Bacteria 3609
471 Ga0395905_0062731 3300037471 Bacteria 3476
472 Ga0395905_0095578 3300037471 Bacteria 2789
473 Ga0395905_0102103 3300037471 Bacteria 2692
474 Ga0395905_0189499 3300037471 Bacteria 1929
475 Ga0395905_0243227 3300037471 Bacteria 1681
476 Ga0395905_0245049 3300037471 Bacteria 1674
477 Ga0395905_0262122 3300037471 Bacteria 1613
478 Ga0395905_0412777 3300037471 Bacteria 1245
479 Ga0395905_0452901 3300037471 Bacteria 1181
480 Ga0395901_0000339 3300038443 Bacteria 56917
481 Ga0395901_0004476 3300038443 Bacteria 14099
482 Ga0395901_0007396 3300038443 Bacteria 11079
483 Ga0395901_0013519 3300038443 Bacteria 8300
484 Ga0395901_0038598 3300038443 Bacteria 4940
485 Ga0395901_0039207 3300038443 Bacteria 4902
486 Ga0395901_0072775 3300038443 Bacteria 3583
487 Ga0395901_0100947 3300038443 Bacteria 3027
488 Ga0395901_0298316 3300038443 Bacteria 1671
489 Ga0395901_0321245 3300038443 Bacteria 1601
490 Ga0395901_0377106 3300038443 Bacteria 1460
491 Ga0436365_1352056 3300039437 Bacteria 3011
492 Ga0439448_0026250 3300042005 Bacteria 1830
493 Ga0439455_0017792 3300042012 Bacteria 1660
494 Ga0450889_000965 3300042144 Bacteria 3052
495 Ga0466969_0081800 3300044656 Bacteria 1540
496 Ga0466969_0095134 3300044656 Bacteria 1408
497 Ga0466966_0012027 3300044684 Bacteria 5736
498 Ga0466966_0084192 3300044684 Bacteria 1978
499 Ga0466961_0042176 3300044693 Bacteria 2925
500 Ga0466963_0013903 3300044694 Bacteria 4955
501 Ga0466963_0035291 3300044694 Bacteria 3257
502 Ga0466963_0211774 3300044694 Bacteria 1356
503 Ga0466964_0011606 3300044706 Bacteria 3331
504 Ga0466971_0009222 3300044719 Bacteria 4312
505 Ga0466957_0022417 3300044842 Bacteria 3726
506 Ga0466957_0170447 3300044842 Bacteria 1418
507 Ga0466959_0071425 3300045049 Bacteria 2513
508 Ga0466959_0075353 3300045049 Bacteria 2438
509 Ga0466959_0081498 3300045049 Bacteria 2332
510 Ga0466959_0104073 3300045049 Bacteria 2030
511 Ga0466958_0076125 3300045836 Bacteria 2059
512 Ga0466967_0070125 3300045976 Bacteria 3135
513 Ga0466967_0093784 3300045976 Bacteria 2732
514 Ga0466967_0548032 3300045976 Bacteria 1138
515 Ga0495668_0007814 3300046616 Bacteria 6776
516 Ga0495623_0027628 3300046679 Bacteria 3653
517 Ga0495677_0004157 3300047445 Bacteria 5585
518 Ga0495602_0031005 3300048088 Bacteria 5062
519 Ga0496100_0012340 3300048903 Bacteria 4895
520 Ga0496100_0227021 3300048903 Bacteria 1372
521 Ga0496101_0001043 3300048904 Bacteria 16361
522 Ga0496101_0065888 3300048904 Bacteria 2641
523 Ga0496101_0196523 3300048904 Bacteria 1558
524 Ga0496102_0028207 3300048905 Bacteria 5014
525 Ga0496105_0356043 3300048908 Bacteria 1168
526 Ga0496106_0051418 3300048909 Bacteria 3107
527 Ga0496107_0021772 3300048910 Bacteria 4530
528 Ga0496108_0004702 3300048911 Bacteria 11012
529 Ga0496108_0010651 3300048911 Bacteria 7459
530 Ga0496108_0019405 3300048911 Bacteria 5583
531 Ga0496109_0005117 3300048912 Bacteria 10956
532 Ga0496109_0045813 3300048912 Bacteria 3970
533 Ga0496109_0058015 3300048912 Bacteria 3535
534 Ga0496109_0356860 3300048912 Bacteria 1381
535 Ga0496110_0004667 3300048913 Bacteria 10653
536 Ga0496110_0056650 3300048913 Bacteria 3449
537 Ga0496111_0011687 3300048914 Bacteria 5926
538 Ga0496111_0028532 3300048914 Bacteria 3955
539 Ga0496111_0033517 3300048914 Bacteria 3663
540 Ga0496111_0118198 3300048914 Bacteria 1957
541 Ga0496111_0145801 3300048914 Bacteria 1755
542 Ga0496112_0000161 3300048915 Bacteria 42407
543 Ga0496112_0001522 3300048915 Bacteria 17862
544 Ga0496112_0013201 3300048915 Bacteria 7620
545 Ga0496112_0073923 3300048915 Bacteria 3369
546 Ga0496113_0002715 3300048916 Bacteria 10396
547 Ga0496113_0009123 3300048916 Bacteria 6499
548 Ga0496113_0009501 3300048916 Bacteria 6379
549 Ga0496113_0015133 3300048916 Bacteria 5290
550 Ga0496114_0000019 3300048917 Bacteria 244365
551 Ga0496114_0061753 3300048917 Bacteria 3135
552 Ga0496114_0079422 3300048917 Bacteria 2769
553 Ga0496115_0000488 3300048918 Bacteria 31339
554 Ga0496115_0140797 3300048918 Bacteria 1990
555 Ga0501067_0016936 3300049583 Bacteria 4027
556 Ga0501068_0022592 3300049584 Bacteria 3679
557 Ga0501069_0059423 3300049585 Bacteria 2133
558 Ga0501080_0062928 3300049742 Bacteria 3453
559 Ga0501268_001320 3300049765 Bacteria 3074
560 nmdc:mga00v17_130720_c1 3300050491 Bacteria 1604
561 nmdc:mga0k408_73385_c1 3300050493 Bacteria 1998
562 nmdc:mga09592_352147_c1 3300050508 Bacteria 1274
563 nmdc:mga08y16_331939_c1 3300050511 Bacteria 1564
564 nmdc:mga0a205_160904_c1 3300050515 Bacteria 2142
565 Ga0500658_0000041 3300053134 Bacteria 77435
566 2738712160 2738541275 Bacteria 4830863
567 2928102491 2928100450 Bacteria 4837635
568 Ga0070659_100090121
569 JGI24741J21665_1003534
570 JGI24740J21852_10001632
571 JGI24739J22299_10002101
572 JGI24739J22299_10009219
573 JGI24737J22298_10003529
574 JGI24737J22298_10014122
575 JGI24735J21928_10027661
576 JGI24744J21845_10006369
577 Ga0070658_10001352
578 Ga0070658_10018232
579 Ga0070658_10019310
580 Ga0070658_10049686
581 Ga0070658_10078808
582 Ga0070658_10116817
583 Ga0070683_100020756
584 Ga0070683_100023452
585 Ga0070683_100085459
586 Ga0070683_100120939
587 Ga0070683_100303648
588 Ga0070690_100035433
589 Ga0070690_100096262
590 Ga0070690_100113835
591 Ga0070670_100009979
592 Ga0070670_100035846
593 Ga0070670_100063345
594 Ga0070670_100086100
595 Ga0070670_100297406
596 Ga0070677_10081408
597 Ga0068869_100018311
598 Ga0068869_100030604
599 Ga0070666_10002844
600 Ga0070666_10020500
601 Ga0070680_100312484
602 Ga0070682_100052930
603 Ga0068868_100005000
604 Ga0070660_100000012
605 Ga0070660_100054721
606 Ga0070660_100170396
607 Ga0070660_100331464
608 Ga0070661_100000251
609 Ga0070661_100014003
610 Ga0070661_100268695
611 Ga0070692_10065586
612 Ga0070668_100006224
613 Ga0070668_100063822
614 Ga0070668_100165714
615 Ga0070669_100284247
616 Ga0070669_100334965
617 Ga0070675_100010756
618 Ga0070675_100090932
619 Ga0070675_100129903
620 Ga0070675_100248117
621 Ga0070675_100412242
622 Ga0070671_100000356
623 Ga0070671_100003440
624 Ga0070671_100004676
625 Ga0070671_100013615
626 Ga0070671_100065834
627 Ga0070671_100164394
628 Ga0070671_100225588
629 Ga0070674_100006680
630 Ga0070674_100017030
631 Ga0070674_100139703
632 Ga0070673_100008385
633 Ga0070673_100072858
634 Ga0070673_100272723
635 Ga0070673_100363391
636 Ga0070659_100000254
637 Ga0070659_100021249
638 Ga0070659_100067334
639 Ga0070659_100154804
640 Ga0070659_100204622
641 Ga0070659_100237774
642 Ga0070667_100001265
643 Ga0070667_100008606
644 Ga0070667_100042324
645 Ga0070667_100072221
646 Ga0070709_10267938
647 Ga0070714_100052859
648 Ga0070714_100115264
649 Ga0070713_100012893
650 Ga0070713_100308400
651 Ga0070663_100000089
652 Ga0070663_100004495
653 Ga0070663_100041534
654 Ga0070663_100124157
655 Ga0070663_100165269
656 Ga0070678_100005602
657 Ga0070678_100012540
658 Ga0070662_100000023
659 Ga0070662_100014212
660 Ga0070662_100020254
661 Ga0070662_100030837
662 Ga0070662_100058995
663 Ga0070662_100112336
664 Ga0070662_100227081
665 Ga0070662_100230975
666 Ga0070662_100236107
667 Ga0070662_100400990
668 Ga0070681_10126638
669 Ga0070681_10130077
670 Ga0068867_100118396
671 Ga0070679_100194917
672 Ga0070679_100280991
673 Ga0070684_100014255
674 Ga0070684_100016587
675 Ga0068853_100000491
676 Ga0068853_100195510
677 Ga0070672_100005173
678 Ga0070672_100024701
679 Ga0070672_100076900
680 Ga0070672_100185192
681 Ga0070686_100027884
682 Ga0070695_100205079
683 Ga0070696_100022566
684 Ga0068855_100010293
685 Ga0068855_100015136
686 Ga0068855_100086144
687 Ga0068855_100096780
688 Ga0068855_100291554
689 Ga0068855_100315026
690 Ga0070664_100000951
691 Ga0070664_100005277
692 Ga0070664_100070857
693 Ga0070664_100343102
694 Ga0070664_100351769
695 Ga0068857_100007268
696 Ga0068857_100038977
697 Ga0068857_100221721
698 Ga0068854_100012540
699 Ga0068854_100109736
700 Ga0068854_100267631
701 Ga0068856_100000128
702 Ga0068856_100011799
703 Ga0068856_100078080
704 Ga0068856_100166625
705 Ga0068856_100275777
706 Ga0068852_100000359
707 Ga0068852_100046942
708 Ga0068852_100049173
709 Ga0068859_100003414
710 Ga0068859_100023037
711 Ga0068859_100074338
712 Ga0068859_100102752
713 Ga0068859_100266524
714 Ga0068859_100471621
715 Ga0068864_100000713
716 Ga0068864_100033913
717 Ga0068864_100069433
718 Ga0068851_10003368
719 Ga0068851_10046854
720 Ga0068863_100002105
721 Ga0068863_100010452
722 Ga0068863_100018929
723 Ga0068863_100037827
724 Ga0068863_100042898
725 Ga0068863_100167404
726 Ga0068858_100001407
727 Ga0068858_100005575
728 Ga0068858_100019046
729 Ga0068858_100092488
730 Ga0068860_100009287
731 Ga0068860_100013628
732 Ga0068860_100193083
733 Ga0068862_100021750
734 Ga0068862_100425169
735 Ga0068862_100459564
736 Ga0070717_10002429
737 Ga0075364_10159969
738 Ga0070712_100049879
739 Ga0097621_100007766
740 Ga0097621_100036190
741 Ga0068871_100007308
742 Ga0075428_100251500
743 Ga0075433_10063789
744 Ga0097620_100003414
745 Ga0097620_100023037
746 Ga0097620_100074339
747 Ga0097620_100102753
748 Ga0097620_100266544
749 Ga0097620_100471583
750 Ga0105240_10001847
751 Ga0105240_10388002
752 Ga0111539_10132715
753 Ga0105247_10092587
754 Ga0114129_10622457
755 Ga0105241_10064946
756 Ga0105242_10222455
757 Ga0105248_10000168
758 Ga0105248_10001002
759 Ga0105248_10001965
760 Ga0105248_10041900
761 Ga0105248_10042516
762 Ga0105248_10130056
763 Ga0105248_10162954
764 Ga0105238_10292880
765 Ga0157373_10031370
766 Ga0157373_10055372
767 Ga0157371_10000765
768 Ga0157371_10013052
769 Ga0157371_10086220
770 Ga0157371_10123176
771 Ga0157371_10247809
772 Ga0157370_10000534
773 Ga0157370_10094779
774 Ga0157369_10144877
775 Ga0157369_10281589
776 Ga0157369_10284141
777 Ga0157369_10348100
778 Ga0157369_10513808
779 Ga0157374_10038314
780 Ga0157374_10152924
781 Ga0157378_10130925
782 Ga0163162_10013333
783 Ga0163162_10014270
784 Ga0163162_10054089
785 Ga0163162_10384574
786 Ga0157375_10007560
787 Ga0157375_10093017
788 Ga0157375_10194189
789 Ga0163163_10000151
790 Ga0163163_10000991
791 Ga0163163_10095092
792 Ga0163163_10129357
793 Ga0157377_10003012
794 Ga0157379_10001787
795 Ga0157379_10121365
796 Ga0206353_10048212
797 Ga0207697_10013790
798 Ga0207697_10081670
799 Ga0207656_10031573
800 Ga0207656_10076845
801 Ga0207682_10019838
802 Ga0207688_10022604
803 Ga0207688_10042413
804 Ga0207688_10062699
805 Ga0207680_10000271
806 Ga0207680_10027566
807 Ga0207647_10013159
808 Ga0207647_10084072
809 Ga0207699_10174313
810 Ga0207645_10000896
811 Ga0207645_10012249
812 Ga0207705_10000694
813 Ga0207705_10001792
814 Ga0207705_10001965
815 Ga0207705_10020893
816 Ga0207705_10027999
817 Ga0207705_10169354
818 Ga0207707_10044718
819 Ga0207660_10029261
820 Ga0207660_10057612
821 Ga0207660_10245679
822 Ga0207657_10000038
823 Ga0207657_10001185
824 Ga0207657_10002057
825 Ga0207657_10018539
826 Ga0207657_10044947
827 Ga0207657_10080628
828 Ga0207657_10111868
829 Ga0207657_10158384
830 Ga0207657_10191859
831 Ga0207649_10051015
832 Ga0207649_10065561
833 Ga0207652_10008636
834 Ga0207652_10044274
835 Ga0207681_10025491
836 Ga0207681_10124455
837 Ga0207681_10148525
838 Ga0207650_10024990
839 Ga0207650_10030898
840 Ga0207650_10095236
841 Ga0207650_10182205
842 Ga0207659_10026990
843 Ga0207659_10060116
844 Ga0207659_10336647
845 Ga0207687_10053701
846 Ga0207700_10079587
847 Ga0207664_10062451
848 Ga0207664_10202666
849 Ga0207664_10248486
850 Ga0207644_10000794
851 Ga0207644_10001261
852 Ga0207644_10002807
853 Ga0207644_10006303
854 Ga0207644_10006565
855 Ga0207644_10013382
856 Ga0207644_10013741
857 Ga0207690_10000149
858 Ga0207690_10012995
859 Ga0207690_10045922
860 Ga0207690_10112663
861 Ga0207690_10199647
862 Ga0207690_10275768
863 Ga0207706_10000061
864 Ga0207706_10000675
865 Ga0207706_10004182
866 Ga0207706_10019015
867 Ga0207706_10034041
868 Ga0207706_10034214
869 Ga0207706_10037251
870 Ga0207706_10049572
871 Ga0207706_10165720
872 Ga0207706_10167371
873 Ga0207706_10394936
874 Ga0207709_10045463
875 Ga0207669_10013957
876 Ga0207704_10045315
877 Ga0207691_10005337
878 Ga0207691_10011187
879 Ga0207691_10106515
880 Ga0207691_10149724
881 Ga0207691_10172575
882 Ga0207691_10295898
883 Ga0207711_10000044
884 Ga0207711_10000823
885 Ga0207711_10001606
886 Ga0207711_10005580
887 Ga0207711_10056130
888 Ga0207711_10169903
889 Ga0207689_10005456
890 Ga0207689_10222908
891 Ga0207661_10015991
892 Ga0207661_10173287
893 Ga0207679_10000149
894 Ga0207679_10020953
895 Ga0207679_10021288
896 Ga0207679_10065306
897 Ga0207679_10136300
898 Ga0207679_10165182
899 Ga0207667_10008269
900 Ga0207667_10062028
901 Ga0207667_10089697
902 Ga0207667_10556614
903 Ga0207651_10008324
904 Ga0207651_10016590
905 Ga0207651_10050147
906 Ga0207651_10074504
907 Ga0207651_10324239
908 Ga0207668_10000070
909 Ga0207668_10029230
910 Ga0207640_10010448
911 Ga0207640_10114317
912 Ga0207640_10115380
913 Ga0207658_10006101
914 Ga0207658_10013515
915 Ga0207658_10014061
916 Ga0207658_10028486
917 Ga0207658_10056077
918 Ga0207677_10022701
919 Ga0207677_10029235
920 Ga0207677_10115739
921 Ga0207677_10285040
922 Ga0207703_10001894
923 Ga0207703_10004651
924 Ga0207703_10020613
925 Ga0207703_10051450
926 Ga0207703_10391599
927 Ga0207639_10000754
928 Ga0207639_10039305
929 Ga0207678_10002682
930 Ga0207678_10003724
931 Ga0207678_10006723
932 Ga0207678_10036604
933 Ga0207678_10087151
934 Ga0207678_10128907
935 Ga0207702_10000323
936 Ga0207702_10020794
937 Ga0207702_10272183
938 Ga0207641_10001621
939 Ga0207641_10012721
940 Ga0207641_10040447
941 Ga0207648_10009738
942 Ga0207648_10065088
943 Ga0207648_10254026
944 Ga0207676_10000446
945 Ga0207676_10095426
946 Ga0207674_10000308
947 Ga0207674_10006404
948 Ga0207674_10009135
949 Ga0207674_10017639
950 Ga0207674_10017868
951 Ga0207675_100070452
952 Ga0207675_100143220
953 Ga0207675_100392426
954 Ga0207683_10010518
955 Ga0207683_10288500
956 Ga0207698_10001389
957 Ga0207698_10048191
958 Ga0207698_10058348
959 Ga0207698_10063233
960 Ga0207698_10151944
961 Ga0207698_10250348
962 Ga0268266_10022686
963 Ga0268266_10027920
964 Ga0268264_10001254
965 Ga0268264_10054786
966 Ga0307405_10058451
967 Ga0307405_10061804
968 Ga0307410_10005219
969 Ga0307410_10047522
970 Ga0307407_10077708
971 Ga0307412_10118133
972 Ga0307412_10175224
973 Ga0307409_100014270
974 Ga0307409_100026619
975 Ga0307416_100221316
976 Ga0307414_10150570
977 Ga0307411_10002066
978 Ga0307411_10003991
979 Ga0307411_10044787
980 Ga0307411_10058870
981 Ga0307415_100046790
982 Ga0373946_0022230
983 Ga0373955_0001801
984 Ga0373935_0019723
985 Ga0373933_0035774
986 Ga0395899_0001198
987 Ga0395899_0037217
988 Ga0395899_0046049
989 Ga0395899_0093332
990 Ga0395899_0118462
991 Ga0395899_0187972
992 Ga0395899_0200997
993 Ga0395900_0000093
994 Ga0395900_0007133
995 Ga0395900_0018451
996 Ga0395900_0018682
997 Ga0395900_0020612
998 Ga0395900_0022739
999 Ga0395900_0024132
1000 Ga0395900_0038255
1001 Ga0395900_0039372
1002 Ga0395900_0041349
1003 Ga0395900_0046971
1004 Ga0395900_0052801
1005 Ga0395900_0060057
1006 Ga0395900_0130898
1007 Ga0395900_0133830
1008 Ga0395900_0157703
1009 Ga0395900_0194479
1010 Ga0395900_0236737
1011 Ga0395900_0293111
1012 Ga0395900_0299875
1013 Ga0395900_0347548
1014 Ga0395898_0000053
1015 Ga0395898_0001084
1016 Ga0395898_0008780
1017 Ga0395898_0016261
1018 Ga0395898_0039628
1019 Ga0395898_0062232
1020 Ga0395898_0081796
1021 Ga0395898_0149500
1022 Ga0395898_0246012
1023 Ga0395898_0413583
1024 Ga0395905_0000031
1025 Ga0395905_0001268
1026 Ga0395905_0002525
1027 Ga0395905_0002788
1028 Ga0395905_0004604
1029 Ga0395905_0005106
1030 Ga0395905_0007657
1031 Ga0395905_0028397
1032 Ga0395905_0030204
1033 Ga0395905_0035236
1034 Ga0395905_0047489
1035 Ga0395905_0048729
1036 Ga0395905_0057427
1037 Ga0395905_0058348
1038 Ga0395905_0062731
1039 Ga0395905_0095578
1040 Ga0395905_0102103
1041 Ga0395905_0189499
1042 Ga0395905_0243227
1043 Ga0395905_0245049
1044 Ga0395905_0262122
1045 Ga0395905_0412777
1046 Ga0395905_0452901
1047 Ga0395901_0000339
1048 Ga0395901_0004476
1049 Ga0395901_0007396
1050 Ga0395901_0013519
1051 Ga0395901_0038598
1052 Ga0395901_0039207
1053 Ga0395901_0072775
1054 Ga0395901_0100947
1055 Ga0395901_0298316
1056 Ga0395901_0321245
1057 Ga0395901_0377106
1058 Ga0436365_1352056
1059 Ga0439448_0026250
1060 Ga0439455_0017792
1061 Ga0450889_000965
1062 Ga0466969_0081800
1063 Ga0466969_0095134
1064 Ga0466966_0012027
1065 Ga0466966_0084192
1066 Ga0466961_0042176
1067 Ga0466963_0013903
1068 Ga0466963_0035291
1069 Ga0466963_0211774
1070 Ga0466964_0011606
1071 Ga0466971_0009222
1072 Ga0466957_0022417
1073 Ga0466957_0170447
1074 Ga0466959_0071425
1075 Ga0466959_0075353
1076 Ga0466959_0081498
1077 Ga0466959_0104073
1078 Ga0466958_0076125
1079 Ga0466967_0070125
1080 Ga0466967_0093784
1081 Ga0466967_0548032
1082 Ga0495668_0007814
1083 Ga0495623_0027628
1084 Ga0495677_0004157
1085 Ga0495602_0031005
1086 Ga0496100_0012340
1087 Ga0496100_0227021
1088 Ga0496101_0001043
1089 Ga0496101_0065888
1090 Ga0496101_0196523
1091 Ga0496102_0028207
1092 Ga0496105_0356043
1093 Ga0496106_0051418
1094 Ga0496107_0021772
1095 Ga0496108_0004702
1096 Ga0496108_0010651
1097 Ga0496108_0019405
1098 Ga0496109_0005117
1099 Ga0496109_0045813
1100 Ga0496109_0058015
1101 Ga0496109_0356860
1102 Ga0496110_0004667
1103 Ga0496110_0056650
1104 Ga0496111_0011687
1105 Ga0496111_0028532
1106 Ga0496111_0033517
1107 Ga0496111_0118198
1108 Ga0496111_0145801
1109 Ga0496112_0000161
1110 Ga0496112_0001522
1111 Ga0496112_0013201
1112 Ga0496112_0073923
1113 Ga0496113_0002715
1114 Ga0496113_0009123
1115 Ga0496113_0009501
1116 Ga0496113_0015133
1117 Ga0496114_0000019
1118 Ga0496114_0061753
1119 Ga0496114_0079422
1120 Ga0496115_0000488
1121 Ga0496115_0140797
1122 Ga0501067_0016936
1123 Ga0501068_0022592
1124 Ga0501069_0059423
1125 Ga0501080_0062928
1126 Ga0501268_001320
1127 nmdc:mga00v17_130720_c1
1128 nmdc:mga0k408_73385_c1
1129 nmdc:mga09592_352147_c1
1130 nmdc:mga08y16_331939_c1
1131 nmdc:mga0a205_160904_c1
1132 Ga0500658_0000041
1133 2738712160
1134 2928102491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

27

287

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.9312 1 330
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.9203 1 330
2ppq-assembly1.cif.gz_A-2 crystal structure of the homoserine kinase from agrobacterium tumefaciens 0.7486 1 327
2bkk-assembly1.cif.gz_A crystal structure of aminoglycoside phosphotransferase aph(3')-iiia in complex with the inhibitor ar_3a 0.7376 7 288
6fdn-assembly1.cif.gz_B rio2 structure 0.7235 8 221
ID Description Score Start End Superfamily
af_B3DMA2_17_122_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9504 1 101 3.30.200.20
af_Q8K370_368_600_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9387 104 330 3.90.1200.10
af_O01590_328_568_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9379 103 333 3.90.1200.10
3dxpA02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9312 103 330 3.90.1200.10
af_Q8RWZ3_20_127_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9306 5 103 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A0Q8XRY5-F1-model_v4 Aminoglycoside phosphotransferase 0.9755 2 333 GO:0016740
AF-A0A0D7NV26-F1-model_v4 Aminoglycoside phosphotransferase 0.971 1 333 GO:0016740
AF-A0A7Y2YK71-F1-model_v4 Phosphotransferase family protein 0.9708 1 141 GO:0016740
AF-A0A3N6PKU2-F1-model_v4 Phosphotransferase family protein 0.9705 1 333 GO:0016740
AF-A0A3N2QIF4-F1-model_v4 deleted 0.9702 1 333

Map