F464307

General Info

Members Datasets Scaffolds Average Seq Length
565 286 1130 270

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0183511|Ga0496109_0183511_305_1144
Length 279
Sequence MTPPVQDRGRKPALIATDVDGTLLDDDEKISSRTRAAARAVVDAGAQFVLATGRPPRWVRPIVDQLGFTPMAVCANGAVIYDPSTDRIVSVRTLSADALGELAEIATRVIPGAGLAVERVGRSAHDAATPQFVSSPGYEHAWLNPDNTEVSIEDLLSAPAVKLLIRKAGASSAAMAAALAKHVGIEGDITYSTNNGLVEIVPLGISKATGIQELARPRGITAAEVVAFGDMPNDVPMLGWAGLGVAMGNAHPDAVAAADEVTTTNAEDGVARVLERWWQ

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
169 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
263 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
266 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
267 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
271 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
272 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
273 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
274 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
275 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
276 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
277 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
278 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
279 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
280 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
281 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
282 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
283 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
284 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
285 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
286 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 96.99
Metatranscriptomes 0
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 13.45
Nodule 0.18
Rhizoplane 13.45
Rhizosphere 61.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0183511 3300048912 Bacteria 1966
2 JGI24739J22299_10071500 3300001989 Bacteria 1079
3 JGI24737J22298_10068360 3300001990 Bacteria 1062
4 JGI24743J22301_10007680 3300001991 Bacteria 1876
5 JGI24748J21848_1007380 3300002074 Bacteria 1289
6 JGI24744J21845_10000853 3300002077 Bacteria 5760
7 JGI24744J21845_10010169 3300002077 Bacteria 1928
8 JGI24742J22300_10001119 3300002244 Bacteria 4158
9 JGI24751J29686_10012189 3300002459 Bacteria 1772
10 Ga0055540_1000038 3300003792 Bacteria 161988
11 Ga0055540_1002436 3300003792 Bacteria 9823
12 Ga0055540_1003290 3300003792 Bacteria 7896
13 Ga0055540_1004570 3300003792 Bacteria 6164
14 Ga0070676_10005393 3300005328 Bacteria 6812
15 Ga0070690_100282415 3300005330 Bacteria 1185
16 Ga0068869_100013423 3300005334 Bacteria 5448
17 Ga0068869_100038297 3300005334 Bacteria 3417
18 Ga0070666_10079476 3300005335 Bacteria 2240
19 Ga0070680_100045179 3300005336 Bacteria 3581
20 Ga0070682_100022499 3300005337 Bacteria 3734
21 Ga0070682_100454593 3300005337 Bacteria 982
22 Ga0070682_100473105 3300005337 Bacteria 965
23 Ga0068868_100002062 3300005338 Bacteria 13816
24 Ga0070689_100014453 3300005340 Bacteria 5735
25 Ga0070689_100097349 3300005340 Bacteria 2326
26 Ga0070691_10233497 3300005341 Bacteria 980
27 Ga0070668_100006600 3300005347 Bacteria 8596
28 Ga0070668_100009021 3300005347 Bacteria 7408
29 Ga0070669_100038388 3300005353 Bacteria 3477
30 Ga0070675_100154086 3300005354 Bacteria 1972
31 Ga0070671_100055255 3300005355 Bacteria 3303
32 Ga0070671_100210947 3300005355 Bacteria 1647
33 Ga0070674_100052412 3300005356 Bacteria 2814
34 Ga0070674_100304721 3300005356 Bacteria 1271
35 Ga0070688_100027106 3300005365 Bacteria 3411
36 Ga0070688_100057079 3300005365 Bacteria 2453
37 Ga0070667_100000099 3300005367 Bacteria 108662
38 Ga0070667_100011251 3300005367 Bacteria 7402
39 Ga0070667_100011479 3300005367 Bacteria 7325
40 Ga0070667_100024853 3300005367 Bacteria 4978
41 Ga0070709_10041982 3300005434 Bacteria 2821
42 Ga0070714_100028468 3300005435 Bacteria 4637
43 Ga0070714_100112581 3300005435 Bacteria 2412
44 Ga0070710_10000860 3300005437 Bacteria 14572
45 Ga0070710_10003206 3300005437 Bacteria 7756
46 Ga0070701_10001043 3300005438 Bacteria 10106
47 Ga0070701_10293805 3300005438 Bacteria 997
48 Ga0070711_100000430 3300005439 Bacteria 21892
49 Ga0070700_100000815 3300005441 Bacteria 15317
50 Ga0070663_100002169 3300005455 Bacteria 10976
51 Ga0070663_100037524 3300005455 Bacteria 3374
52 Ga0070678_100000296 3300005456 Bacteria 23040
53 Ga0070678_100068777 3300005456 Bacteria 2641
54 Ga0070678_100192868 3300005456 Bacteria 1676
55 Ga0070662_100037707 3300005457 Bacteria 3428
56 Ga0068867_100002560 3300005459 Bacteria 12818
57 Ga0068867_100069531 3300005459 Bacteria 2629
58 Ga0070685_10019284 3300005466 Bacteria 3678
59 Ga0070685_10146604 3300005466 Bacteria 1492
60 Ga0070697_100641625 3300005536 Bacteria 935
61 Ga0068853_100009254 3300005539 Bacteria 7941
62 Ga0068853_100013269 3300005539 Bacteria 6727
63 Ga0070672_100224204 3300005543 Bacteria 1577
64 Ga0070695_100008828 3300005545 Bacteria 5988
65 Ga0070696_100007202 3300005546 Bacteria 7429
66 Ga0070693_100011777 3300005547 Bacteria 4411
67 Ga0070665_100004453 3300005548 Bacteria 14715
68 Ga0070665_100044249 3300005548 Bacteria 4471
69 Ga0070665_100047336 3300005548 Bacteria 4317
70 Ga0070704_100000484 3300005549 Bacteria 18886
71 Ga0068854_100001737 3300005578 Bacteria 13297
72 Ga0068854_100198810 3300005578 Bacteria 1574
73 Ga0070702_100010422 3300005615 Bacteria 4578
74 Ga0070702_100336319 3300005615 Bacteria 1058
75 Ga0068852_100333977 3300005616 Bacteria 1475
76 Ga0068859_100002520 3300005617 Bacteria 18593
77 Ga0068864_100098242 3300005618 Bacteria 2593
78 Ga0068864_100744297 3300005618 Bacteria 960
79 Ga0068861_100005055 3300005719 Bacteria 8898
80 Ga0068861_100059724 3300005719 Bacteria 2920
81 Ga0068861_100182161 3300005719 Bacteria 1749
82 Ga0068870_10038599 3300005840 Bacteria 2467
83 Ga0068863_100004183 3300005841 Bacteria 14247
84 Ga0068863_100020294 3300005841 Bacteria 6356
85 Ga0068863_100059876 3300005841 Bacteria 3603
86 Ga0068858_100005212 3300005842 Bacteria 12736
87 Ga0068858_100055571 3300005842 Bacteria 3659
88 Ga0068858_100294737 3300005842 Bacteria 1547
89 Ga0068860_100000163 3300005843 Bacteria 108836
90 Ga0068860_100002020 3300005843 Bacteria 21414
91 Ga0068860_100599372 3300005843 Bacteria 1107
92 Ga0068862_100000089 3300005844 Bacteria 109047
93 Ga0068862_100016336 3300005844 Bacteria 6178
94 Ga0068862_100488629 3300005844 Bacteria 1167
95 Ga0081455_10064403 3300005937 Bacteria 3069
96 Ga0081455_10069989 3300005937 Bacteria 2914
97 Ga0081455_10075976 3300005937 Bacteria 2769
98 Ga0081538_10066811 3300005981 Bacteria 2012
99 Ga0075365_10015383 3300006038 Bacteria 4628
100 Ga0075365_10031263 3300006038 Bacteria 3415
101 Ga0075365_10034858 3300006038 Bacteria 3253
102 Ga0075365_10041848 3300006038 Bacteria 2994
103 Ga0075365_10186900 3300006038 Bacteria 1449
104 Ga0075368_10028013 3300006042 Bacteria 2175
105 Ga0075363_100000369 3300006048 Bacteria 13579
106 Ga0075363_100000380 3300006048 Bacteria 13452
107 Ga0075363_100009679 3300006048 Bacteria 4539
108 Ga0075363_100009836 3300006048 Bacteria 4510
109 Ga0075363_100010387 3300006048 Bacteria 4419
110 Ga0075363_100016376 3300006048 Bacteria 3662
111 Ga0075363_100043974 3300006048 Bacteria 2364
112 Ga0075363_100083779 3300006048 Bacteria 1747
113 Ga0075364_10002787 3300006051 Bacteria 9824
114 Ga0075364_10003247 3300006051 Bacteria 9206
115 Ga0075364_10008746 3300006051 Bacteria 6057
116 Ga0075364_10024041 3300006051 Bacteria 3864
117 Ga0075364_10037067 3300006051 Bacteria 3155
118 Ga0070715_10002781 3300006163 Bacteria 5440
119 Ga0070716_100015973 3300006173 Bacteria 3868
120 Ga0070712_100000975 3300006175 Bacteria 17221
121 Ga0070712_100006327 3300006175 Bacteria 7342
122 Ga0075362_10014003 3300006177 Bacteria 3227
123 Ga0075362_10014798 3300006177 Bacteria 3159
124 Ga0075362_10158550 3300006177 Bacteria 1088
125 Ga0075367_10126292 3300006178 Bacteria 1579
126 Ga0075369_10009713 3300006186 Bacteria 3745
127 Ga0075369_10025654 3300006186 Bacteria 2452
128 Ga0075369_10028147 3300006186 Bacteria 2354
129 Ga0075369_10036593 3300006186 Bacteria 2089
130 Ga0075369_10043083 3300006186 Bacteria 1936
131 Ga0075369_10106334 3300006186 Bacteria 1262
132 Ga0075370_10004655 3300006353 Bacteria 6689
133 Ga0075370_10037269 3300006353 Bacteria 2733
134 Ga0075370_10116336 3300006353 Bacteria 1554
135 Ga0075428_100003226 3300006844 Bacteria 17845
136 Ga0075430_100028048 3300006846 Bacteria 4783
137 Ga0075431_100024868 3300006847 Bacteria 6141
138 Ga0068865_100030297 3300006881 Bacteria 3598
139 Ga0097620_100002520 3300006931 Bacteria 18593
140 Ga0099795_10073600 3300007788 Bacteria 1294
141 Ga0111539_10245221 3300009094 Bacteria 2086
142 Ga0111539_10933855 3300009094 Bacteria 1009
143 Ga0105245_10002947 3300009098 Bacteria 15272
144 Ga0105245_10173874 3300009098 Bacteria 2053
145 Ga0105245_10308958 3300009098 Bacteria 1554
146 Ga0105247_10000089 3300009101 Bacteria 98925
147 Ga0105247_10000987 3300009101 Bacteria 21438
148 Ga0105247_10034198 3300009101 Bacteria 3095
149 Ga0114129_10006072 3300009147 Bacteria 17120
150 Ga0105243_10002294 3300009148 Bacteria 16036
151 Ga0105241_10060904 3300009174 Bacteria 2905
152 Ga0105241_10104943 3300009174 Bacteria 2253
153 Ga0105242_10002156 3300009176 Bacteria 15520
154 Ga0105242_10273668 3300009176 Bacteria 1531
155 Ga0105248_10000183 3300009177 Bacteria 72792
156 Ga0105248_10003302 3300009177 Bacteria 17900
157 Ga0105248_10019893 3300009177 Bacteria 7432
158 Ga0105237_10004951 3300009545 Bacteria 15208
159 Ga0105238_10177964 3300009551 Bacteria 2104
160 Ga0105238_10207319 3300009551 Bacteria 1936
161 Ga0105238_10294600 3300009551 Bacteria 1605
162 Ga0105249_10000117 3300009553 Bacteria 108322
163 Ga0105249_10001271 3300009553 Bacteria 22130
164 Ga0105249_10638800 3300009553 Bacteria 1121
165 Ga0105249_10861503 3300009553 Bacteria 972
166 Ga0105239_10028232 3300010375 Bacteria 6172
167 Ga0105239_10057815 3300010375 Bacteria 4255
168 Ga0105239_10079320 3300010375 Bacteria 3613
169 Ga0105239_10147555 3300010375 Bacteria 2624
170 Ga0157374_10061016 3300013296 Bacteria 3530
171 Ga0157374_10200762 3300013296 Bacteria 1953
172 Ga0157378_10008792 3300013297 Bacteria 8791
173 Ga0157378_10212217 3300013297 Bacteria 1836
174 Ga0163162_10001807 3300013306 Bacteria 20088
175 Ga0163162_10072175 3300013306 Bacteria 3506
176 Ga0163162_10255740 3300013306 Bacteria 1883
177 Ga0157372_10008140 3300013307 Bacteria 11150
178 Ga0157375_10008317 3300013308 Bacteria 9084
179 Ga0157375_10349651 3300013308 Bacteria 1644
180 Ga0157375_10560181 3300013308 Bacteria 1304
181 Ga0163163_10010844 3300014325 Bacteria 8231
182 Ga0163163_10018725 3300014325 Bacteria 6489
183 Ga0163163_10271705 3300014325 Bacteria 1746
184 Ga0163163_10828890 3300014325 Bacteria 988
185 Ga0157380_10005410 3300014326 Bacteria 8922
186 Ga0157380_10243472 3300014326 Bacteria 1623
187 Ga0157377_10059365 3300014745 Bacteria 2180
188 Ga0157377_10061978 3300014745 Bacteria 2139
189 Ga0157379_10003999 3300014968 Bacteria 12572
190 Ga0157379_10093616 3300014968 Bacteria 2696
191 Ga0157379_10183837 3300014968 Bacteria 1888
192 Ga0157376_10136451 3300014969 Bacteria 2196
193 Ga0163161_10002120 3300017792 Bacteria 14350
194 Ga0163161_10081373 3300017792 Bacteria 2384
195 Ga0213874_10064769 3300021377 Bacteria 1153
196 Ga0213874_10081547 3300021377 Bacteria 1049
197 Ga0213876_10003522 3300021384 Bacteria 8928
198 Ga0213876_10012093 3300021384 Bacteria 4598
199 Ga0213876_10043154 3300021384 Bacteria 2383
200 Ga0213876_10108088 3300021384 Bacteria 1476
201 Ga0213875_10010816 3300021388 Bacteria 4562
202 Ga0209025_1069720 3300025294 Bacteria 1255
203 Ga0209051_1000014 3300025303 Bacteria 552732
204 Ga0209051_1000865 3300025303 Bacteria 30711
205 Ga0209051_1004861 3300025303 Bacteria 8071
206 Ga0209051_1008335 3300025303 Bacteria 5498
207 Ga0209051_1022741 3300025303 Bacteria 2629
208 Ga0207653_10026222 3300025885 Bacteria 1867
209 Ga0207692_10000372 3300025898 Bacteria 15423
210 Ga0207692_10006640 3300025898 Bacteria 4704
211 Ga0207642_10003512 3300025899 Bacteria 4958
212 Ga0207642_10187316 3300025899 Bacteria 1132
213 Ga0207710_10000117 3300025900 Bacteria 98934
214 Ga0207710_10000775 3300025900 Bacteria 17389
215 Ga0207688_10000617 3300025901 Bacteria 17505
216 Ga0207688_10009226 3300025901 Bacteria 5375
217 Ga0207680_10013238 3300025903 Bacteria 4231
218 Ga0207647_10027089 3300025904 Bacteria 3741
219 Ga0207685_10019152 3300025905 Bacteria 2251
220 Ga0207654_10027156 3300025911 Bacteria 3109
221 Ga0207695_10118208 3300025913 Bacteria 2622
222 Ga0207671_10030186 3300025914 Bacteria 4044
223 Ga0207671_10038762 3300025914 Bacteria 3531
224 Ga0207671_10046557 3300025914 Bacteria 3209
225 Ga0207693_10000681 3300025915 Bacteria 30511
226 Ga0207693_10000765 3300025915 Bacteria 28902
227 Ga0207693_10125345 3300025915 Bacteria 2018
228 Ga0207663_10015756 3300025916 Bacteria 4178
229 Ga0207663_10051005 3300025916 Bacteria 2574
230 Ga0207681_10544659 3300025923 Bacteria 954
231 Ga0207694_10224409 3300025924 Bacteria 1533
232 Ga0207687_10000262 3300025927 Bacteria 35881
233 Ga0207687_10100777 3300025927 Bacteria 2125
234 Ga0207664_10088621 3300025929 Bacteria 2532
235 Ga0207644_10068030 3300025931 Bacteria 2597
236 Ga0207706_10039626 3300025933 Bacteria 4177
237 Ga0207686_10010816 3300025934 Bacteria 4975
238 Ga0207686_10190784 3300025934 Bacteria 1461
239 Ga0207709_10004066 3300025935 Bacteria 8518
240 Ga0207670_10052081 3300025936 Bacteria 2752
241 Ga0207670_10106283 3300025936 Bacteria 2013
242 Ga0207669_10000563 3300025937 Bacteria 16153
243 Ga0207669_10032130 3300025937 Bacteria 2943
244 Ga0207669_10059937 3300025937 Bacteria 2330
245 Ga0207704_10000495 3300025938 Bacteria 17545
246 Ga0207665_10010978 3300025939 Bacteria 5944
247 Ga0207665_10104285 3300025939 Bacteria 1984
248 Ga0207691_10113548 3300025940 Bacteria 2407
249 Ga0207711_10000096 3300025941 Bacteria 93552
250 Ga0207711_10065376 3300025941 Bacteria 3144
251 Ga0207711_10065775 3300025941 Bacteria 3134
252 Ga0207689_10017132 3300025942 Bacteria 6133
253 Ga0207689_10026186 3300025942 Bacteria 4884
254 Ga0207651_10125626 3300025960 Bacteria 1954
255 Ga0207712_10000083 3300025961 Bacteria 108319
256 Ga0207668_10005297 3300025972 Bacteria 7590
257 Ga0207640_10001197 3300025981 Bacteria 14192
258 Ga0207640_10240570 3300025981 Bacteria 1398
259 Ga0207658_10000085 3300025986 Bacteria 104042
260 Ga0207658_10001787 3300025986 Bacteria 16104
261 Ga0207658_10013063 3300025986 Bacteria 5671
262 Ga0207658_10014775 3300025986 Bacteria 5350
263 Ga0207658_10020544 3300025986 Bacteria 4572
264 Ga0207677_10003083 3300026023 Bacteria 8796
265 Ga0207703_10012330 3300026035 Bacteria 6664
266 Ga0207703_10044388 3300026035 Bacteria 3572
267 Ga0207703_10156961 3300026035 Bacteria 1989
268 Ga0207639_10009143 3300026041 Bacteria 6830
269 Ga0207639_10051543 3300026041 Bacteria 3131
270 Ga0207678_10002286 3300026067 Bacteria 17345
271 Ga0207678_10035348 3300026067 Bacteria 4351
272 Ga0207678_10045351 3300026067 Bacteria 3802
273 Ga0207678_10054699 3300026067 Bacteria 3438
274 Ga0207708_10008493 3300026075 Bacteria 7603
275 Ga0207708_10012484 3300026075 Bacteria 6332
276 Ga0207641_10143499 3300026088 Bacteria 2157
277 Ga0207648_10001087 3300026089 Bacteria 30469
278 Ga0207648_10051169 3300026089 Bacteria 3610
279 Ga0207676_10193814 3300026095 Bacteria 1790
280 Ga0207675_100004579 3300026118 Bacteria 13330
281 Ga0207675_100063200 3300026118 Bacteria 3459
282 Ga0207683_10001707 3300026121 Bacteria 19650
283 Ga0207698_10237183 3300026142 Bacteria 1660
284 Ga0209813_10017574 3300027866 Bacteria 1965
285 Ga0207428_10140022 3300027907 Bacteria 1847
286 Ga0268266_10005521 3300028379 Bacteria 11771
287 Ga0268266_10011534 3300028379 Bacteria 7674
288 Ga0268266_10222301 3300028379 Bacteria 1736
289 Ga0268265_10000099 3300028380 Bacteria 109591
290 Ga0268265_10011868 3300028380 Bacteria 5890
291 Ga0268264_10000225 3300028381 Bacteria 109852
292 Ga0268264_10011261 3300028381 Bacteria 7391
293 Ga0268264_10061323 3300028381 Bacteria 3154
294 Ga0268264_10604496 3300028381 Bacteria 1081
295 Ga0265327_10000113 3300031251 Bacteria 175267
296 Ga0265327_10000718 3300031251 Bacteria 52146
297 Ga0265327_10003510 3300031251 Bacteria 14878
298 Ga0307405_10549980 3300031731 Bacteria 934
299 Ga0307413_10224949 3300031824 Bacteria 1373
300 Ga0307410_10454891 3300031852 Bacteria 1045
301 Ga0307412_10046203 3300031911 Bacteria 2852
302 Ga0307412_10313537 3300031911 Bacteria 1245
303 Ga0307409_100019177 3300031995 Bacteria 4623
304 Ga0307416_100056449 3300032002 Bacteria 3169
305 Ga0307416_100777782 3300032002 Bacteria 1052
306 Ga0307411_10089736 3300032005 Bacteria 2142
307 Ga0307415_100018772 3300032126 Bacteria 4185
308 Ga0373941_0018908 3300035115 Bacteria 1910
309 Ga0373960_0013522 3300035121 Bacteria 2050
310 Ga0373931_0255358 3300035691 Bacteria 1067
311 Ga0316584_0073478 3300036712 Bacteria 2563
312 Ga0436364_1009445 3300037853 Bacteria 41017
313 Ga0436364_1260832 3300037853 Bacteria 5349
314 Ga0436365_0644765 3300039437 Bacteria 3852
315 Ga0436365_0739235 3300039437 Bacteria 18954
316 Ga0436365_1129068 3300039437 Bacteria 8742
317 Ga0436365_1758865 3300039437 Bacteria 1475
318 Ga0436363_0304836 3300039450 Bacteria 1799
319 Ga0436363_1203862 3300039450 Bacteria 3390
320 Ga0436363_1636840 3300039450 Bacteria 1330
321 Ga0439461_0002618 3300041410 Bacteria 2897
322 Ga0439466_0011227 3300041411 Bacteria 3315
323 Ga0439466_0020142 3300041411 Bacteria 2381
324 Ga0439466_0029259 3300041411 Bacteria 1896
325 Ga0439465_0001138 3300041413 Bacteria 8523
326 Ga0451787_559986 3300041441 Bacteria 1101
327 Ga0451807_1384763 3300041486 Bacteria 1915
328 Ga0451853_1612168 3300041512 Bacteria 1026
329 Ga0439431_0002163 3300041997 Bacteria 4330
330 Ga0439445_0002017 3300042004 Bacteria 4480
331 Ga0439445_0017606 3300042004 Bacteria 1767
332 Ga0439448_0092937 3300042005 Bacteria 1020
333 Ga0439448_0095658 3300042005 Bacteria 1006
334 Ga0439434_0028953 3300042435 Bacteria 1679
335 Ga0466969_0041402 3300044656 Bacteria 2305
336 Ga0466972_0008591 3300044658 Bacteria 5124
337 Ga0466972_0029069 3300044658 Bacteria 2723
338 Ga0466972_0085667 3300044658 Bacteria 1497
339 Ga0466972_0107137 3300044658 Bacteria 1321
340 Ga0466965_0003388 3300044683 Bacteria 6982
341 Ga0466965_0009462 3300044683 Bacteria 4528
342 Ga0466965_0020330 3300044683 Bacteria 3190
343 Ga0466966_0013611 3300044684 Bacteria 5382
344 Ga0466966_0015207 3300044684 Bacteria 5091
345 Ga0466966_0044459 3300044684 Bacteria 2843
346 Ga0466964_0015764 3300044706 Bacteria 2877
347 Ga0466971_0017692 3300044719 Bacteria 3155
348 Ga0466968_0000108 3300044735 Bacteria 24579
349 Ga0466968_0111472 3300044735 Bacteria 1230
350 Ga0466970_0055903 3300044765 Bacteria 2108
351 Ga0466970_0213943 3300044765 Bacteria 1074
352 Ga0466957_0020293 3300044842 Bacteria 3910
353 Ga0466957_0088872 3300044842 Bacteria 1933
354 Ga0466957_0161915 3300044842 Bacteria 1454
355 Ga0466960_0000084 3300044901 Bacteria 31326
356 Ga0466960_0003214 3300044901 Bacteria 6264
357 Ga0466959_0016826 3300045049 Bacteria 5351
358 Ga0466959_0053649 3300045049 Bacteria 2946
359 Ga0466959_0106420 3300045049 Bacteria 2005
360 Ga0466959_0317935 3300045049 Bacteria 1064
361 Ga0466958_0011313 3300045836 Bacteria 5025
362 Ga0466958_0015952 3300045836 Bacteria 4318
363 Ga0466958_0018415 3300045836 Bacteria 4053
364 Ga0466967_0000693 3300045976 Bacteria 17131
365 Ga0495629_0030323 3300046459 Bacteria 3835
366 Ga0495638_0000303 3300046460 Bacteria 63516
367 Ga0495638_0024648 3300046460 Bacteria 3919
368 Ga0495638_0274731 3300046460 Bacteria 918
369 Ga0495641_0017247 3300046461 Bacteria 3768
370 Ga0495662_0200296 3300046476 Bacteria 984
371 Ga0495648_0016720 3300046524 Bacteria 5278
372 Ga0495654_0066162 3300046530 Bacteria 1724
373 Ga0495665_0069107 3300046531 Bacteria 1862
374 Ga0495640_0139801 3300046533 Bacteria 1561
375 Ga0495624_0166048 3300046690 Bacteria 1347
376 Ga0495671_0056291 3300046692 Bacteria 1947
377 Ga0495581_0008792 3300047315 Bacteria 5844
378 Ga0495674_0016484 3300047319 Bacteria 6892
379 Ga0495672_0002599 3300047320 Bacteria 16367
380 Ga0495672_0049169 3300047320 Bacteria 2497
381 Ga0495672_0057875 3300047320 Bacteria 2249
382 Ga0495672_0111676 3300047320 Bacteria 1466
383 Ga0495676_0094558 3300047321 Bacteria 2226
384 Ga0495673_0001039 3300047469 Bacteria 24467
385 Ga0495686_0001351 3300047472 Bacteria 27403
386 Ga0495626_0030104 3300048091 Bacteria 2620
387 Ga0496100_0000214 3300048903 Bacteria 31974
388 Ga0496100_0000706 3300048903 Bacteria 15941
389 Ga0496100_0004157 3300048903 Bacteria 7631
390 Ga0496100_0023358 3300048903 Bacteria 3756
391 Ga0496100_0027421 3300048903 Bacteria 3503
392 Ga0496100_0098577 3300048903 Bacteria 2009
393 Ga0496101_0000034 3300048904 Bacteria 178045
394 Ga0496101_0001539 3300048904 Bacteria 13816
395 Ga0496101_0001934 3300048904 Bacteria 12536
396 Ga0496101_0005563 3300048904 Bacteria 8043
397 Ga0496101_0044995 3300048904 Bacteria 3160
398 Ga0496101_0119435 3300048904 Bacteria 1992
399 Ga0496101_0483174 3300048904 Bacteria 978
400 Ga0496102_0000001 3300048905 Bacteria 873433
401 Ga0496102_0000180 3300048905 Bacteria 85998
402 Ga0496102_0003734 3300048905 Bacteria 12870
403 Ga0496102_0003951 3300048905 Bacteria 12567
404 Ga0496102_0012407 3300048905 Bacteria 7374
405 Ga0496102_0100212 3300048905 Bacteria 2690
406 Ga0496102_0296961 3300048905 Bacteria 1523
407 Ga0496102_0574960 3300048905 Bacteria 1050
408 Ga0496103_0000007 3300048906 Bacteria 354915
409 Ga0496103_0000511 3300048906 Bacteria 31999
410 Ga0496103_0001374 3300048906 Bacteria 16417
411 Ga0496103_0001837 3300048906 Bacteria 13797
412 Ga0496103_0042230 3300048906 Bacteria 2805
413 Ga0496103_0104367 3300048906 Bacteria 1796
414 Ga0496104_0002711 3300048907 Bacteria 15248
415 Ga0496104_0007127 3300048907 Bacteria 9857
416 Ga0496104_0067003 3300048907 Bacteria 3410
417 Ga0496104_0276670 3300048907 Bacteria 1592
418 Ga0496105_0008132 3300048908 Bacteria 8156
419 Ga0496105_0011279 3300048908 Bacteria 7054
420 Ga0496105_0288168 3300048908 Bacteria 1322
421 Ga0496105_0378964 3300048908 Bacteria 1126
422 Ga0496106_0000843 3300048909 Bacteria 22268
423 Ga0496106_0000972 3300048909 Bacteria 20919
424 Ga0496106_0001657 3300048909 Bacteria 16708
425 Ga0496106_0046539 3300048909 Bacteria 3262
426 Ga0496106_0154214 3300048909 Bacteria 1813
427 Ga0496106_0325621 3300048909 Bacteria 1233
428 Ga0496107_0000108 3300048910 Bacteria 40403
429 Ga0496107_0002072 3300048910 Bacteria 12824
430 Ga0496107_0012537 3300048910 Bacteria 5918
431 Ga0496107_0051960 3300048910 Bacteria 2957
432 Ga0496107_0105730 3300048910 Bacteria 2066
433 Ga0496108_0001375 3300048911 Bacteria 19133
434 Ga0496108_0002193 3300048911 Bacteria 15653
435 Ga0496108_0028452 3300048911 Bacteria 4625
436 Ga0496108_0107204 3300048911 Bacteria 2386
437 Ga0496109_0000127 3300048912 Bacteria 77905
438 Ga0496109_0042786 3300048912 Bacteria 4105
439 Ga0496109_0043070 3300048912 Bacteria 4092
440 Ga0496109_0061577 3300048912 Bacteria 3431
441 Ga0496110_0004919 3300048913 Bacteria 10431
442 Ga0496110_0016154 3300048913 Bacteria 6225
443 Ga0496110_0034852 3300048913 Bacteria 4363
444 Ga0496112_0000750 3300048915 Bacteria 22692
445 Ga0496112_0012408 3300048915 Bacteria 7832
446 Ga0496112_0020031 3300048915 Bacteria 6333
447 Ga0496112_0021457 3300048915 Bacteria 6143
448 Ga0496112_0040605 3300048915 Bacteria 4550
449 Ga0496113_0024939 3300048916 Bacteria 4258
450 Ga0496114_0000196 3300048917 Bacteria 43970
451 Ga0496114_0000277 3300048917 Bacteria 37457
452 Ga0496114_0001059 3300048917 Bacteria 20678
453 Ga0496114_0166843 3300048917 Bacteria 1917
454 Ga0496114_0314145 3300048917 Bacteria 1384
455 Ga0496114_0353289 3300048917 Bacteria 1300
456 Ga0496115_0006820 3300048918 Bacteria 8378
457 Ga0496115_0008407 3300048918 Bacteria 7639
458 Ga0496115_0019244 3300048918 Bacteria 5252
459 Ga0496115_0115656 3300048918 Bacteria 2206
460 Ga0496116_0000018 3300048919 Bacteria 545877
461 Ga0496116_0103619 3300048919 Bacteria 1692
462 Ga0496117_0000015 3300048920 Bacteria 583316
463 Ga0496117_0000508 3300048920 Bacteria 64302
464 Ga0496117_0023481 3300048920 Bacteria 4911
465 Ga0496117_0073398 3300048920 Bacteria 2283
466 Ga0496118_0000012 3300048921 Bacteria 583316
467 Ga0496118_0000415 3300048921 Bacteria 71044
468 Ga0496118_0048662 3300048921 Bacteria 3270
469 Ga0496119_0002179 3300048922 Bacteria 21959
470 Ga0496119_0011047 3300048922 Bacteria 7528
471 Ga0496119_0040485 3300048922 Bacteria 2980
472 Ga0496120_0000155 3300048923 Bacteria 114046
473 Ga0496120_0016092 3300048923 Bacteria 4900
474 Ga0496120_0060177 3300048923 Bacteria 2125
475 Ga0496121_0000048 3300048924 Bacteria 330242
476 Ga0496121_0001156 3300048924 Bacteria 46246
477 Ga0496121_0003654 3300048924 Bacteria 21631
478 Ga0496122_0002047 3300048925 Bacteria 29932
479 Ga0496122_0020703 3300048925 Bacteria 5925
480 Ga0496122_0187144 3300048925 Bacteria 1227
481 Ga0496123_0008573 3300048926 Bacteria 9369
482 Ga0496124_0000044 3300048927 Bacteria 289064
483 Ga0496124_0231173 3300048927 Bacteria 1382
484 Ga0496125_0000037 3300048928 Bacteria 330242
485 Ga0496125_0009855 3300048928 Bacteria 9722
486 Ga0496126_0000046 3300048929 Bacteria 330242
487 Ga0496126_0001655 3300048929 Bacteria 33535
488 Ga0496126_0015895 3300048929 Bacteria 7556
489 Ga0496126_0023514 3300048929 Bacteria 5970
490 Ga0496126_0038780 3300048929 Bacteria 4428
491 Ga0496126_0472294 3300048929 Bacteria 1006
492 Ga0495682_0069497 3300049460 Bacteria 1268
493 Ga0501032_0003879 3300049569 Bacteria 11356
494 Ga0501032_0231969 3300049569 Bacteria 1200
495 Ga0501034_0001919 3300049571 Bacteria 26321
496 Ga0501034_0179989 3300049571 Bacteria 2079
497 Ga0501036_0030272 3300049572 Bacteria 4574
498 Ga0501037_0000167 3300049573 Bacteria 61779
499 Ga0501038_0003863 3300049574 Bacteria 13922
500 Ga0501039_0000583 3300049575 Bacteria 26350
501 Ga0501043_0002025 3300049579 Bacteria 17305
502 Ga0501047_0005898 3300049581 Bacteria 11525
503 Ga0501047_0308073 3300049581 Bacteria 1425
504 Ga0501069_0288470 3300049585 Bacteria 961
505 Ga0501070_0012730 3300049586 Bacteria 7093
506 Ga0501073_0299474 3300049589 Bacteria 1109
507 Ga0501035_0056980 3300049822 Bacteria 3485
508 Ga0501044_0049961 3300049823 Bacteria 4317
509 nmdc:mga03683_23991_c1 3300050489 Bacteria 2382
510 nmdc:mga03n38_1429_c1 3300050490 Bacteria 6825
511 nmdc:mga03n38_23799_c1 3300050490 Bacteria 2497
512 nmdc:mga03n38_40682_c1 3300050490 Bacteria 2021
513 nmdc:mga03n38_97448_c1 3300050490 Bacteria 1412
514 nmdc:mga00v17_133078_c1 3300050491 Bacteria 1590
515 nmdc:mga00v17_142038_c1 3300050491 Bacteria 1540
516 nmdc:mga00v17_202465_c1 3300050491 Bacteria 1283
517 nmdc:mga00v17_3751_c1 3300050491 Bacteria 7843
518 nmdc:mga00v17_51769_c1 3300050491 Bacteria 2497
519 nmdc:mga00v17_9500_c1 3300050491 Bacteria 5268
520 nmdc:mga0yw44_21446_c1 3300050492 Bacteria 3603
521 nmdc:mga0yw44_23768_c1 3300050492 Bacteria 2204
522 nmdc:mga0yw44_69604_c1 3300050492 Bacteria 2180
523 nmdc:mga06z11_46087_c1 3300050494 Bacteria 2207
524 nmdc:mga04h51_28167_c1 3300050495 Bacteria 1751
525 nmdc:mga07m45_63041_c1 3300050496 Bacteria 2102
526 nmdc:mga07m45_68969_c1 3300050496 Bacteria 2010
527 nmdc:mga07m45_7970_c1 3300050496 Bacteria 5426
528 nmdc:mga05p37_74202_c1 3300050507 Bacteria 2533
529 nmdc:mga06r32_32936_c1 3300050510 Bacteria 4879
530 nmdc:mga08y16_221559_c1 3300050511 Bacteria 1958
531 nmdc:mga0sz30_23023_c1 3300050516 Bacteria 2532
532 nmdc:mga0sz30_29799_c1 3300050516 Bacteria 2252
533 nmdc:mga0sz30_3159_c1 3300050516 Bacteria 5898
534 Ga0500635_0074140 3300053080 Bacteria 1212
535 Ga0495619_0126003 3300053085 Bacteria 1757
536 Ga0500643_010709 3300053087 Bacteria 3394
537 Ga0500562_007925 3300053108 Bacteria 2682
538 Ga0500652_000229 3300053131 Bacteria 21415
539 Ga0500652_106410 3300053131 Bacteria 1172
540 Ga0500559_0022317 3300053136 Bacteria 2684
541 Ga0500568_0080536 3300053139 Bacteria 1237
542 Ga0500588_0035776 3300053146 Bacteria 1464
543 Ga0500616_0004358 3300053153 Bacteria 10127
544 Ga0500627_0032373 3300053158 Bacteria 2203
545 Ga0500645_000004 3300053730 Bacteria 305014
546 Ga0466962_0022337 3300061719 Bacteria 3040
547 Ga0466962_0038432 3300061719 Bacteria 2292
548 Ga0466962_0244921 3300061719 Bacteria 880
549 2644488330 2643221687 Bacteria 6500351
550 2644639990 2643221715 Bacteria 6671032
551 2738663829 2738541264 Bacteria 5935393
552 2738703176 2738541274 Bacteria 6909446
553 2739142964 2738541356 Bacteria 5935017
554 2739329360 2738543028 Bacteria 6917070
555 2753036754 2751185725 Bacteria 5740550
556 2753324625 2751185792 Bacteria 5739090
557 2842136159 2842134933 Bacteria 5847019
558 2902795245 2902792274 Bacteria 7270173
559 2902800418 2902799365 Bacteria 5419524
560 2902811801 2902810491 Bacteria 6794147
561 2902841422 2902837492 Bacteria 6697721
562 2929218446 2929212328 Bacteria 7708288
563 2939583647 2939582691 Bacteria 7088898
564 2974319706 2974315732 Bacteria 4602776
565 2984523574 2984523437 Bacteria 4508481
566 Ga0496109_0183511
567 JGI24739J22299_10071500
568 JGI24737J22298_10068360
569 JGI24743J22301_10007680
570 JGI24748J21848_1007380
571 JGI24744J21845_10000853
572 JGI24744J21845_10010169
573 JGI24742J22300_10001119
574 JGI24751J29686_10012189
575 Ga0055540_1000038
576 Ga0055540_1002436
577 Ga0055540_1003290
578 Ga0055540_1004570
579 Ga0070676_10005393
580 Ga0070690_100282415
581 Ga0068869_100013423
582 Ga0068869_100038297
583 Ga0070666_10079476
584 Ga0070680_100045179
585 Ga0070682_100022499
586 Ga0070682_100454593
587 Ga0070682_100473105
588 Ga0068868_100002062
589 Ga0070689_100014453
590 Ga0070689_100097349
591 Ga0070691_10233497
592 Ga0070668_100006600
593 Ga0070668_100009021
594 Ga0070669_100038388
595 Ga0070675_100154086
596 Ga0070671_100055255
597 Ga0070671_100210947
598 Ga0070674_100052412
599 Ga0070674_100304721
600 Ga0070688_100027106
601 Ga0070688_100057079
602 Ga0070667_100000099
603 Ga0070667_100011251
604 Ga0070667_100011479
605 Ga0070667_100024853
606 Ga0070709_10041982
607 Ga0070714_100028468
608 Ga0070714_100112581
609 Ga0070710_10000860
610 Ga0070710_10003206
611 Ga0070701_10001043
612 Ga0070701_10293805
613 Ga0070711_100000430
614 Ga0070700_100000815
615 Ga0070663_100002169
616 Ga0070663_100037524
617 Ga0070678_100000296
618 Ga0070678_100068777
619 Ga0070678_100192868
620 Ga0070662_100037707
621 Ga0068867_100002560
622 Ga0068867_100069531
623 Ga0070685_10019284
624 Ga0070685_10146604
625 Ga0070697_100641625
626 Ga0068853_100009254
627 Ga0068853_100013269
628 Ga0070672_100224204
629 Ga0070695_100008828
630 Ga0070696_100007202
631 Ga0070693_100011777
632 Ga0070665_100004453
633 Ga0070665_100044249
634 Ga0070665_100047336
635 Ga0070704_100000484
636 Ga0068854_100001737
637 Ga0068854_100198810
638 Ga0070702_100010422
639 Ga0070702_100336319
640 Ga0068852_100333977
641 Ga0068859_100002520
642 Ga0068864_100098242
643 Ga0068864_100744297
644 Ga0068861_100005055
645 Ga0068861_100059724
646 Ga0068861_100182161
647 Ga0068870_10038599
648 Ga0068863_100004183
649 Ga0068863_100020294
650 Ga0068863_100059876
651 Ga0068858_100005212
652 Ga0068858_100055571
653 Ga0068858_100294737
654 Ga0068860_100000163
655 Ga0068860_100002020
656 Ga0068860_100599372
657 Ga0068862_100000089
658 Ga0068862_100016336
659 Ga0068862_100488629
660 Ga0081455_10064403
661 Ga0081455_10069989
662 Ga0081455_10075976
663 Ga0081538_10066811
664 Ga0075365_10015383
665 Ga0075365_10031263
666 Ga0075365_10034858
667 Ga0075365_10041848
668 Ga0075365_10186900
669 Ga0075368_10028013
670 Ga0075363_100000369
671 Ga0075363_100000380
672 Ga0075363_100009679
673 Ga0075363_100009836
674 Ga0075363_100010387
675 Ga0075363_100016376
676 Ga0075363_100043974
677 Ga0075363_100083779
678 Ga0075364_10002787
679 Ga0075364_10003247
680 Ga0075364_10008746
681 Ga0075364_10024041
682 Ga0075364_10037067
683 Ga0070715_10002781
684 Ga0070716_100015973
685 Ga0070712_100000975
686 Ga0070712_100006327
687 Ga0075362_10014003
688 Ga0075362_10014798
689 Ga0075362_10158550
690 Ga0075367_10126292
691 Ga0075369_10009713
692 Ga0075369_10025654
693 Ga0075369_10028147
694 Ga0075369_10036593
695 Ga0075369_10043083
696 Ga0075369_10106334
697 Ga0075370_10004655
698 Ga0075370_10037269
699 Ga0075370_10116336
700 Ga0075428_100003226
701 Ga0075430_100028048
702 Ga0075431_100024868
703 Ga0068865_100030297
704 Ga0097620_100002520
705 Ga0099795_10073600
706 Ga0111539_10245221
707 Ga0111539_10933855
708 Ga0105245_10002947
709 Ga0105245_10173874
710 Ga0105245_10308958
711 Ga0105247_10000089
712 Ga0105247_10000987
713 Ga0105247_10034198
714 Ga0114129_10006072
715 Ga0105243_10002294
716 Ga0105241_10060904
717 Ga0105241_10104943
718 Ga0105242_10002156
719 Ga0105242_10273668
720 Ga0105248_10000183
721 Ga0105248_10003302
722 Ga0105248_10019893
723 Ga0105237_10004951
724 Ga0105238_10177964
725 Ga0105238_10207319
726 Ga0105238_10294600
727 Ga0105249_10000117
728 Ga0105249_10001271
729 Ga0105249_10638800
730 Ga0105249_10861503
731 Ga0105239_10028232
732 Ga0105239_10057815
733 Ga0105239_10079320
734 Ga0105239_10147555
735 Ga0157374_10061016
736 Ga0157374_10200762
737 Ga0157378_10008792
738 Ga0157378_10212217
739 Ga0163162_10001807
740 Ga0163162_10072175
741 Ga0163162_10255740
742 Ga0157372_10008140
743 Ga0157375_10008317
744 Ga0157375_10349651
745 Ga0157375_10560181
746 Ga0163163_10010844
747 Ga0163163_10018725
748 Ga0163163_10271705
749 Ga0163163_10828890
750 Ga0157380_10005410
751 Ga0157380_10243472
752 Ga0157377_10059365
753 Ga0157377_10061978
754 Ga0157379_10003999
755 Ga0157379_10093616
756 Ga0157379_10183837
757 Ga0157376_10136451
758 Ga0163161_10002120
759 Ga0163161_10081373
760 Ga0213874_10064769
761 Ga0213874_10081547
762 Ga0213876_10003522
763 Ga0213876_10012093
764 Ga0213876_10043154
765 Ga0213876_10108088
766 Ga0213875_10010816
767 Ga0209025_1069720
768 Ga0209051_1000014
769 Ga0209051_1000865
770 Ga0209051_1004861
771 Ga0209051_1008335
772 Ga0209051_1022741
773 Ga0207653_10026222
774 Ga0207692_10000372
775 Ga0207692_10006640
776 Ga0207642_10003512
777 Ga0207642_10187316
778 Ga0207710_10000117
779 Ga0207710_10000775
780 Ga0207688_10000617
781 Ga0207688_10009226
782 Ga0207680_10013238
783 Ga0207647_10027089
784 Ga0207685_10019152
785 Ga0207654_10027156
786 Ga0207695_10118208
787 Ga0207671_10030186
788 Ga0207671_10038762
789 Ga0207671_10046557
790 Ga0207693_10000681
791 Ga0207693_10000765
792 Ga0207693_10125345
793 Ga0207663_10015756
794 Ga0207663_10051005
795 Ga0207681_10544659
796 Ga0207694_10224409
797 Ga0207687_10000262
798 Ga0207687_10100777
799 Ga0207664_10088621
800 Ga0207644_10068030
801 Ga0207706_10039626
802 Ga0207686_10010816
803 Ga0207686_10190784
804 Ga0207709_10004066
805 Ga0207670_10052081
806 Ga0207670_10106283
807 Ga0207669_10000563
808 Ga0207669_10032130
809 Ga0207669_10059937
810 Ga0207704_10000495
811 Ga0207665_10010978
812 Ga0207665_10104285
813 Ga0207691_10113548
814 Ga0207711_10000096
815 Ga0207711_10065376
816 Ga0207711_10065775
817 Ga0207689_10017132
818 Ga0207689_10026186
819 Ga0207651_10125626
820 Ga0207712_10000083
821 Ga0207668_10005297
822 Ga0207640_10001197
823 Ga0207640_10240570
824 Ga0207658_10000085
825 Ga0207658_10001787
826 Ga0207658_10013063
827 Ga0207658_10014775
828 Ga0207658_10020544
829 Ga0207677_10003083
830 Ga0207703_10012330
831 Ga0207703_10044388
832 Ga0207703_10156961
833 Ga0207639_10009143
834 Ga0207639_10051543
835 Ga0207678_10002286
836 Ga0207678_10035348
837 Ga0207678_10045351
838 Ga0207678_10054699
839 Ga0207708_10008493
840 Ga0207708_10012484
841 Ga0207641_10143499
842 Ga0207648_10001087
843 Ga0207648_10051169
844 Ga0207676_10193814
845 Ga0207675_100004579
846 Ga0207675_100063200
847 Ga0207683_10001707
848 Ga0207698_10237183
849 Ga0209813_10017574
850 Ga0207428_10140022
851 Ga0268266_10005521
852 Ga0268266_10011534
853 Ga0268266_10222301
854 Ga0268265_10000099
855 Ga0268265_10011868
856 Ga0268264_10000225
857 Ga0268264_10011261
858 Ga0268264_10061323
859 Ga0268264_10604496
860 Ga0265327_10000113
861 Ga0265327_10000718
862 Ga0265327_10003510
863 Ga0307405_10549980
864 Ga0307413_10224949
865 Ga0307410_10454891
866 Ga0307412_10046203
867 Ga0307412_10313537
868 Ga0307409_100019177
869 Ga0307416_100056449
870 Ga0307416_100777782
871 Ga0307411_10089736
872 Ga0307415_100018772
873 Ga0373941_0018908
874 Ga0373960_0013522
875 Ga0373931_0255358
876 Ga0316584_0073478
877 Ga0436364_1009445
878 Ga0436364_1260832
879 Ga0436365_0644765
880 Ga0436365_0739235
881 Ga0436365_1129068
882 Ga0436365_1758865
883 Ga0436363_0304836
884 Ga0436363_1203862
885 Ga0436363_1636840
886 Ga0439461_0002618
887 Ga0439466_0011227
888 Ga0439466_0020142
889 Ga0439466_0029259
890 Ga0439465_0001138
891 Ga0451787_559986
892 Ga0451807_1384763
893 Ga0451853_1612168
894 Ga0439431_0002163
895 Ga0439445_0002017
896 Ga0439445_0017606
897 Ga0439448_0092937
898 Ga0439448_0095658
899 Ga0439434_0028953
900 Ga0466969_0041402
901 Ga0466972_0008591
902 Ga0466972_0029069
903 Ga0466972_0085667
904 Ga0466972_0107137
905 Ga0466965_0003388
906 Ga0466965_0009462
907 Ga0466965_0020330
908 Ga0466966_0013611
909 Ga0466966_0015207
910 Ga0466966_0044459
911 Ga0466964_0015764
912 Ga0466971_0017692
913 Ga0466968_0000108
914 Ga0466968_0111472
915 Ga0466970_0055903
916 Ga0466970_0213943
917 Ga0466957_0020293
918 Ga0466957_0088872
919 Ga0466957_0161915
920 Ga0466960_0000084
921 Ga0466960_0003214
922 Ga0466959_0016826
923 Ga0466959_0053649
924 Ga0466959_0106420
925 Ga0466959_0317935
926 Ga0466958_0011313
927 Ga0466958_0015952
928 Ga0466958_0018415
929 Ga0466967_0000693
930 Ga0495629_0030323
931 Ga0495638_0000303
932 Ga0495638_0024648
933 Ga0495638_0274731
934 Ga0495641_0017247
935 Ga0495662_0200296
936 Ga0495648_0016720
937 Ga0495654_0066162
938 Ga0495665_0069107
939 Ga0495640_0139801
940 Ga0495624_0166048
941 Ga0495671_0056291
942 Ga0495581_0008792
943 Ga0495674_0016484
944 Ga0495672_0002599
945 Ga0495672_0049169
946 Ga0495672_0057875
947 Ga0495672_0111676
948 Ga0495676_0094558
949 Ga0495673_0001039
950 Ga0495686_0001351
951 Ga0495626_0030104
952 Ga0496100_0000214
953 Ga0496100_0000706
954 Ga0496100_0004157
955 Ga0496100_0023358
956 Ga0496100_0027421
957 Ga0496100_0098577
958 Ga0496101_0000034
959 Ga0496101_0001539
960 Ga0496101_0001934
961 Ga0496101_0005563
962 Ga0496101_0044995
963 Ga0496101_0119435
964 Ga0496101_0483174
965 Ga0496102_0000001
966 Ga0496102_0000180
967 Ga0496102_0003734
968 Ga0496102_0003951
969 Ga0496102_0012407
970 Ga0496102_0100212
971 Ga0496102_0296961
972 Ga0496102_0574960
973 Ga0496103_0000007
974 Ga0496103_0000511
975 Ga0496103_0001374
976 Ga0496103_0001837
977 Ga0496103_0042230
978 Ga0496103_0104367
979 Ga0496104_0002711
980 Ga0496104_0007127
981 Ga0496104_0067003
982 Ga0496104_0276670
983 Ga0496105_0008132
984 Ga0496105_0011279
985 Ga0496105_0288168
986 Ga0496105_0378964
987 Ga0496106_0000843
988 Ga0496106_0000972
989 Ga0496106_0001657
990 Ga0496106_0046539
991 Ga0496106_0154214
992 Ga0496106_0325621
993 Ga0496107_0000108
994 Ga0496107_0002072
995 Ga0496107_0012537
996 Ga0496107_0051960
997 Ga0496107_0105730
998 Ga0496108_0001375
999 Ga0496108_0002193
1000 Ga0496108_0028452
1001 Ga0496108_0107204
1002 Ga0496109_0000127
1003 Ga0496109_0042786
1004 Ga0496109_0043070
1005 Ga0496109_0061577
1006 Ga0496110_0004919
1007 Ga0496110_0016154
1008 Ga0496110_0034852
1009 Ga0496112_0000750
1010 Ga0496112_0012408
1011 Ga0496112_0020031
1012 Ga0496112_0021457
1013 Ga0496112_0040605
1014 Ga0496113_0024939
1015 Ga0496114_0000196
1016 Ga0496114_0000277
1017 Ga0496114_0001059
1018 Ga0496114_0166843
1019 Ga0496114_0314145
1020 Ga0496114_0353289
1021 Ga0496115_0006820
1022 Ga0496115_0008407
1023 Ga0496115_0019244
1024 Ga0496115_0115656
1025 Ga0496116_0000018
1026 Ga0496116_0103619
1027 Ga0496117_0000015
1028 Ga0496117_0000508
1029 Ga0496117_0023481
1030 Ga0496117_0073398
1031 Ga0496118_0000012
1032 Ga0496118_0000415
1033 Ga0496118_0048662
1034 Ga0496119_0002179
1035 Ga0496119_0011047
1036 Ga0496119_0040485
1037 Ga0496120_0000155
1038 Ga0496120_0016092
1039 Ga0496120_0060177
1040 Ga0496121_0000048
1041 Ga0496121_0001156
1042 Ga0496121_0003654
1043 Ga0496122_0002047
1044 Ga0496122_0020703
1045 Ga0496122_0187144
1046 Ga0496123_0008573
1047 Ga0496124_0000044
1048 Ga0496124_0231173
1049 Ga0496125_0000037
1050 Ga0496125_0009855
1051 Ga0496126_0000046
1052 Ga0496126_0001655
1053 Ga0496126_0015895
1054 Ga0496126_0023514
1055 Ga0496126_0038780
1056 Ga0496126_0472294
1057 Ga0495682_0069497
1058 Ga0501032_0003879
1059 Ga0501032_0231969
1060 Ga0501034_0001919
1061 Ga0501034_0179989
1062 Ga0501036_0030272
1063 Ga0501037_0000167
1064 Ga0501038_0003863
1065 Ga0501039_0000583
1066 Ga0501043_0002025
1067 Ga0501047_0005898
1068 Ga0501047_0308073
1069 Ga0501069_0288470
1070 Ga0501070_0012730
1071 Ga0501073_0299474
1072 Ga0501035_0056980
1073 Ga0501044_0049961
1074 nmdc:mga03683_23991_c1
1075 nmdc:mga03n38_1429_c1
1076 nmdc:mga03n38_23799_c1
1077 nmdc:mga03n38_40682_c1
1078 nmdc:mga03n38_97448_c1
1079 nmdc:mga00v17_133078_c1
1080 nmdc:mga00v17_142038_c1
1081 nmdc:mga00v17_202465_c1
1082 nmdc:mga00v17_3751_c1
1083 nmdc:mga00v17_51769_c1
1084 nmdc:mga00v17_9500_c1
1085 nmdc:mga0yw44_21446_c1
1086 nmdc:mga0yw44_23768_c1
1087 nmdc:mga0yw44_69604_c1
1088 nmdc:mga06z11_46087_c1
1089 nmdc:mga04h51_28167_c1
1090 nmdc:mga07m45_63041_c1
1091 nmdc:mga07m45_68969_c1
1092 nmdc:mga07m45_7970_c1
1093 nmdc:mga05p37_74202_c1
1094 nmdc:mga06r32_32936_c1
1095 nmdc:mga08y16_221559_c1
1096 nmdc:mga0sz30_23023_c1
1097 nmdc:mga0sz30_29799_c1
1098 nmdc:mga0sz30_3159_c1
1099 Ga0500635_0074140
1100 Ga0495619_0126003
1101 Ga0500643_010709
1102 Ga0500562_007925
1103 Ga0500652_000229
1104 Ga0500652_106410
1105 Ga0500559_0022317
1106 Ga0500568_0080536
1107 Ga0500588_0035776
1108 Ga0500616_0004358
1109 Ga0500627_0032373
1110 Ga0500645_000004
1111 Ga0466962_0022337
1112 Ga0466962_0038432
1113 Ga0466962_0244921
1114 2644488330
1115 2644639990
1116 2738663829
1117 2738703176
1118 2739142964
1119 2739329360
1120 2753036754
1121 2753324625
1122 2842136159
1123 2902795245
1124 2902800418
1125 2902811801
1126 2902841422
1127 2929218446
1128 2939583647
1129 2974319706
1130 2984523574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

15

274

0.97

PF05116

S6PP

Sucrose-6F-phosphate phosphohydrolase

164

272

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t35-assembly1.cif.gz_A crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase kdsc from klebsiella pneumoniae subsp. pneumoniae 0.9211 199 266
3pgv-assembly3.cif.gz_C crystal structure of a haloacid dehalogenase-like hydrolase (kpn_04322) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.39 a resolution 0.8875 2 269
3pgv-assembly1.cif.gz_A crystal structure of a haloacid dehalogenase-like hydrolase (kpn_04322) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.39 a resolution 0.8787 4 270
3pgv-assembly3.cif.gz_C crystal structure of a haloacid dehalogenase-like hydrolase (kpn_04322) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.39 a resolution 0.8778 2 269
3pgv-assembly1.cif.gz_A crystal structure of a haloacid dehalogenase-like hydrolase (kpn_04322) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.39 a resolution 0.8723 4 270
ID Description Score Start End Superfamily
af_O07810_7_266_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 1 5 263 3.40.50.2020
af_O07810_7_266_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9925 5 263 3.40.50.2020
af_Q86KT5_213_287_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9773 199 267 3.40.50.1000
1rkqB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.937 1 268 3.40.50.1000
3pgvC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9156 4 269 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2Z5TQV0-F1-model_v4 deleted 1.001 30 270
AF-A0A2Z5TQV0-F1-model_v4 deleted 0.9927 30 270
AF-J5KLQ6-F1-model_v4 deleted 0.9715 189 267
AF-A0A6J4WIQ7-F1-model_v4 deleted 0.9623 1 268
AF-A0A419ZFW1-F1-model_v4 deleted 0.9619 1 270

Map