F464409

General Info

Members Datasets Scaffolds Average Seq Length
566 291 1132 186

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_11175207|Ga0268265_111752071
Length 223
Sequence MLTDRISRTTASRLPFNMRWAAPARLYGEWQPLRYDFTMQPADSILFSGGAPGAEAEFGACAERHGIEEVNFTFDGHKIVRHRGVRVLNHEELQNGDVSLEYVGKLMQRRYTDAPTIRKVLQTLWYQVNSGQEIYVIGTILDDNTVRGGTGWGAEFAKLCNKPLFVFDQDKNGWRKWTGEAWQALDGANAPVITHPHFTGTGTRTLKDQSKQAIEDLFTRSFG

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
192 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
193 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
194 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 5.3
Rhizosphere 93.11
Stem 0
Stem Tuber 0
Unclassified 15.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_11175207 3300028380 Bacteria 764
2 JGI24743J22301_10015236 3300001991 Bacteria 1424
3 Ga0065712_10010379 3300005290 Bacteria 3449
4 Ga0065712_10068736 3300005290 Bacteria 9191
5 Ga0065712_10093272 3300005290 Unclassified 2299
6 Ga0065712_10099012 3300005290 Bacteria 2102
7 Ga0065715_10090856 3300005293 Bacteria 6374
8 Ga0065715_10127634 3300005293 Bacteria 2083
9 Ga0065715_10198011 3300005293 Bacteria 1374
10 Ga0065715_10199945 3300005293 Bacteria 1367
11 Ga0065715_10295830 3300005293 Bacteria 1052
12 Ga0065715_10632930 3300005293 Bacteria 677
13 Ga0065707_10352843 3300005295 Bacteria 916
14 Ga0070658_10573652 3300005327 Unclassified 977
15 Ga0070658_11342093 3300005327 Unclassified 621
16 Ga0070676_10406316 3300005328 Bacteria 949
17 Ga0070683_100008903 3300005329 Bacteria 8552
18 Ga0070683_100161209 3300005329 Bacteria 2128
19 Ga0070690_100057759 3300005330 Bacteria 2490
20 Ga0070670_100079230 3300005331 Bacteria 2823
21 Ga0070670_100089564 3300005331 Bacteria 2645
22 Ga0070670_100119548 3300005331 Bacteria 2273
23 Ga0070670_100211544 3300005331 Bacteria 1686
24 Ga0070670_100343948 3300005331 Bacteria 1310
25 Ga0070670_100485479 3300005331 Unclassified 1097
26 Ga0070677_10219512 3300005333 Unclassified 928
27 Ga0068869_100117168 3300005334 Bacteria 2033
28 Ga0070666_10085569 3300005335 Bacteria 2159
29 Ga0070666_10230045 3300005335 Bacteria 1309
30 Ga0070682_100395766 3300005337 Unclassified 1043
31 Ga0068868_100125947 3300005338 Bacteria 2093
32 Ga0068868_100343570 3300005338 Bacteria 1277
33 Ga0068868_100875024 3300005338 Bacteria 815
34 Ga0070689_100009871 3300005340 Bacteria 6788
35 Ga0070691_10189982 3300005341 Bacteria 1074
36 Ga0070692_10067971 3300005345 Unclassified 1892
37 Ga0070692_10194906 3300005345 Bacteria 1183
38 Ga0070668_100271108 3300005347 Bacteria 1414
39 Ga0070669_100208768 3300005353 Bacteria 1539
40 Ga0070675_100000409 3300005354 Bacteria 29206
41 Ga0070675_100247516 3300005354 Bacteria 1559
42 Ga0070675_100261720 3300005354 Unclassified 1516
43 Ga0070675_100318909 3300005354 Unclassified 1373
44 Ga0070675_100486319 3300005354 Bacteria 1111
45 Ga0070675_100864524 3300005354 Bacteria 828
46 Ga0070671_100278611 3300005355 Bacteria 1422
47 Ga0070671_100320919 3300005355 Bacteria 1320
48 Ga0070674_100009973 3300005356 Bacteria 5718
49 Ga0070674_100387103 3300005356 Bacteria 1139
50 Ga0070673_100274056 3300005364 Unclassified 1478
51 Ga0070688_100018704 3300005365 Bacteria 4003
52 Ga0070688_100078405 3300005365 Unclassified 2131
53 Ga0070667_100415549 3300005367 Bacteria 1226
54 Ga0070667_101366816 3300005367 Unclassified 664
55 Ga0070703_10021053 3300005406 Unclassified 1903
56 Ga0070713_100148374 3300005436 Bacteria 2084
57 Ga0070701_10060775 3300005438 Bacteria 1991
58 Ga0070711_100280944 3300005439 Bacteria 1317
59 Ga0070711_100755368 3300005439 Unclassified 822
60 Ga0070700_100273523 3300005441 Bacteria 1222
61 Ga0070700_100479162 3300005441 Unclassified 953
62 Ga0070694_100067757 3300005444 Unclassified 2451
63 Ga0070694_100078025 3300005444 Bacteria 2296
64 Ga0070708_100241967 3300005445 Bacteria 1694
65 Ga0070663_100025473 3300005455 Bacteria 3995
66 Ga0070678_100228851 3300005456 Unclassified 1549
67 Ga0070678_100421189 3300005456 Bacteria 1164
68 Ga0070662_100051668 3300005457 Bacteria 2969
69 Ga0070662_100095951 3300005457 Bacteria 2236
70 Ga0068867_100195722 3300005459 Unclassified 1616
71 Ga0068867_100400337 3300005459 Bacteria 1158
72 Ga0070707_100101399 3300005468 Bacteria 2789
73 Ga0070707_100235847 3300005468 Unclassified 1781
74 Ga0070698_100518945 3300005471 Unclassified 1130
75 Ga0070698_100956673 3300005471 Bacteria 803
76 Ga0070699_100543889 3300005518 Bacteria 1057
77 Ga0070684_100004579 3300005535 Bacteria 10544
78 Ga0070684_100097410 3300005535 Bacteria 2623
79 Ga0070697_101003998 3300005536 Unclassified 742
80 Ga0070672_100124767 3300005543 Bacteria 2111
81 Ga0070672_100375657 3300005543 Unclassified 1215
82 Ga0070672_100693052 3300005543 Bacteria 892
83 Ga0070672_101041324 3300005543 Viruses 726
84 Ga0070686_100098056 3300005544 Bacteria 1974
85 Ga0070686_100214041 3300005544 Unclassified 1389
86 Ga0070695_100143566 3300005545 Bacteria 1658
87 Ga0070696_100035055 3300005546 Bacteria 3454
88 Ga0070693_100019338 3300005547 Bacteria 3568
89 Ga0070665_100073214 3300005548 Bacteria 3433
90 Ga0070665_100463772 3300005548 Bacteria 1277
91 Ga0070704_100044727 3300005549 Bacteria 3078
92 Ga0070704_100060666 3300005549 Bacteria 2703
93 Ga0070704_100403968 3300005549 Unclassified 1166
94 Ga0068855_100129182 3300005563 Unclassified 2887
95 Ga0070664_100006213 3300005564 Bacteria 9652
96 Ga0070664_100119938 3300005564 Bacteria 2302
97 Ga0070664_100133575 3300005564 Bacteria 2181
98 Ga0070664_100155851 3300005564 Bacteria 2018
99 Ga0070664_100853158 3300005564 Bacteria 853
100 Ga0068854_100233659 3300005578 Bacteria 1461
101 Ga0068856_100126546 3300005614 Bacteria 2558
102 Ga0070702_100025206 3300005615 Bacteria 3184
103 Ga0068852_101144864 3300005616 Bacteria 799
104 Ga0068859_100067893 3300005617 Unclassified 3601
105 Ga0068859_100175066 3300005617 Bacteria 2227
106 Ga0068866_10790023 3300005718 Bacteria 659
107 Ga0068861_100018885 3300005719 Bacteria 4915
108 Ga0068861_100090754 3300005719 Unclassified 2411
109 Ga0068861_100143756 3300005719 Unclassified 1950
110 Ga0068863_100382646 3300005841 Bacteria 1374
111 Ga0068858_100065356 3300005842 Bacteria 3366
112 Ga0068858_100391297 3300005842 Bacteria 1335
113 Ga0068858_100591977 3300005842 Bacteria 1075
114 Ga0068858_100674752 3300005842 Bacteria 1005
115 Ga0068860_100688423 3300005843 Bacteria 1032
116 Ga0068860_100742671 3300005843 Bacteria 993
117 Ga0068862_100020965 3300005844 Bacteria 5461
118 Ga0068862_100074731 3300005844 Bacteria 2930
119 Ga0068862_100492884 3300005844 Bacteria 1162
120 Ga0068862_101141885 3300005844 Unclassified 776
121 Ga0081538_10195985 3300005981 Bacteria 838
122 Ga0070717_10244933 3300006028 Bacteria 1582
123 Ga0070717_10298799 3300006028 Bacteria 1431
124 Ga0075362_10263784 3300006177 Bacteria 849
125 Ga0075367_10043964 3300006178 Bacteria 2617
126 Ga0075366_10012308 3300006195 Bacteria 4850
127 Ga0075366_10369717 3300006195 Unclassified 881
128 Ga0097621_100258412 3300006237 Bacteria 1527
129 Ga0097621_100379837 3300006237 Bacteria 1262
130 Ga0097621_100791178 3300006237 Bacteria 878
131 Ga0068871_100239004 3300006358 Bacteria 1578
132 Ga0068871_100434094 3300006358 Bacteria 1175
133 Ga0068871_101016068 3300006358 Bacteria 773
134 Ga0075428_100000085 3300006844 Bacteria 78003
135 Ga0075428_100002199 3300006844 Bacteria 21094
136 Ga0075428_100002253 3300006844 Bacteria 20883
137 Ga0075428_100007167 3300006844 Bacteria 12347
138 Ga0075428_100016571 3300006844 Bacteria 8137
139 Ga0075428_100588353 3300006844 Bacteria 1189
140 Ga0075430_100003772 3300006846 Bacteria 12732
141 Ga0075430_100007531 3300006846 Bacteria 9192
142 Ga0075430_100017138 3300006846 Bacteria 6170
143 Ga0075431_100009895 3300006847 Bacteria 9574
144 Ga0075431_100027600 3300006847 Bacteria 5826
145 Ga0075431_100029333 3300006847 Bacteria 5662
146 Ga0075431_100192861 3300006847 Bacteria 2087
147 Ga0075431_100237146 3300006847 Bacteria 1857
148 Ga0075431_100883721 3300006847 Unclassified 864
149 Ga0075433_10015786 3300006852 Bacteria 6208
150 Ga0075433_10033285 3300006852 Bacteria 4417
151 Ga0075433_10102190 3300006852 Bacteria 2538
152 Ga0075433_10140945 3300006852 Bacteria 2143
153 Ga0075433_10260295 3300006852 Bacteria 1538
154 Ga0075434_100017873 3300006871 Bacteria 6840
155 Ga0075434_100237008 3300006871 Bacteria 1844
156 Ga0075434_100268112 3300006871 Bacteria 1727
157 Ga0075434_100994394 3300006871 Bacteria 853
158 Ga0075429_100011684 3300006880 Bacteria 7614
159 Ga0075429_100034457 3300006880 Bacteria 4400
160 Ga0068865_100177131 3300006881 Bacteria 1639
161 Ga0068865_101171808 3300006881 Bacteria 679
162 Ga0075436_100185876 3300006914 Unclassified 1469
163 Ga0097620_100067895 3300006931 Unclassified 3601
164 Ga0097620_100175072 3300006931 Bacteria 2227
165 Ga0075435_100004603 3300007076 Bacteria 9499
166 Ga0075435_100023476 3300007076 Bacteria 4773
167 Ga0075435_100024343 3300007076 Bacteria 4697
168 Ga0075435_100098369 3300007076 Bacteria 2422
169 Ga0075435_100213454 3300007076 Bacteria 1638
170 Ga0099794_10232215 3300007265 Bacteria 949
171 Ga0105240_10096914 3300009093 Bacteria 3594
172 Ga0111539_10000043 3300009094 Bacteria 128570
173 Ga0111539_10037497 3300009094 Bacteria 5852
174 Ga0111539_10108045 3300009094 Bacteria 3265
175 Ga0111539_10183728 3300009094 Bacteria 2442
176 Ga0111539_11391459 3300009094 Bacteria 814
177 Ga0105245_10040836 3300009098 Bacteria 4134
178 Ga0105245_10545785 3300009098 Bacteria 1181
179 Ga0105245_10621552 3300009098 Bacteria 1108
180 Ga0114129_10001092 3300009147 Bacteria 35623
181 Ga0114129_10001838 3300009147 Bacteria 28894
182 Ga0114129_10005748 3300009147 Bacteria 17574
183 Ga0114129_10007228 3300009147 Bacteria 15810
184 Ga0114129_10155236 3300009147 Bacteria 3130
185 Ga0114129_10214134 3300009147 Bacteria 2602
186 Ga0105243_10326131 3300009148 Bacteria 1401
187 Ga0105243_10336810 3300009148 Bacteria 1380
188 Ga0105241_10045151 3300009174 Bacteria 3342
189 Ga0105242_10755018 3300009176 Bacteria 958
190 Ga0105248_10043577 3300009177 Bacteria 5032
191 Ga0105248_10073698 3300009177 Bacteria 3837
192 Ga0105248_10077909 3300009177 Bacteria 3727
193 Ga0105248_10134737 3300009177 Bacteria 2787
194 Ga0105248_10406303 3300009177 Bacteria 1533
195 Ga0105248_10498426 3300009177 Bacteria 1373
196 Ga0105248_10630672 3300009177 Bacteria 1209
197 Ga0105248_10739779 3300009177 Bacteria 1110
198 Ga0105248_11246795 3300009177 Bacteria 841
199 Ga0105238_10302613 3300009551 Bacteria 1583
200 Ga0105238_10577342 3300009551 Unclassified 1130
201 Ga0105249_10096901 3300009553 Unclassified 2768
202 Ga0105249_10177929 3300009553 Bacteria 2067
203 Ga0105249_10233271 3300009553 Bacteria 1816
204 Ga0105249_10765704 3300009553 Bacteria 1028
205 Ga0105239_10539716 3300010375 Bacteria 1328
206 Ga0105246_10646404 3300011119 Bacteria 920
207 Ga0157369_10429383 3300013105 Bacteria 1369
208 Ga0157374_10018124 3300013296 Bacteria 6210
209 Ga0157374_10738788 3300013296 Bacteria 998
210 Ga0163162_10931603 3300013306 Bacteria 980
211 Ga0157372_10247238 3300013307 Bacteria 2070
212 Ga0157375_10291283 3300013308 Bacteria 1796
213 Ga0157375_10471840 3300013308 Bacteria 1420
214 Ga0157375_10881320 3300013308 Bacteria 1040
215 Ga0163163_10022561 3300014325 Bacteria 5964
216 Ga0163163_10143297 3300014325 Bacteria 2432
217 Ga0163163_10265415 3300014325 Bacteria 1768
218 Ga0157380_10882260 3300014326 Bacteria 919
219 Ga0157377_10127374 3300014745 Unclassified 1551
220 Ga0157379_10125788 3300014968 Bacteria 2306
221 Ga0157379_10200279 3300014968 Bacteria 1806
222 Ga0157376_10325029 3300014969 Unclassified 1463
223 Ga0157376_11013480 3300014969 Bacteria 853
224 Ga0157376_11124181 3300014969 Bacteria 812
225 Ga0157376_11189199 3300014969 Bacteria 790
226 Ga0207666_1019437 3300025271 Unclassified 991
227 Ga0207673_1028186 3300025290 Bacteria 773
228 Ga0207697_10001791 3300025315 Bacteria 11492
229 Ga0207697_10098414 3300025315 Bacteria 1245
230 Ga0207697_10265064 3300025315 Bacteria 761
231 Ga0207642_10109940 3300025899 Bacteria 1401
232 Ga0207642_10228468 3300025899 Bacteria 1044
233 Ga0207688_10000902 3300025901 Bacteria 14997
234 Ga0207688_10222636 3300025901 Bacteria 1137
235 Ga0207688_10354535 3300025901 Bacteria 904
236 Ga0207680_10143285 3300025903 Bacteria 1586
237 Ga0207647_10243379 3300025904 Bacteria 1033
238 Ga0207645_10033586 3300025907 Bacteria 3297
239 Ga0207705_11064807 3300025909 Unclassified 624
240 Ga0207654_10211753 3300025911 Bacteria 1281
241 Ga0207695_10130868 3300025913 Bacteria 2467
242 Ga0207663_10903155 3300025916 Bacteria 706
243 Ga0207662_10015608 3300025918 Bacteria 4275
244 Ga0207657_10100506 3300025919 Bacteria 2401
245 Ga0207649_10317040 3300025920 Unclassified 1144
246 Ga0207646_10007112 3300025922 Bacteria 11445
247 Ga0207646_10033482 3300025922 Bacteria 4649
248 Ga0207646_10205158 3300025922 Unclassified 1781
249 Ga0207681_10282704 3300025923 Bacteria 1307
250 Ga0207650_10049227 3300025925 Bacteria 3111
251 Ga0207650_10982740 3300025925 Bacteria 718
252 Ga0207650_11235404 3300025925 Unclassified 636
253 Ga0207659_10003777 3300025926 Bacteria 9135
254 Ga0207659_10109066 3300025926 Bacteria 2101
255 Ga0207659_10161444 3300025926 Bacteria 1760
256 Ga0207659_10601273 3300025926 Bacteria 938
257 Ga0207687_10785319 3300025927 Unclassified 812
258 Ga0207700_10056427 3300025928 Bacteria 2956
259 Ga0207644_10276235 3300025931 Bacteria 1348
260 Ga0207644_10623674 3300025931 Unclassified 896
261 Ga0207690_10154698 3300025932 Bacteria 1703
262 Ga0207706_10037204 3300025933 Bacteria 4322
263 Ga0207706_10123495 3300025933 Bacteria 2277
264 Ga0207686_10042406 3300025934 Unclassified 2781
265 Ga0207686_10363212 3300025934 Bacteria 1093
266 Ga0207709_10667641 3300025935 Bacteria 829
267 Ga0207670_10265552 3300025936 Bacteria 1332
268 Ga0207669_10089301 3300025937 Bacteria 2001
269 Ga0207669_10266409 3300025937 Unclassified 1284
270 Ga0207669_10610470 3300025937 Bacteria 888
271 Ga0207704_10484401 3300025938 Bacteria 994
272 Ga0207691_10053888 3300025940 Bacteria 3671
273 Ga0207691_10352318 3300025940 Unclassified 1259
274 Ga0207691_10925103 3300025940 Viruses 729
275 Ga0207711_10036264 3300025941 Bacteria 4184
276 Ga0207711_10064549 3300025941 Bacteria 3163
277 Ga0207711_10122672 3300025941 Bacteria 2321
278 Ga0207711_10426687 3300025941 Unclassified 1233
279 Ga0207689_10166932 3300025942 Bacteria 1814
280 Ga0207689_10275772 3300025942 Bacteria 1392
281 Ga0207661_10022199 3300025944 Bacteria 4774
282 Ga0207679_10057248 3300025945 Bacteria 2882
283 Ga0207679_10131492 3300025945 Bacteria 2009
284 Ga0207679_10246105 3300025945 Bacteria 1517
285 Ga0207667_10241415 3300025949 Bacteria 1849
286 Ga0207651_10155304 3300025960 Unclassified 1787
287 Ga0207651_10181781 3300025960 Bacteria 1669
288 Ga0207712_10679678 3300025961 Unclassified 897
289 Ga0207668_10456016 3300025972 Bacteria 1092
290 Ga0207640_10291220 3300025981 Bacteria 1287
291 Ga0207658_11234853 3300025986 Bacteria 683
292 Ga0207658_11328298 3300025986 Bacteria 657
293 Ga0207677_10063495 3300026023 Bacteria 2568
294 Ga0207703_10103896 3300026035 Bacteria 2413
295 Ga0207703_10160503 3300026035 Bacteria 1969
296 Ga0207678_10048356 3300026067 Bacteria 3676
297 Ga0207708_10002436 3300026075 Bacteria 13672
298 Ga0207702_10489590 3300026078 Unclassified 1198
299 Ga0207648_10627908 3300026089 Bacteria 992
300 Ga0207676_10395441 3300026095 Bacteria 1290
301 Ga0207674_10064019 3300026116 Bacteria 3709
302 Ga0207675_100108435 3300026118 Bacteria 2619
303 Ga0207675_100110436 3300026118 Bacteria 2594
304 Ga0207675_100149578 3300026118 Unclassified 2221
305 Ga0207675_100576260 3300026118 Unclassified 1127
306 Ga0207683_10087871 3300026121 Bacteria 2764
307 Ga0207683_10199296 3300026121 Bacteria 1819
308 Ga0207683_10269516 3300026121 Bacteria 1555
309 Ga0207683_10294149 3300026121 Unclassified 1485
310 Ga0207683_10313452 3300026121 Unclassified 1436
311 Ga0207683_10676881 3300026121 Unclassified 956
312 Ga0207698_11147631 3300026142 Bacteria 790
313 Ga0209813_10042218 3300027866 Bacteria 1393
314 Ga0207428_10000163 3300027907 Bacteria 92085
315 Ga0207428_10020470 3300027907 Bacteria 5620
316 Ga0207428_10137306 3300027907 Bacteria 1869
317 Ga0207428_10726212 3300027907 Unclassified 709
318 Ga0268266_10187992 3300028379 Bacteria 1885
319 Ga0268266_10319421 3300028379 Bacteria 1453
320 Ga0268266_10351043 3300028379 Unclassified 1386
321 Ga0268266_10860364 3300028379 Unclassified 876
322 Ga0268265_10085912 3300028380 Viruses 2499
323 Ga0268265_10092406 3300028380 Bacteria 2422
324 Ga0268265_10753614 3300028380 Bacteria 945
325 Ga0268264_10622751 3300028381 Bacteria 1066
326 Ga0307408_100049796 3300031548 Bacteria 3010
327 Ga0307408_100723769 3300031548 Bacteria 896
328 Ga0307405_10284516 3300031731 Bacteria 1246
329 Ga0307413_10023488 3300031824 Bacteria 3342
330 Ga0307413_10029863 3300031824 Bacteria 3056
331 Ga0307413_10066670 3300031824 Bacteria 2247
332 Ga0307410_10017515 3300031852 Bacteria 4305
333 Ga0307406_10101183 3300031901 Bacteria 1963
334 Ga0307407_10016412 3300031903 Bacteria 3687
335 Ga0307407_10103612 3300031903 Bacteria 1771
336 Ga0307407_10388629 3300031903 Bacteria 998
337 Ga0307412_10033280 3300031911 Bacteria 3275
338 Ga0307412_10523552 3300031911 Unclassified 991
339 Ga0307409_100014833 3300031995 Bacteria 5087
340 Ga0307409_100024371 3300031995 Bacteria 4219
341 Ga0307409_100051498 3300031995 Bacteria 3151
342 Ga0307416_100062121 3300032002 Bacteria 3053
343 Ga0307416_100070201 3300032002 Bacteria 2903
344 Ga0307416_100137166 3300032002 Bacteria 2216
345 Ga0307414_10315282 3300032004 Bacteria 1329
346 Ga0307414_10794994 3300032004 Unclassified 862
347 Ga0307411_10003665 3300032005 Bacteria 7187
348 Ga0307411_10076767 3300032005 Unclassified 2285
349 Ga0307411_10134067 3300032005 Bacteria 1815
350 Ga0307411_10445362 3300032005 Unclassified 1082
351 Ga0307415_100208980 3300032126 Bacteria 1555
352 Ga0307415_100407657 3300032126 Unclassified 1162
353 Ga0373926_0084320 3300035083 Bacteria 1178
354 Ga0373951_0028838 3300035091 Bacteria 1302
355 Ga0373952_0066375 3300035092 Bacteria 893
356 Ga0373923_0026827 3300035111 Bacteria 2294
357 Ga0373954_0123729 3300035118 Bacteria 1257
358 Ga0373957_0167969 3300035120 Unclassified 906
359 Ga0373960_0060403 3300035121 Bacteria 1149
360 Ga0373943_0000969 3300035170 Bacteria 12756
361 Ga0373943_0201027 3300035170 Bacteria 1103
362 Ga0373946_0002561 3300035171 Bacteria 6426
363 Ga0373955_0127878 3300035172 Bacteria 1481
364 Ga0373962_0084815 3300035242 Bacteria 967
365 Ga0373924_0024897 3300035410 Bacteria 2362
366 Ga0373935_0011091 3300035692 Bacteria 5415
367 Ga0373935_0255393 3300035692 Bacteria 1228
368 Ga0373927_0020981 3300035695 Bacteria 4282
369 Ga0373927_0232582 3300035695 Bacteria 1211
370 Ga0373933_0343549 3300035724 Bacteria 969
371 Ga0373947_0005021 3300035725 Bacteria 7748
372 Ga0373937_0003185 3300036401 Bacteria 13738
373 Ga0373937_0154736 3300036401 Bacteria 2149
374 Ga0373937_0414377 3300036401 Bacteria 1278
375 Ga0373937_1134880 3300036401 Unclassified 730
376 Ga0373925_0004619 3300037068 Bacteria 10396
377 Ga0373925_0185317 3300037068 Bacteria 1650
378 Ga0373925_0467270 3300037068 Bacteria 1034
379 Ga0439436_0109242 3300041404 Bacteria 772
380 Ga0439439_0064730 3300041406 Bacteria 974
381 Ga0451807_1876778 3300041486 Bacteria 988
382 Ga0439433_0006558 3300041999 Bacteria 2506
383 Ga0439433_0036247 3300041999 Bacteria 1139
384 Ga0439443_029110 3300042003 Bacteria 904
385 Ga0439450_012659 3300042008 Bacteria 1679
386 Ga0450898_023992 3300042134 Bacteria 1088
387 Ga0439435_0003481 3300042436 Bacteria 3280
388 Ga0439435_0007860 3300042436 Bacteria 2459
389 Ga0439435_0032103 3300042436 Bacteria 1431
390 Ga0451577_0000102 3300042876 Bacteria 188094
391 Ga0439440_0011530 3300042993 Bacteria 1865
392 Ga0453684_0000249 3300044712 Bacteria 232232
393 Ga0451576_0242754 3300045051 Unclassified 1882
394 Ga0451576_0731717 3300045051 Bacteria 1039
395 Ga0495592_0009330 3300046454 Bacteria 7380
396 Ga0495603_0508526 3300046455 Bacteria 690
397 Ga0495629_0538830 3300046459 Unclassified 784
398 Ga0495651_0322633 3300046462 Bacteria 1029
399 Ga0495582_0096009 3300046473 Bacteria 1657
400 Ga0495639_0351317 3300046475 Unclassified 740
401 Ga0495664_0625167 3300046477 Bacteria 639
402 Ga0495608_0015935 3300046511 Bacteria 5203
403 Ga0495618_0370467 3300046514 Unclassified 880
404 Ga0495630_0057146 3300046517 Bacteria 2924
405 Ga0495644_0255794 3300046523 Bacteria 681
406 Ga0495665_0172761 3300046531 Unclassified 1125
407 Ga0495586_0076421 3300046535 Bacteria 1835
408 Ga0495598_0206287 3300046537 Bacteria 712
409 Ga0495645_0019810 3300046543 Bacteria 4847
410 Ga0495645_0345756 3300046543 Bacteria 959
411 Ga0495634_0075801 3300046642 Bacteria 2208
412 Ga0495659_0149556 3300046664 Bacteria 937
413 Ga0495588_0381866 3300046674 Bacteria 740
414 Ga0495599_0117801 3300046678 Bacteria 1652
415 Ga0495647_0194321 3300046681 Unclassified 888
416 Ga0495658_0125661 3300046683 Bacteria 1556
417 Ga0495658_0146659 3300046683 Bacteria 1447
418 Ga0495658_0339373 3300046683 Bacteria 954
419 Ga0495658_0372507 3300046683 Bacteria 909
420 Ga0495669_0016840 3300046684 Bacteria 3133
421 Ga0495613_0000967 3300046689 Bacteria 21928
422 Ga0495613_0523334 3300046689 Bacteria 796
423 Ga0495613_0613479 3300046689 Bacteria 723
424 Ga0495600_0061745 3300046809 Bacteria 2448
425 Ga0495600_0125694 3300046809 Unclassified 1668
426 Ga0495604_0005221 3300047317 Bacteria 10288
427 Ga0495604_0388937 3300047317 Bacteria 920
428 Ga0495604_0394692 3300047317 Bacteria 912
429 Ga0495674_0013512 3300047319 Bacteria 7676
430 Ga0495680_0197269 3300047322 Bacteria 1446
431 Ga0495675_0105238 3300047444 Bacteria 1764
432 Ga0495684_0000550 3300047471 Bacteria 30400
433 Ga0496100_0347874 3300048903 Bacteria 1119
434 Ga0496101_0376707 3300048904 Bacteria 1116
435 Ga0496102_0005888 3300048905 Bacteria 10433
436 Ga0496102_0936981 3300048905 Unclassified 787
437 Ga0496103_0645484 3300048906 Unclassified 673
438 Ga0496104_0026929 3300048907 Bacteria 5315
439 Ga0496104_0115847 3300048907 Bacteria 2571
440 Ga0496105_0051059 3300048908 Bacteria 3417
441 Ga0496105_0091066 3300048908 Bacteria 2519
442 Ga0496106_0204848 3300048909 Bacteria 1571
443 Ga0496106_0466077 3300048909 Bacteria 1015
444 Ga0496106_1078585 3300048909 Bacteria 630
445 Ga0496108_0007403 3300048911 Bacteria 8902
446 Ga0496108_0348661 3300048911 Bacteria 1292
447 Ga0496109_0064174 3300048912 Bacteria 3360
448 Ga0496109_0339158 3300048912 Bacteria 1419
449 Ga0496109_0365841 3300048912 Unclassified 1362
450 Ga0496110_0016861 3300048913 Bacteria 6103
451 Ga0496110_0024015 3300048913 Bacteria 5194
452 Ga0496110_0238641 3300048913 Bacteria 1654
453 Ga0496111_0034898 3300048914 Bacteria 3593
454 Ga0496112_0001657 3300048915 Bacteria 17310
455 Ga0496112_0027752 3300048915 Bacteria 5460
456 Ga0496112_0044738 3300048915 Bacteria 4339
457 Ga0496112_0179403 3300048915 Bacteria 2082
458 Ga0496112_0481317 3300048915 Bacteria 1178
459 Ga0496113_0333847 3300048916 Bacteria 1216
460 Ga0496114_0255367 3300048917 Bacteria 1543
461 Ga0496114_0576201 3300048917 Bacteria 993
462 Ga0501031_0046502 3300049568 Bacteria 2830
463 Ga0501032_0654157 3300049569 Bacteria 667
464 Ga0501034_0089345 3300049571 Bacteria 3079
465 Ga0501034_0361640 3300049571 Bacteria 1378
466 Ga0501034_0735974 3300049571 Bacteria 882
467 Ga0501034_1035654 3300049571 Bacteria 704
468 Ga0501036_0209413 3300049572 Bacteria 1638
469 Ga0501038_0298804 3300049574 Bacteria 1264
470 Ga0501040_0017010 3300049576 Bacteria 4822
471 Ga0501041_0108719 3300049577 Bacteria 1720
472 Ga0501041_0613727 3300049577 Bacteria 694
473 Ga0501042_0054476 3300049578 Bacteria 2853
474 Ga0501042_0081881 3300049578 Bacteria 2314
475 Ga0501042_0154107 3300049578 Bacteria 1657
476 Ga0501046_0365003 3300049580 Bacteria 1047
477 Ga0501047_0078858 3300049581 Bacteria 3167
478 Ga0501048_0118989 3300049582 Bacteria 1866
479 Ga0501068_0049259 3300049584 Bacteria 2544
480 Ga0501071_0131260 3300049587 Bacteria 1861
481 Ga0501071_0273880 3300049587 Bacteria 1277
482 Ga0501071_0917707 3300049587 Bacteria 676
483 Ga0501071_1089131 3300049587 Bacteria 617
484 Ga0501072_0055068 3300049588 Bacteria 3135
485 Ga0501072_0171513 3300049588 Bacteria 1731
486 Ga0501073_0663856 3300049589 Bacteria 719
487 Ga0501074_0376387 3300049590 Bacteria 1007
488 Ga0501075_0027545 3300049591 Unclassified 4189
489 Ga0501075_0094801 3300049591 Bacteria 2265
490 Ga0501076_0011930 3300049592 Bacteria 6490
491 Ga0501076_0180939 3300049592 Bacteria 1719
492 Ga0501076_0247573 3300049592 Bacteria 1458
493 Ga0501077_0193705 3300049593 Bacteria 1291
494 Ga0501260_023630 3300049689 Unclassified 678
495 Ga0501079_0018258 3300049741 Bacteria 5359
496 Ga0501079_0425768 3300049741 Bacteria 1042
497 Ga0501080_0071967 3300049742 Bacteria 3217
498 Ga0501080_0089411 3300049742 Bacteria 2861
499 Ga0501081_0155082 3300049743 Viruses 1647
500 Ga0501083_0192800 3300049744 Bacteria 1330
501 Ga0501265_053460 3300049762 Unclassified 642
502 Ga0501044_0240558 3300049823 Bacteria 1754
503 Ga0501045_0034066 3300049824 Bacteria 3695
504 Ga0501045_0045575 3300049824 Bacteria 3192
505 nmdc:mga03683_234757_c1 3300050489 Bacteria 849
506 nmdc:mga0k408_94235_c1 3300050493 Bacteria 1761
507 nmdc:mga06z11_60740_c1 3300050494 Bacteria 1969
508 nmdc:mga04h51_50672_c1 3300050495 Bacteria 1392
509 nmdc:mga05p37_13619_c1 3300050507 Bacteria 9747
510 nmdc:mga05p37_1399793_c1 3300050507 Bacteria 704
511 nmdc:mga05p37_1547_c1 3300050507 Bacteria 26735
512 nmdc:mga05p37_16623_c2 3300050507 Bacteria 5097
513 nmdc:mga05p37_3206_c1 3300050507 Bacteria 19038
514 nmdc:mga05p37_535406_c1 3300050507 Bacteria 1337
515 nmdc:mga09592_19373_c1 3300050508 Bacteria 5587
516 nmdc:mga09592_33292_c1 3300050508 Bacteria 4301
517 nmdc:mga09592_553490_c1 3300050508 Bacteria 988
518 nmdc:mga09592_717346_c1 3300050508 Bacteria 850
519 nmdc:mga09592_916180_c1 3300050508 Bacteria 736
520 nmdc:mga0qj67_5243_c1 3300050509 Bacteria 9452
521 nmdc:mga0qj67_73305_c1 3300050509 Bacteria 2735
522 nmdc:mga0qj67_84833_c1 3300050509 Bacteria 2540
523 nmdc:mga06r32_20783_c1 3300050510 Bacteria 6048
524 nmdc:mga06r32_40834_c1 3300050510 Bacteria 4406
525 nmdc:mga06r32_41308_c1 3300050510 Bacteria 4382
526 nmdc:mga06r32_58719_c1 3300050510 Bacteria 3698
527 nmdc:mga08y16_204091_c1 3300050511 Bacteria 2048
528 nmdc:mga08y16_25_c1 3300050511 Bacteria 235789
529 nmdc:mga08y16_28972_c1 3300050511 Bacteria 5837
530 nmdc:mga08y16_56853_c1 3300050511 Unclassified 4088
531 nmdc:mga08y16_88914_c1 3300050511 Bacteria 3219
532 nmdc:mga0n895_1224294_c1 3300050512 Bacteria 724
533 nmdc:mga0n895_193404_c1 3300050512 Bacteria 2065
534 nmdc:mga0n895_283224_c1 3300050512 Bacteria 1681
535 nmdc:mga0n895_538162_c1 3300050512 Bacteria 1174
536 nmdc:mga0rr50_194703_c1 3300050513 Bacteria 1663
537 nmdc:mga0rr50_227529_c1 3300050513 Bacteria 1542
538 nmdc:mga0rr50_8955_c1 3300050513 Bacteria 6258
539 nmdc:mga0a205_1025991_c1 3300050515 Bacteria 672
540 nmdc:mga0a205_275665_c1 3300050515 Bacteria 1558
541 nmdc:mga0a205_3960_c1 3300050515 Bacteria 5907
542 nmdc:mga0a205_442639_c1 3300050515 Unclassified 1160
543 Ga0495601_0094874 3300053077 Bacteria 1923
544 Ga0495601_0170624 3300053077 Bacteria 1422
545 Ga0495612_0192496 3300053078 Unclassified 898
546 Ga0495595_0013281 3300053084 Bacteria 3478
547 Ga0495595_0054415 3300053084 Bacteria 1861
548 Ga0495595_0060890 3300053084 Bacteria 1767
549 Ga0495619_0007430 3300053085 Bacteria 6940
550 Ga0495619_0044146 3300053085 Bacteria 2925
551 Ga0495619_0106852 3300053085 Unclassified 1909
552 Ga0501084_0301182 3300054114 Bacteria 1354
553 Ga0501084_0736071 3300054114 Bacteria 831
554 Ga0501084_0820370 3300054114 Unclassified 783
555 Ga0590071_000061 3300059421 Bacteria 29023
556 Ga0590071_027831 3300059421 Bacteria 1342
557 Ga0590075_000074 3300059424 Bacteria 25445
558 Ga0590075_070318 3300059424 Unclassified 904
559 Ga0590077_000510 3300059426 Bacteria 10783
560 Ga0590077_007746 3300059426 Bacteria 2193
561 Ga0590077_039004 3300059426 Bacteria 1052
562 Ga0501082_0087843 3300060353 Bacteria 2683
563 Ga0501082_0231600 3300060353 Bacteria 1608
564 Ga0501082_0261981 3300060353 Bacteria 1504
565 Ga0501082_0450535 3300060353 Bacteria 1124
566 Ga0530510_0009486 3300061734 Bacteria 6823
567 Ga0268265_11175207
568 JGI24743J22301_10015236
569 Ga0065712_10010379
570 Ga0065712_10068736
571 Ga0065712_10093272
572 Ga0065712_10099012
573 Ga0065715_10090856
574 Ga0065715_10127634
575 Ga0065715_10198011
576 Ga0065715_10199945
577 Ga0065715_10295830
578 Ga0065715_10632930
579 Ga0065707_10352843
580 Ga0070658_10573652
581 Ga0070658_11342093
582 Ga0070676_10406316
583 Ga0070683_100008903
584 Ga0070683_100161209
585 Ga0070690_100057759
586 Ga0070670_100079230
587 Ga0070670_100089564
588 Ga0070670_100119548
589 Ga0070670_100211544
590 Ga0070670_100343948
591 Ga0070670_100485479
592 Ga0070677_10219512
593 Ga0068869_100117168
594 Ga0070666_10085569
595 Ga0070666_10230045
596 Ga0070682_100395766
597 Ga0068868_100125947
598 Ga0068868_100343570
599 Ga0068868_100875024
600 Ga0070689_100009871
601 Ga0070691_10189982
602 Ga0070692_10067971
603 Ga0070692_10194906
604 Ga0070668_100271108
605 Ga0070669_100208768
606 Ga0070675_100000409
607 Ga0070675_100247516
608 Ga0070675_100261720
609 Ga0070675_100318909
610 Ga0070675_100486319
611 Ga0070675_100864524
612 Ga0070671_100278611
613 Ga0070671_100320919
614 Ga0070674_100009973
615 Ga0070674_100387103
616 Ga0070673_100274056
617 Ga0070688_100018704
618 Ga0070688_100078405
619 Ga0070667_100415549
620 Ga0070667_101366816
621 Ga0070703_10021053
622 Ga0070713_100148374
623 Ga0070701_10060775
624 Ga0070711_100280944
625 Ga0070711_100755368
626 Ga0070700_100273523
627 Ga0070700_100479162
628 Ga0070694_100067757
629 Ga0070694_100078025
630 Ga0070708_100241967
631 Ga0070663_100025473
632 Ga0070678_100228851
633 Ga0070678_100421189
634 Ga0070662_100051668
635 Ga0070662_100095951
636 Ga0068867_100195722
637 Ga0068867_100400337
638 Ga0070707_100101399
639 Ga0070707_100235847
640 Ga0070698_100518945
641 Ga0070698_100956673
642 Ga0070699_100543889
643 Ga0070684_100004579
644 Ga0070684_100097410
645 Ga0070697_101003998
646 Ga0070672_100124767
647 Ga0070672_100375657
648 Ga0070672_100693052
649 Ga0070672_101041324
650 Ga0070686_100098056
651 Ga0070686_100214041
652 Ga0070695_100143566
653 Ga0070696_100035055
654 Ga0070693_100019338
655 Ga0070665_100073214
656 Ga0070665_100463772
657 Ga0070704_100044727
658 Ga0070704_100060666
659 Ga0070704_100403968
660 Ga0068855_100129182
661 Ga0070664_100006213
662 Ga0070664_100119938
663 Ga0070664_100133575
664 Ga0070664_100155851
665 Ga0070664_100853158
666 Ga0068854_100233659
667 Ga0068856_100126546
668 Ga0070702_100025206
669 Ga0068852_101144864
670 Ga0068859_100067893
671 Ga0068859_100175066
672 Ga0068866_10790023
673 Ga0068861_100018885
674 Ga0068861_100090754
675 Ga0068861_100143756
676 Ga0068863_100382646
677 Ga0068858_100065356
678 Ga0068858_100391297
679 Ga0068858_100591977
680 Ga0068858_100674752
681 Ga0068860_100688423
682 Ga0068860_100742671
683 Ga0068862_100020965
684 Ga0068862_100074731
685 Ga0068862_100492884
686 Ga0068862_101141885
687 Ga0081538_10195985
688 Ga0070717_10244933
689 Ga0070717_10298799
690 Ga0075362_10263784
691 Ga0075367_10043964
692 Ga0075366_10012308
693 Ga0075366_10369717
694 Ga0097621_100258412
695 Ga0097621_100379837
696 Ga0097621_100791178
697 Ga0068871_100239004
698 Ga0068871_100434094
699 Ga0068871_101016068
700 Ga0075428_100000085
701 Ga0075428_100002199
702 Ga0075428_100002253
703 Ga0075428_100007167
704 Ga0075428_100016571
705 Ga0075428_100588353
706 Ga0075430_100003772
707 Ga0075430_100007531
708 Ga0075430_100017138
709 Ga0075431_100009895
710 Ga0075431_100027600
711 Ga0075431_100029333
712 Ga0075431_100192861
713 Ga0075431_100237146
714 Ga0075431_100883721
715 Ga0075433_10015786
716 Ga0075433_10033285
717 Ga0075433_10102190
718 Ga0075433_10140945
719 Ga0075433_10260295
720 Ga0075434_100017873
721 Ga0075434_100237008
722 Ga0075434_100268112
723 Ga0075434_100994394
724 Ga0075429_100011684
725 Ga0075429_100034457
726 Ga0068865_100177131
727 Ga0068865_101171808
728 Ga0075436_100185876
729 Ga0097620_100067895
730 Ga0097620_100175072
731 Ga0075435_100004603
732 Ga0075435_100023476
733 Ga0075435_100024343
734 Ga0075435_100098369
735 Ga0075435_100213454
736 Ga0099794_10232215
737 Ga0105240_10096914
738 Ga0111539_10000043
739 Ga0111539_10037497
740 Ga0111539_10108045
741 Ga0111539_10183728
742 Ga0111539_11391459
743 Ga0105245_10040836
744 Ga0105245_10545785
745 Ga0105245_10621552
746 Ga0114129_10001092
747 Ga0114129_10001838
748 Ga0114129_10005748
749 Ga0114129_10007228
750 Ga0114129_10155236
751 Ga0114129_10214134
752 Ga0105243_10326131
753 Ga0105243_10336810
754 Ga0105241_10045151
755 Ga0105242_10755018
756 Ga0105248_10043577
757 Ga0105248_10073698
758 Ga0105248_10077909
759 Ga0105248_10134737
760 Ga0105248_10406303
761 Ga0105248_10498426
762 Ga0105248_10630672
763 Ga0105248_10739779
764 Ga0105248_11246795
765 Ga0105238_10302613
766 Ga0105238_10577342
767 Ga0105249_10096901
768 Ga0105249_10177929
769 Ga0105249_10233271
770 Ga0105249_10765704
771 Ga0105239_10539716
772 Ga0105246_10646404
773 Ga0157369_10429383
774 Ga0157374_10018124
775 Ga0157374_10738788
776 Ga0163162_10931603
777 Ga0157372_10247238
778 Ga0157375_10291283
779 Ga0157375_10471840
780 Ga0157375_10881320
781 Ga0163163_10022561
782 Ga0163163_10143297
783 Ga0163163_10265415
784 Ga0157380_10882260
785 Ga0157377_10127374
786 Ga0157379_10125788
787 Ga0157379_10200279
788 Ga0157376_10325029
789 Ga0157376_11013480
790 Ga0157376_11124181
791 Ga0157376_11189199
792 Ga0207666_1019437
793 Ga0207673_1028186
794 Ga0207697_10001791
795 Ga0207697_10098414
796 Ga0207697_10265064
797 Ga0207642_10109940
798 Ga0207642_10228468
799 Ga0207688_10000902
800 Ga0207688_10222636
801 Ga0207688_10354535
802 Ga0207680_10143285
803 Ga0207647_10243379
804 Ga0207645_10033586
805 Ga0207705_11064807
806 Ga0207654_10211753
807 Ga0207695_10130868
808 Ga0207663_10903155
809 Ga0207662_10015608
810 Ga0207657_10100506
811 Ga0207649_10317040
812 Ga0207646_10007112
813 Ga0207646_10033482
814 Ga0207646_10205158
815 Ga0207681_10282704
816 Ga0207650_10049227
817 Ga0207650_10982740
818 Ga0207650_11235404
819 Ga0207659_10003777
820 Ga0207659_10109066
821 Ga0207659_10161444
822 Ga0207659_10601273
823 Ga0207687_10785319
824 Ga0207700_10056427
825 Ga0207644_10276235
826 Ga0207644_10623674
827 Ga0207690_10154698
828 Ga0207706_10037204
829 Ga0207706_10123495
830 Ga0207686_10042406
831 Ga0207686_10363212
832 Ga0207709_10667641
833 Ga0207670_10265552
834 Ga0207669_10089301
835 Ga0207669_10266409
836 Ga0207669_10610470
837 Ga0207704_10484401
838 Ga0207691_10053888
839 Ga0207691_10352318
840 Ga0207691_10925103
841 Ga0207711_10036264
842 Ga0207711_10064549
843 Ga0207711_10122672
844 Ga0207711_10426687
845 Ga0207689_10166932
846 Ga0207689_10275772
847 Ga0207661_10022199
848 Ga0207679_10057248
849 Ga0207679_10131492
850 Ga0207679_10246105
851 Ga0207667_10241415
852 Ga0207651_10155304
853 Ga0207651_10181781
854 Ga0207712_10679678
855 Ga0207668_10456016
856 Ga0207640_10291220
857 Ga0207658_11234853
858 Ga0207658_11328298
859 Ga0207677_10063495
860 Ga0207703_10103896
861 Ga0207703_10160503
862 Ga0207678_10048356
863 Ga0207708_10002436
864 Ga0207702_10489590
865 Ga0207648_10627908
866 Ga0207676_10395441
867 Ga0207674_10064019
868 Ga0207675_100108435
869 Ga0207675_100110436
870 Ga0207675_100149578
871 Ga0207675_100576260
872 Ga0207683_10087871
873 Ga0207683_10199296
874 Ga0207683_10269516
875 Ga0207683_10294149
876 Ga0207683_10313452
877 Ga0207683_10676881
878 Ga0207698_11147631
879 Ga0209813_10042218
880 Ga0207428_10000163
881 Ga0207428_10020470
882 Ga0207428_10137306
883 Ga0207428_10726212
884 Ga0268266_10187992
885 Ga0268266_10319421
886 Ga0268266_10351043
887 Ga0268266_10860364
888 Ga0268265_10085912
889 Ga0268265_10092406
890 Ga0268265_10753614
891 Ga0268264_10622751
892 Ga0307408_100049796
893 Ga0307408_100723769
894 Ga0307405_10284516
895 Ga0307413_10023488
896 Ga0307413_10029863
897 Ga0307413_10066670
898 Ga0307410_10017515
899 Ga0307406_10101183
900 Ga0307407_10016412
901 Ga0307407_10103612
902 Ga0307407_10388629
903 Ga0307412_10033280
904 Ga0307412_10523552
905 Ga0307409_100014833
906 Ga0307409_100024371
907 Ga0307409_100051498
908 Ga0307416_100062121
909 Ga0307416_100070201
910 Ga0307416_100137166
911 Ga0307414_10315282
912 Ga0307414_10794994
913 Ga0307411_10003665
914 Ga0307411_10076767
915 Ga0307411_10134067
916 Ga0307411_10445362
917 Ga0307415_100208980
918 Ga0307415_100407657
919 Ga0373926_0084320
920 Ga0373951_0028838
921 Ga0373952_0066375
922 Ga0373923_0026827
923 Ga0373954_0123729
924 Ga0373957_0167969
925 Ga0373960_0060403
926 Ga0373943_0000969
927 Ga0373943_0201027
928 Ga0373946_0002561
929 Ga0373955_0127878
930 Ga0373962_0084815
931 Ga0373924_0024897
932 Ga0373935_0011091
933 Ga0373935_0255393
934 Ga0373927_0020981
935 Ga0373927_0232582
936 Ga0373933_0343549
937 Ga0373947_0005021
938 Ga0373937_0003185
939 Ga0373937_0154736
940 Ga0373937_0414377
941 Ga0373937_1134880
942 Ga0373925_0004619
943 Ga0373925_0185317
944 Ga0373925_0467270
945 Ga0439436_0109242
946 Ga0439439_0064730
947 Ga0451807_1876778
948 Ga0439433_0006558
949 Ga0439433_0036247
950 Ga0439443_029110
951 Ga0439450_012659
952 Ga0450898_023992
953 Ga0439435_0003481
954 Ga0439435_0007860
955 Ga0439435_0032103
956 Ga0451577_0000102
957 Ga0439440_0011530
958 Ga0453684_0000249
959 Ga0451576_0242754
960 Ga0451576_0731717
961 Ga0495592_0009330
962 Ga0495603_0508526
963 Ga0495629_0538830
964 Ga0495651_0322633
965 Ga0495582_0096009
966 Ga0495639_0351317
967 Ga0495664_0625167
968 Ga0495608_0015935
969 Ga0495618_0370467
970 Ga0495630_0057146
971 Ga0495644_0255794
972 Ga0495665_0172761
973 Ga0495586_0076421
974 Ga0495598_0206287
975 Ga0495645_0019810
976 Ga0495645_0345756
977 Ga0495634_0075801
978 Ga0495659_0149556
979 Ga0495588_0381866
980 Ga0495599_0117801
981 Ga0495647_0194321
982 Ga0495658_0125661
983 Ga0495658_0146659
984 Ga0495658_0339373
985 Ga0495658_0372507
986 Ga0495669_0016840
987 Ga0495613_0000967
988 Ga0495613_0523334
989 Ga0495613_0613479
990 Ga0495600_0061745
991 Ga0495600_0125694
992 Ga0495604_0005221
993 Ga0495604_0388937
994 Ga0495604_0394692
995 Ga0495674_0013512
996 Ga0495680_0197269
997 Ga0495675_0105238
998 Ga0495684_0000550
999 Ga0496100_0347874
1000 Ga0496101_0376707
1001 Ga0496102_0005888
1002 Ga0496102_0936981
1003 Ga0496103_0645484
1004 Ga0496104_0026929
1005 Ga0496104_0115847
1006 Ga0496105_0051059
1007 Ga0496105_0091066
1008 Ga0496106_0204848
1009 Ga0496106_0466077
1010 Ga0496106_1078585
1011 Ga0496108_0007403
1012 Ga0496108_0348661
1013 Ga0496109_0064174
1014 Ga0496109_0339158
1015 Ga0496109_0365841
1016 Ga0496110_0016861
1017 Ga0496110_0024015
1018 Ga0496110_0238641
1019 Ga0496111_0034898
1020 Ga0496112_0001657
1021 Ga0496112_0027752
1022 Ga0496112_0044738
1023 Ga0496112_0179403
1024 Ga0496112_0481317
1025 Ga0496113_0333847
1026 Ga0496114_0255367
1027 Ga0496114_0576201
1028 Ga0501031_0046502
1029 Ga0501032_0654157
1030 Ga0501034_0089345
1031 Ga0501034_0361640
1032 Ga0501034_0735974
1033 Ga0501034_1035654
1034 Ga0501036_0209413
1035 Ga0501038_0298804
1036 Ga0501040_0017010
1037 Ga0501041_0108719
1038 Ga0501041_0613727
1039 Ga0501042_0054476
1040 Ga0501042_0081881
1041 Ga0501042_0154107
1042 Ga0501046_0365003
1043 Ga0501047_0078858
1044 Ga0501048_0118989
1045 Ga0501068_0049259
1046 Ga0501071_0131260
1047 Ga0501071_0273880
1048 Ga0501071_0917707
1049 Ga0501071_1089131
1050 Ga0501072_0055068
1051 Ga0501072_0171513
1052 Ga0501073_0663856
1053 Ga0501074_0376387
1054 Ga0501075_0027545
1055 Ga0501075_0094801
1056 Ga0501076_0011930
1057 Ga0501076_0180939
1058 Ga0501076_0247573
1059 Ga0501077_0193705
1060 Ga0501260_023630
1061 Ga0501079_0018258
1062 Ga0501079_0425768
1063 Ga0501080_0071967
1064 Ga0501080_0089411
1065 Ga0501081_0155082
1066 Ga0501083_0192800
1067 Ga0501265_053460
1068 Ga0501044_0240558
1069 Ga0501045_0034066
1070 Ga0501045_0045575
1071 nmdc:mga03683_234757_c1
1072 nmdc:mga0k408_94235_c1
1073 nmdc:mga06z11_60740_c1
1074 nmdc:mga04h51_50672_c1
1075 nmdc:mga05p37_13619_c1
1076 nmdc:mga05p37_1399793_c1
1077 nmdc:mga05p37_1547_c1
1078 nmdc:mga05p37_16623_c2
1079 nmdc:mga05p37_3206_c1
1080 nmdc:mga05p37_535406_c1
1081 nmdc:mga09592_19373_c1
1082 nmdc:mga09592_33292_c1
1083 nmdc:mga09592_553490_c1
1084 nmdc:mga09592_717346_c1
1085 nmdc:mga09592_916180_c1
1086 nmdc:mga0qj67_5243_c1
1087 nmdc:mga0qj67_73305_c1
1088 nmdc:mga0qj67_84833_c1
1089 nmdc:mga06r32_20783_c1
1090 nmdc:mga06r32_40834_c1
1091 nmdc:mga06r32_41308_c1
1092 nmdc:mga06r32_58719_c1
1093 nmdc:mga08y16_204091_c1
1094 nmdc:mga08y16_25_c1
1095 nmdc:mga08y16_28972_c1
1096 nmdc:mga08y16_56853_c1
1097 nmdc:mga08y16_88914_c1
1098 nmdc:mga0n895_1224294_c1
1099 nmdc:mga0n895_193404_c1
1100 nmdc:mga0n895_283224_c1
1101 nmdc:mga0n895_538162_c1
1102 nmdc:mga0rr50_194703_c1
1103 nmdc:mga0rr50_227529_c1
1104 nmdc:mga0rr50_8955_c1
1105 nmdc:mga0a205_1025991_c1
1106 nmdc:mga0a205_275665_c1
1107 nmdc:mga0a205_3960_c1
1108 nmdc:mga0a205_442639_c1
1109 Ga0495601_0094874
1110 Ga0495601_0170624
1111 Ga0495612_0192496
1112 Ga0495595_0013281
1113 Ga0495595_0054415
1114 Ga0495595_0060890
1115 Ga0495619_0007430
1116 Ga0495619_0044146
1117 Ga0495619_0106852
1118 Ga0501084_0301182
1119 Ga0501084_0736071
1120 Ga0501084_0820370
1121 Ga0590071_000061
1122 Ga0590071_027831
1123 Ga0590075_000074
1124 Ga0590075_070318
1125 Ga0590077_000510
1126 Ga0590077_007746
1127 Ga0590077_039004
1128 Ga0501082_0087843
1129 Ga0501082_0231600
1130 Ga0501082_0261981
1131 Ga0501082_0450535
1132 Ga0530510_0009486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.7969 6 34
8eef-assembly2.cif.gz_B c. ammoniagenes monoamine oxidase (mao) bound to octopamine 0.6946 7 43
4dim-assembly1.cif.gz_A crystal structure of phosphoribosylglycinamide synthetase from anaerococcus prevotii 0.693 6 40
3imk-assembly1.cif.gz_A crystal structure of putative molybdenum carrier protein (yp_461806.1) from syntrophus aciditrophicus sb at 1.45 a resolution 0.6466 6 177
3imk-assembly1.cif.gz_A crystal structure of putative molybdenum carrier protein (yp_461806.1) from syntrophus aciditrophicus sb at 1.45 a resolution 0.5922 6 177
ID Description Score Start End Superfamily
3imkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8061 7 133 3.40.50.450
2vouC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7065 4 34 3.50.50.60
3rp8A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6716 6 49 3.50.50.60
2vqdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6384 6 37 3.40.50.20
af_Q4CS16_3_471_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.6355 6 37 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A7V9AUS7-F1-model_v4 Uncharacterized protein 0.9839 1 182
AF-A0A1F2UCX6-F1-model_v4 Uncharacterized protein 0.9803 1 183
AF-A0A2V8LU73-F1-model_v4 Uncharacterized protein 0.9801 1 183
AF-A0A2N2HDY7-F1-model_v4 Uncharacterized protein 0.9795 1 182
AF-A0A520ZXI8-F1-model_v4 Uncharacterized protein 0.9793 93 182

Map