F464281

General Info

Members Datasets Scaffolds Average Seq Length
565 437 1130 131

Family's Representative Sequence

Representative Sequence 3300031649|Ga0307514_10000567|Ga0307514_1000056770
Length 161
Sequence LSAPRPAASRQAPQGGPENSGTALRFLESTYLLDTNIISDLIRNPAGAAAQRVAHIGAKAIFTSIVVAAELRYGCAKKGSPKLLAKVESLLAAIPVLPLDIPADVQYGAIRADLEAAGQTIGMNDLLIAAHAKALACTLVTDNTREFNRIRGLKCENWLER

Samples

Sample ID Description Type Environment
1 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
57 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
145 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
146 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
255 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
256 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
257 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
260 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
261 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
262 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
263 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
264 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
265 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
266 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
267 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
268 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
269 2516143018 Ensifer sp. BR816 Isolate Nodule
270 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
271 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
272 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
273 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
274 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
275 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
276 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
277 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
278 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
279 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
280 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
281 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
282 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
283 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
284 2643221736 Bosea sp. Root483D1 Isolate Unclassified
285 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
286 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
287 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
288 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
289 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
290 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
291 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
292 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
293 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
294 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
295 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
296 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
297 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
298 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
299 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
300 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
301 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
302 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
303 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
304 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
305 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
306 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
307 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
308 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
309 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
310 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
311 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
312 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
313 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
314 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
315 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
316 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
317 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
318 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
319 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
320 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
321 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
322 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
323 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
324 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
325 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
326 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
327 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
328 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
329 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
330 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
331 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
332 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
333 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
334 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
335 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
336 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
337 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
338 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
339 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
340 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
341 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
342 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
343 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
344 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
345 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
346 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
347 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
348 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
349 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
350 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
351 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
352 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
353 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
354 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
355 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
356 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
357 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
358 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
359 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
360 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
361 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
362 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
363 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
364 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
365 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
366 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
367 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
368 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
369 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
370 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
371 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
372 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
373 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
374 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
375 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
376 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
377 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
378 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
379 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
380 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
381 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
382 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
383 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
384 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
385 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
386 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
387 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
388 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
389 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
390 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
391 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
392 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
393 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
394 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
395 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
396 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
397 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
398 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
399 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
400 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
401 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
402 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
403 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
404 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
405 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
406 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
407 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
408 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
409 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
410 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
411 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
412 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
413 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
414 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
415 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
416 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
417 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
418 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
419 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
420 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
421 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
422 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
423 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
424 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
425 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
426 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
427 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
428 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
429 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
430 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
431 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
432 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
433 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
434 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
435 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
436 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
437 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 68.14
Metatranscriptomes 0.35
Isolates 31.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.61
Nodule 29.73
Rhizoplane 4.6
Rhizosphere 49.38
Stem 0
Stem Tuber 0
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307514_10000567 3300031649 Bacteria 70155
2 JGI25159J45721_1004403 3300002987 Bacteria 4684
3 JGI25151J46595_10000203 3300003187 Bacteria 73276
4 JGI25406J46586_10000108 3300003203 Bacteria 36424
5 rootH1_10029231 3300003316 Bacteria 1489
6 rootH1_10315688 3300003323 Bacteria 1286
7 Ga0065165_1000631 3300005262 Bacteria 51108
8 Ga0070658_10080725 3300005327 Bacteria 2671
9 Ga0070682_100813270 3300005337 Unclassified 760
10 Ga0068868_100669660 3300005338 Bacteria 926
11 Ga0070660_100655030 3300005339 Bacteria 879
12 Ga0070661_101695857 3300005344 Bacteria 535
13 Ga0070688_100288475 3300005365 Bacteria 1182
14 Ga0070659_100000784 3300005366 Bacteria 23117
15 Ga0070659_101202038 3300005366 Bacteria 670
16 Ga0070714_100005014 3300005435 Bacteria 10066
17 Ga0070713_100004799 3300005436 Bacteria 9158
18 Ga0070713_100214489 3300005436 Bacteria 1744
19 Ga0070710_10009413 3300005437 Bacteria 4778
20 Ga0070711_100010806 3300005439 Bacteria 5661
21 Ga0070681_10059521 3300005458 Bacteria 3799
22 Ga0068867_100684950 3300005459 Bacteria 903
23 Ga0070699_101108104 3300005518 Bacteria 726
24 Ga0070679_100040560 3300005530 Bacteria 4632
25 Ga0070679_100293234 3300005530 Bacteria 1578
26 Ga0070697_100359316 3300005536 Bacteria 1259
27 Ga0068853_100155406 3300005539 Bacteria 2061
28 Ga0068853_100201203 3300005539 Bacteria 1813
29 Ga0070665_100050490 3300005548 Bacteria 4174
30 Ga0070665_100440851 3300005548 Bacteria 1312
31 Ga0070665_100562834 3300005548 Bacteria 1152
32 Ga0068855_100032993 3300005563 Bacteria 6181
33 Ga0068855_100232957 3300005563 Bacteria 2061
34 Ga0068855_100272011 3300005563 Bacteria 1884
35 Ga0068855_101291428 3300005563 Bacteria 756
36 Ga0068857_100492227 3300005577 Bacteria 1150
37 Ga0068856_100004184 3300005614 Bacteria 14419
38 Ga0068856_100392473 3300005614 Bacteria 1407
39 Ga0068852_100169080 3300005616 Bacteria 2047
40 Ga0068852_100368409 3300005616 Bacteria 1407
41 Ga0068851_10063741 3300005834 Bacteria 1893
42 Ga0068858_100997330 3300005842 Bacteria 821
43 Ga0068862_100949199 3300005844 Bacteria 848
44 Ga0081455_10008907 3300005937 Bacteria 10378
45 Ga0081455_10146972 3300005937 Bacteria 1822
46 Ga0081455_10304374 3300005937 Bacteria 1142
47 Ga0081540_1032618 3300005983 Bacteria 2841
48 Ga0081540_1043692 3300005983 Bacteria 2295
49 Ga0081540_1090653 3300005983 Bacteria 1346
50 Ga0081539_10000008 3300005985 Bacteria 525071
51 Ga0070717_10000379 3300006028 Bacteria 28424
52 Ga0070717_10071210 3300006028 Bacteria 2899
53 Ga0075365_10044407 3300006038 Bacteria 2911
54 Ga0075365_10064243 3300006038 Bacteria 2458
55 Ga0075365_10649005 3300006038 Bacteria 746
56 Ga0075363_100222964 3300006048 Bacteria 1081
57 Ga0075363_100423502 3300006048 Bacteria 784
58 Ga0075364_10057126 3300006051 Bacteria 2555
59 Ga0075364_10079814 3300006051 Bacteria 2162
60 Ga0070715_10164489 3300006163 Bacteria 1099
61 Ga0070716_100351387 3300006173 Bacteria 1044
62 Ga0070712_100038098 3300006175 Bacteria 3283
63 Ga0070712_100212403 3300006175 Bacteria 1527
64 Ga0075362_10083423 3300006177 Bacteria 1475
65 Ga0075367_10005310 3300006178 Bacteria 6378
66 Ga0075369_10538844 3300006186 Bacteria 556
67 Ga0075370_10028633 3300006353 Bacteria 3097
68 Ga0099794_10011346 3300007265 Bacteria 3812
69 Ga0099794_10015303 3300007265 Plasmid 3383
70 Ga0099795_10061748 3300007788 Bacteria 1392
71 Ga0105240_10000308 3300009093 Bacteria 94340
72 Ga0105240_10033370 3300009093 Bacteria 6650
73 Ga0105240_10104267 3300009093 Bacteria 3444
74 Ga0105240_10290663 3300009093 Bacteria 1874
75 Ga0105240_10652839 3300009093 Bacteria 1153
76 Ga0105245_12247341 3300009098 Bacteria 599
77 Ga0105243_10233456 3300009148 Bacteria 1633
78 Ga0105243_10264075 3300009148 Unclassified 1543
79 Ga0105243_10874038 3300009148 Bacteria 892
80 Ga0105241_10165649 3300009174 Bacteria 1821
81 Ga0105248_10176370 3300009177 Bacteria 2408
82 Ga0105248_11415975 3300009177 Bacteria 787
83 Ga0105237_10183770 3300009545 Bacteria 2091
84 Ga0105238_10384241 3300009551 Bacteria 1396
85 Ga0105238_10772339 3300009551 Bacteria 975
86 Ga0123340_1012919 3300009763 Bacteria 7486
87 Ga0123341_1014410 3300009765 Bacteria 7083
88 Ga0099796_10060737 3300010159 Bacteria 1339
89 Ga0099796_10149158 3300010159 Bacteria 919
90 Ga0105239_10019181 3300010375 Bacteria 7554
91 Ga0105239_11889771 3300010375 Bacteria 692
92 Ga0105239_12722211 3300010375 Unclassified 577
93 Ga0157371_10777651 3300013102 Bacteria 720
94 Ga0157370_10000481 3300013104 Bacteria 49689
95 Ga0157370_10226623 3300013104 Bacteria 1730
96 Ga0157370_10276468 3300013104 Bacteria 1552
97 Ga0157369_10104463 3300013105 Bacteria 3016
98 Ga0157369_10177540 3300013105 Bacteria 2242
99 Ga0157374_10171700 3300013296 Bacteria 2115
100 Ga0157374_10262708 3300013296 Bacteria 1701
101 Ga0157378_10163624 3300013297 Bacteria 2082
102 Ga0157378_10889633 3300013297 Bacteria 921
103 Ga0163163_10457857 3300014325 Bacteria 1336
104 Ga0163163_10940521 3300014325 Bacteria 928
105 Ga0157380_10100654 3300014326 Bacteria 2406
106 Ga0182008_10033584 3300014497 Bacteria 2574
107 Ga0182008_10037774 3300014497 Bacteria 2415
108 Ga0182008_10401414 3300014497 Bacteria 736
109 Ga0157377_10774507 3300014745 Bacteria 705
110 Ga0182006_1061448 3300015261 Bacteria 1416
111 Ga0182007_10006340 3300015262 Bacteria 5087
112 Ga0182007_10040055 3300015262 Bacteria 1565
113 Ga0213872_10054271 3300021361 Bacteria 1817
114 Ga0213875_10000009 3300021388 Bacteria 451129
115 Ga0209677_106441 3300025253 Bacteria 2777
116 Ga0209233_1028337 3300025261 Bacteria 1345
117 Ga0209673_1026625 3300025273 Bacteria 1895
118 Ga0209130_1001794 3300025284 Bacteria 12605
119 Ga0209025_1000003 3300025294 Bacteria 1366495
120 Ga0209256_1056368 3300025299 Unclassified 930
121 Ga0207426_1107005 3300025302 Bacteria 712
122 Ga0207656_10013038 3300025321 Bacteria 3169
123 Ga0207692_10000441 3300025898 Bacteria 14629
124 Ga0207692_10700559 3300025898 Bacteria 657
125 Ga0207710_10399375 3300025900 Unclassified 705
126 Ga0207647_10039896 3300025904 Bacteria 2960
127 Ga0207647_10304698 3300025904 Bacteria 907
128 Ga0207685_10003777 3300025905 Bacteria 3740
129 Ga0207699_10096886 3300025906 Bacteria 1863
130 Ga0207707_10597493 3300025912 Bacteria 934
131 Ga0207695_10000416 3300025913 Bacteria 94770
132 Ga0207695_10029188 3300025913 Bacteria 6101
133 Ga0207695_10289750 3300025913 Bacteria 1529
134 Ga0207695_10417852 3300025913 Bacteria 1225
135 Ga0207695_10521465 3300025913 Bacteria 1070
136 Ga0207671_10163821 3300025914 Bacteria 1723
137 Ga0207693_10003385 3300025915 Bacteria 13621
138 Ga0207693_10027784 3300025915 Bacteria 4472
139 Ga0207693_10166826 3300025915 Bacteria 1733
140 Ga0207663_10005251 3300025916 Bacteria 6521
141 Ga0207657_10079377 3300025919 Bacteria 2761
142 Ga0207657_10516084 3300025919 Bacteria 935
143 Ga0207652_10094420 3300025921 Bacteria 2634
144 Ga0207652_10304901 3300025921 Bacteria 1437
145 Ga0207681_11593021 3300025923 Bacteria 547
146 Ga0207694_10413331 3300025924 Bacteria 1123
147 Ga0207687_10172104 3300025927 Bacteria 1671
148 Ga0207687_10828779 3300025927 Bacteria 790
149 Ga0207700_10002199 3300025928 Bacteria 11189
150 Ga0207664_10038720 3300025929 Bacteria 3698
151 Ga0207690_10006960 3300025932 Bacteria 6703
152 Ga0207665_10003165 3300025939 Bacteria 11027
153 Ga0207711_10930131 3300025941 Bacteria 808
154 Ga0207667_10040998 3300025949 Bacteria 4927
155 Ga0207667_10117624 3300025949 Bacteria 2739
156 Ga0207667_10237867 3300025949 Bacteria 1864
157 Ga0207667_10644172 3300025949 Bacteria 1066
158 Ga0207677_10801214 3300026023 Bacteria 843
159 Ga0207703_10575863 3300026035 Bacteria 1063
160 Ga0207639_10166085 3300026041 Bacteria 1865
161 Ga0207639_10207773 3300026041 Bacteria 1684
162 Ga0207702_10000556 3300026078 Bacteria 41478
163 Ga0207702_10528531 3300026078 Bacteria 1152
164 Ga0207674_10797291 3300026116 Bacteria 912
165 Ga0207698_10050658 3300026142 Bacteria 3169
166 Ga0207698_10480910 3300026142 Bacteria 1205
167 Ga0207698_11139786 3300026142 Bacteria 793
168 Ga0209179_1005681 3300027512 Bacteria 1968
169 Ga0265357_1012328 3300028023 Bacteria 880
170 Ga0268266_10244561 3300028379 Bacteria 1657
171 Ga0268266_11200873 3300028379 Bacteria 733
172 Ga0268265_11492486 3300028380 Bacteria 679
173 Ga0307515_10350937 3300028794 Bacteria 1122
174 Ga0265338_10000414 3300028800 Bacteria 76428
175 Ga0265338_10160078 3300028800 Bacteria 1739
176 Ga0265763_1000905 3300030763 Bacteria 1979
177 Ga0265773_1004748 3300031018 Bacteria 957
178 Ga0265328_10007324 3300031239 Bacteria 4608
179 Ga0265320_10033937 3300031240 Bacteria 2602
180 Ga0265320_10119519 3300031240 Bacteria 1202
181 Ga0265325_10006834 3300031241 Bacteria 6893
182 Ga0265340_10049069 3300031247 Bacteria 2051
183 Ga0265340_10074056 3300031247 Bacteria 1611
184 Ga0265339_10000053 3300031249 Bacteria 101277
185 Ga0265331_10169903 3300031250 Bacteria 987
186 Ga0265327_10092822 3300031251 Bacteria 1469
187 Ga0307509_10191860 3300031507 Bacteria 1893
188 Ga0307509_10416084 3300031507 Bacteria 1046
189 Ga0307408_100012130 3300031548 Bacteria 5705
190 Ga0307408_100036399 3300031548 Bacteria 3460
191 Ga0265313_10000098 3300031595 Bacteria 89130
192 Ga0265314_10014686 3300031711 Bacteria 6250
193 Ga0265314_10197890 3300031711 Bacteria 1190
194 Ga0307516_10042764 3300031730 Bacteria 4492
195 Ga0307516_10628216 3300031730 Bacteria 729
196 Ga0307405_10133151 3300031731 Bacteria 1721
197 Ga0307409_100661101 3300031995 Bacteria 1040
198 Ga0307416_100466951 3300032002 Bacteria 1319
199 Ga0307415_101203456 3300032126 Bacteria 714
200 Ga0307510_10157068 3300033180 Bacteria 1879
201 Ga0373945_0355643 3300035116 Bacteria 636
202 Ga0373927_0043366 3300035695 Bacteria 2912
203 Ga0373947_0158970 3300035725 Bacteria 1460
204 Ga0373937_1270199 3300036401 Bacteria 684
205 Ga0373925_0204692 3300037068 Bacteria 1570
206 Ga0395900_0138525 3300037418 Bacteria 2493
207 Ga0395898_0162226 3300037466 Bacteria 2138
208 Ga0395905_0455368 3300037471 Bacteria 1178
209 Ga0395905_0576399 3300037471 Bacteria 1027
210 Ga0436360_0673824 3300039438 Bacteria 865
211 Ga0436361_0283842 3300039447 Bacteria 769
212 Ga0436361_0468928 3300039447 Bacteria 2376
213 Ga0436361_0622461 3300039447 Bacteria 7881
214 Ga0436361_0945442 3300039447 Bacteria 6614
215 Ga0436363_0520243 3300039450 Bacteria 1032
216 Ga0436363_1696702 3300039450 Bacteria 1984
217 Ga0439436_0026267 3300041404 Bacteria 1707
218 Ga0451837_1304551 3300041494 Bacteria 542
219 Ga0451849_0627580 3300041505 Bacteria 540
220 Ga0439431_0012539 3300041997 Bacteria 1949
221 Ga0439431_0126415 3300041997 Unclassified 716
222 Ga0450905_040351 3300042142 Unclassified 741
223 Ga0466959_1049672 3300045049 Unclassified 542
224 Ga0451576_1606081 3300045051 Bacteria 674
225 Ga0495617_147754 3300046452 Bacteria 748
226 Ga0495603_0236571 3300046455 Bacteria 1052
227 Ga0495629_0528054 3300046459 Bacteria 794
228 Ga0495638_0021265 3300046460 Bacteria 4278
229 Ga0495638_0298469 3300046460 Bacteria 869
230 Ga0495641_0145216 3300046461 Bacteria 1060
231 Ga0495651_0176691 3300046462 Bacteria 1515
232 Ga0495650_0055675 3300046471 Bacteria 1608
233 Ga0495582_0661689 3300046473 Bacteria 604
234 Ga0495605_0077900 3300046474 Bacteria 1554
235 Ga0495605_0462472 3300046474 Bacteria 521
236 Ga0495639_0120363 3300046475 Bacteria 1252
237 Ga0495664_0049991 3300046477 Bacteria 2482
238 Ga0495584_0191896 3300046491 Bacteria 1038
239 Ga0495585_0020059 3300046492 Bacteria 3846
240 Ga0495594_0213177 3300046499 Bacteria 1101
241 Ga0495596_0087502 3300046500 Bacteria 1209
242 Ga0495606_0227258 3300046507 Bacteria 1048
243 Ga0495610_0091393 3300046512 Bacteria 1379
244 Ga0495616_0014348 3300046513 Bacteria 4438
245 Ga0495620_0140556 3300046515 Unclassified 944
246 Ga0495631_0276785 3300046518 Bacteria 715
247 Ga0495632_0136926 3300046519 Bacteria 1137
248 Ga0495643_0215631 3300046522 Unclassified 913
249 Ga0495648_0195983 3300046524 Bacteria 1015
250 Ga0495609_0124188 3300046538 Bacteria 1108
251 Ga0495621_0422966 3300046539 Bacteria 567
252 Ga0495622_0146042 3300046557 Bacteria 1072
253 Ga0495633_0073014 3300046558 Bacteria 1599
254 Ga0495633_0309949 3300046558 Bacteria 717
255 Ga0495667_0183577 3300046559 Bacteria 1341
256 Ga0495656_0016267 3300046615 Bacteria 2821
257 Ga0495668_0008380 3300046616 Bacteria 6462
258 Ga0495611_0097684 3300046648 Bacteria 1361
259 Ga0495625_0209885 3300046660 Bacteria 1280
260 Ga0495625_0264115 3300046660 Bacteria 1113
261 Ga0495647_0399412 3300046681 Bacteria 631
262 Ga0495613_0870957 3300046689 Bacteria 584
263 Ga0495670_0155401 3300046691 Bacteria 1200
264 Ga0495671_0305009 3300046692 Bacteria 766
265 Ga0495671_0384601 3300046692 Bacteria 672
266 Ga0495589_0057597 3300046794 Bacteria 1911
267 Ga0495600_0018184 3300046809 Bacteria 4476
268 Ga0495660_0240278 3300046810 Bacteria 845
269 Ga0495581_0077865 3300047315 Bacteria 1919
270 Ga0495581_0265884 3300047315 Bacteria 1003
271 Ga0495672_0101809 3300047320 Bacteria 1556
272 Ga0495676_0496559 3300047321 Bacteria 801
273 Ga0495683_0190523 3300047323 Bacteria 930
274 Ga0495673_0043643 3300047469 Bacteria 2005
275 Ga0495686_0146401 3300047472 Bacteria 1390
276 Ga0495686_0495644 3300047472 Bacteria 644
277 Ga0495626_0170522 3300048091 Bacteria 907
278 Ga0496101_0066593 3300048904 Bacteria 2628
279 Ga0496101_0291002 3300048904 Bacteria 1278
280 Ga0496102_0005186 3300048905 Bacteria 11064
281 Ga0496102_1203326 3300048905 Bacteria 677
282 Ga0496102_1415138 3300048905 Unclassified 614
283 Ga0496103_0004959 3300048906 Bacteria 8029
284 Ga0496104_0348715 3300048907 Bacteria 1393
285 Ga0496104_0936399 3300048907 Bacteria 771
286 Ga0496107_0683202 3300048910 Bacteria 756
287 Ga0496107_0691547 3300048910 Bacteria 750
288 Ga0496108_0162734 3300048911 Bacteria 1929
289 Ga0496108_0283410 3300048911 Bacteria 1442
290 Ga0496108_0984946 3300048911 Bacteria 721
291 Ga0496109_0660112 3300048912 Bacteria 983
292 Ga0496110_0586191 3300048913 Bacteria 1012
293 Ga0496110_0714175 3300048913 Bacteria 904
294 Ga0496111_0126658 3300048914 Bacteria 1888
295 Ga0496111_0859835 3300048914 Bacteria 654
296 Ga0496112_0106756 3300048915 Bacteria 2770
297 Ga0496112_0335553 3300048915 Bacteria 1455
298 Ga0496113_0079802 3300048916 Bacteria 2506
299 Ga0496113_0662153 3300048916 Bacteria 834
300 Ga0496113_1268187 3300048916 Bacteria 574
301 Ga0496114_1160027 3300048917 Bacteria 658
302 Ga0496115_0391954 3300048918 Bacteria 1128
303 Ga0496115_0536091 3300048918 Bacteria 937
304 Ga0496116_0034384 3300048919 Bacteria 3577
305 Ga0496116_0354607 3300048919 Bacteria 670
306 Ga0496117_0002157 3300048920 Bacteria 25680
307 Ga0496117_0022426 3300048920 Bacteria 5064
308 Ga0496117_0204647 3300048920 Bacteria 1112
309 Ga0496118_0006937 3300048921 Bacteria 12247
310 Ga0496118_0014192 3300048921 Bacteria 7471
311 Ga0496118_0142032 3300048921 Bacteria 1520
312 Ga0496119_0212796 3300048922 Bacteria 993
313 Ga0496119_0271256 3300048922 Bacteria 847
314 Ga0496120_0015388 3300048923 Bacteria 5048
315 Ga0496120_0252773 3300048923 Bacteria 826
316 Ga0496121_0007985 3300048924 Bacteria 12636
317 Ga0496121_0301172 3300048924 Bacteria 1088
318 Ga0496121_0321978 3300048924 Bacteria 1040
319 Ga0496121_0434937 3300048924 Bacteria 850
320 Ga0496122_0053950 3300048925 Bacteria 3024
321 Ga0496123_0058034 3300048926 Bacteria 2514
322 Ga0496124_0138710 3300048927 Bacteria 1922
323 Ga0496124_0301520 3300048927 Bacteria 1157
324 Ga0496124_0735702 3300048927 Bacteria 620
325 Ga0496125_0028718 3300048928 Bacteria 5015
326 Ga0496125_0067441 3300048928 Bacteria 2819
327 Ga0496126_0080426 3300048929 Bacteria 2884
328 Ga0496126_0402595 3300048929 Bacteria 1110
329 Ga0496126_0441420 3300048929 Bacteria 1049
330 Ga0496126_0614236 3300048929 Bacteria 855
331 Ga0501031_0391858 3300049568 Bacteria 898
332 Ga0501032_0304208 3300049569 Bacteria 1030
333 Ga0501033_0005658 3300049570 Bacteria 9871
334 Ga0501034_0006880 3300049571 Bacteria 12159
335 Ga0501034_0204056 3300049571 Bacteria 1934
336 Ga0501034_0247229 3300049571 Bacteria 1728
337 Ga0501036_0001639 3300049572 Bacteria 17335
338 Ga0501037_0001679 3300049573 Bacteria 16097
339 Ga0501037_0034404 3300049573 Bacteria 3739
340 Ga0501038_0001267 3300049574 Bacteria 22954
341 Ga0501038_0255267 3300049574 Bacteria 1387
342 Ga0501039_0005317 3300049575 Bacteria 9734
343 Ga0501039_0714551 3300049575 Bacteria 783
344 Ga0501040_0294863 3300049576 Bacteria 1159
345 Ga0501041_0282911 3300049577 Bacteria 1044
346 Ga0501042_0314440 3300049578 Unclassified 1131
347 Ga0501043_0003315 3300049579 Bacteria 13268
348 Ga0501043_0075263 3300049579 Bacteria 2652
349 Ga0501046_0023260 3300049580 Bacteria 5099
350 Ga0501047_0107162 3300049581 Bacteria 2676
351 Ga0501072_0452437 3300049588 Bacteria 1017
352 Ga0501072_0708432 3300049588 Bacteria 791
353 Ga0501075_0294486 3300049591 Bacteria 1236
354 Ga0501076_0227698 3300049592 Bacteria 1524
355 Ga0501076_0570191 3300049592 Bacteria 933
356 Ga0501077_0368150 3300049593 Bacteria 918
357 Ga0501081_0891399 3300049743 Bacteria 671
358 Ga0501035_0001126 3300049822 Bacteria 27923
359 Ga0501035_0698931 3300049822 Bacteria 818
360 Ga0501044_0014011 3300049823 Bacteria 8659
361 Ga0501045_0002447 3300049824 Bacteria 12620
362 Ga0501045_0111272 3300049824 Bacteria 2031
363 nmdc:mga03683_518149_c1 3300050489 Bacteria 578
364 nmdc:mga03683_63960_c1 3300050489 Bacteria 1560
365 nmdc:mga03n38_351883_c1 3300050490 Bacteria 802
366 nmdc:mga00v17_66429_c1 3300050491 Bacteria 2227
367 nmdc:mga0yw44_15153_c1 3300050492 Bacteria 4120
368 nmdc:mga0yw44_406237_c1 3300050492 Bacteria 921
369 nmdc:mga0yw44_5970_c1 3300050492 Bacteria 5829
370 nmdc:mga06z11_53776_c1 3300050494 Bacteria 2072
371 nmdc:mga04h51_469674_c1 3300050495 Bacteria 534
372 nmdc:mga07m45_92238_c1 3300050496 Bacteria 1736
373 nmdc:mga0sz30_157299_c1 3300050516 Bacteria 1006
374 nmdc:mga0sz30_224334_c1 3300050516 Bacteria 835
375 nmdc:mga0sz30_366440_c1 3300050516 Bacteria 644
376 nmdc:mga0sz30_41211_c1 3300050516 Bacteria 1941
377 Ga0495655_0242918 3300053083 Bacteria 603
378 Ga0500595_017051 3300053119 Bacteria 2692
379 Ga0500568_0031656 3300053139 Bacteria 2180
380 Ga0500568_0055386 3300053139 Bacteria 1548
381 Ga0500604_0087325 3300053151 Bacteria 1015
382 Ga0500620_000059 3300053155 Bacteria 20299
383 Ga0500627_0109698 3300053158 Bacteria 1242
384 Ga0500637_0018750 3300053178 Bacteria 3722
385 Ga0500645_099368 3300053730 Bacteria 822
386 Ga0530510_0403285 3300061734 Bacteria 1031
387 Ga0530510_0570104 3300061734 Bacteria 860
388 2510305352 2510065057 Bacteria 6649661
389 2511196489 2510917030 Bacteria 7460662
390 2511502490 2511231052 Bacteria 6974333
391 2513588417 2513237086 Bacteria 7265287
392 2513619546 2513237091 Bacteria 6900273
393 2513887156 2513237140 Bacteria 7076289
394 2513904515 2513237143 Bacteria 6664116
395 2513913250 2513237144 Bacteria 7530820
396 2516017061 2515154189 Bacteria 9629850
397 2516210561 2516143018 Bacteria 6951533
398 2516893865 2516653046 Bacteria 6989037
399 2551675719 2551306084 Bacteria 8942552
400 2551688767 2551306085 Bacteria 7347181
401 2551694930 2551306086 Bacteria 6843938
402 2551698937 2551306087 Bacteria 7351905
403 2551710604 2551306089 Bacteria 7162724
404 2551720135 2551306090 Bacteria 7953713
405 2551731294 2551306091 Bacteria 7086830
406 2551738701 2551306092 Bacteria 6992595
407 2551744542 2551306093 Bacteria 7064773
408 2585534489 2585427527 Bacteria 7273426
409 2585556145 2585427530 Bacteria 7383882
410 2586004482 2585427634 Bacteria 6455027
411 2616311496 2615840626 Bacteria 7921970
412 2644747735 2643221736 Bacteria 6608466
413 2758638504 2758568016 Bacteria 5645291
414 2819643584 2818991453 Bacteria 7181617
415 2842515647 2842509118 Bacteria 6850950
416 2855826591 2855825444 Bacteria 6785811
417 2855841981 2855839649 Bacteria 7135830
418 2858802655 2858800743 Bacteria 6603254
419 2915989258 2915986958 Bacteria 6739310
420 2915999052 2915993759 Bacteria 7016183
421 2916005032 2916000859 Bacteria 6865702
422 2916012698 2916007675 Bacteria 6898660
423 2916018974 2916014648 Bacteria 6946486
424 2916023003 2916021584 Bacteria 6854472
425 2916033842 2916028427 Bacteria 6748433
426 2916039377 2916035215 Bacteria 6755766
427 2916044360 2916041962 Bacteria 6820487
428 2916050408 2916048683 Bacteria 6543552
429 2916060320 2916055098 Bacteria 6758838
430 2916073833 2916068649 Bacteria 6943657
431 2916078351 2916076590 Bacteria 6596108
432 2921205750 2921201388 Bacteria 6926299
433 2921212543 2921208531 Bacteria 6745326
434 2921243975 2921237296 Bacteria 6876710
435 2921244500 2921244191 Bacteria 6568419
436 2921257836 2921257292 Bacteria 6808382
437 2921269426 2921263974 Bacteria 6864552
438 2921284708 2921282425 Bacteria 6826397
439 2921291095 2921289301 Bacteria 7316391
440 2921299577 2921296804 Bacteria 7176999
441 2924150333 2924144063 Bacteria 6883928
442 2924156515 2924150972 Bacteria 7169444
443 2924159870 2924158325 Bacteria 7188855
444 2924167483 2924165586 Bacteria 7260590
445 2924178444 2924172951 Bacteria 6749356
446 2924183515 2924179722 Bacteria 6843264
447 2924187689 2924186466 Bacteria 6876637
448 2924196424 2924193448 Bacteria 6955718
449 2924203874 2924200457 Bacteria 6757188
450 2924210785 2924207177 Bacteria 6917007
451 2924216844 2924214083 Bacteria 7080103
452 2924233287 2924228884 Bacteria 6633132
453 2929206781 2929199973 Bacteria 7260745
454 2935637187 2935630451 Bacteria 8169952
455 2937005306 2937002841 Bacteria 6934057
456 2937012842 2937009748 Bacteria 6746052
457 2937021893 2937016420 Bacteria 6782579
458 2937027317 2937023124 Bacteria 6815156
459 2937048483 2937042894 Bacteria 6741576
460 2937055588 2937049772 Bacteria 6757901
461 2937062884 2937056579 Bacteria 7107896
462 2937068713 2937063883 Bacteria 7199456
463 2937075910 2937071275 Bacteria 6984483
464 2937097454 2937091812 Bacteria 6979387
465 2937100053 2937098957 Bacteria 7249374
466 2937110194 2937106411 Bacteria 6947143
467 2937117700 2937113482 Bacteria 6505872
468 2937124533 2937119839 Bacteria 6597547
469 2937132272 2937126314 Bacteria 6771275
470 2941513825 2941507105 Bacteria 8166816
471 2941521787 2941515067 Bacteria 8166720
472 2941529456 2941523033 Bacteria 8169134
473 2957387286 2957382221 Bacteria 6737050
474 2957389526 2957388812 Bacteria 6778072
475 2957397234 2957395598 Bacteria 6822399
476 2957408297 2957402308 Bacteria 6741770
477 2957412947 2957408893 Bacteria 6558585
478 2957418919 2957415311 Bacteria 6991633
479 2957425852 2957422303 Bacteria 7172205
480 2957435841 2957430029 Bacteria 7022557
481 2957450219 2957443900 Bacteria 6869977
482 2957455756 2957450854 Bacteria 6765715
483 2957460474 2957457609 Bacteria 6967680
484 2957468796 2957464669 Bacteria 6568877
485 2957476652 2957471148 Bacteria 6797643
486 2957483146 2957478035 Bacteria 6756658
487 2957489202 2957484790 Bacteria 6703082
488 2957495156 2957491536 Bacteria 6695180
489 2957498966 2957498199 Bacteria 7126688
490 2957507077 2957505466 Bacteria 7253085
491 2960589852 2960584000 Bacteria 6864594
492 2960602129 2960597568 Bacteria 6550735
493 2960610248 2960603979 Bacteria 6898737
494 2960613122 2960610863 Bacteria 6691244
495 2960617973 2960617483 Bacteria 6727748
496 2960629757 2960624210 Bacteria 6875384
497 2960638345 2960637947 Bacteria 7296468
498 2960647433 2960645483 Bacteria 7211087
499 2960655061 2960652885 Bacteria 7083688
500 2960667067 2960660292 Bacteria 7041660
501 2960670703 2960667422 Bacteria 6763020
502 2960680548 2960674078 Bacteria 6609048
503 2964614404 2964607997 Bacteria 7101408
504 2964618154 2964615318 Bacteria 6809089
505 2964628057 2964621998 Bacteria 6834995
506 2964634229 2964628898 Bacteria 7083044
507 2964639166 2964636051 Bacteria 7091832
508 2964646226 2964643177 Bacteria 6820887
509 2964651271 2964649959 Bacteria 6675118
510 2964656938 2964656573 Bacteria 7100150
511 2964667688 2964663802 Bacteria 7019362
512 2964675074 2964670856 Bacteria 6851364
513 2964682688 2964678106 Bacteria 6792020
514 2964689243 2964685014 Bacteria 6839111
515 2964694781 2964691889 Bacteria 6802758
516 2964704525 2964698721 Bacteria 6765331
517 2964706522 2964705432 Bacteria 7114648
518 2964718823 2964712639 Bacteria 6695970
519 2964725782 2964719344 Bacteria 7286602
520 2967666789 2967664464 Bacteria 6948836
521 2967677761 2967671571 Bacteria 7021409
522 2967685800 2967678726 Bacteria 7264382
523 2967698661 2967693043 Bacteria 6804451
524 2967700045 2967699805 Bacteria 6854538
525 2967720364 2967714385 Bacteria 7000047
526 2967727218 2967721400 Bacteria 7073753
527 2967739840 2967735183 Bacteria 6827012
528 2967745285 2967742019 Bacteria 6794534
529 2967754225 2967748971 Bacteria 6733771
530 2967759674 2967755722 Bacteria 6814706
531 2967768467 2967762386 Bacteria 6923502
532 2967772679 2967769361 Bacteria 6587838
533 2967778131 2967775926 Bacteria 6738189
534 2970024341 2970019648 Bacteria 7072033
535 2970035958 2970033650 Bacteria 7118744
536 2970045224 2970040964 Bacteria 6731123
537 2970051488 2970047711 Bacteria 7088379
538 2970065478 2970061556 Bacteria 7099761
539 2970070967 2970068827 Bacteria 7123112
540 2970079397 2970076120 Bacteria 6697332
541 2970084634 2970082768 Bacteria 6183754
542 2970094309 2970088815 Bacteria 6933825
543 2970099947 2970095765 Bacteria 6936963
544 2970103991 2970102677 Bacteria 6812532
545 2970111919 2970109326 Bacteria 6863976
546 2970120535 2970116247 Bacteria 6501857
547 2970134673 2970129317 Bacteria 6806560
548 2970152432 2970149975 Bacteria 6779706
549 2970162241 2970156795 Bacteria 7168044
550 2970168252 2970164137 Bacteria 6861252
551 2970175954 2970170962 Bacteria 6876229
552 2970181129 2970177841 Bacteria 6768001
553 2970186220 2970184632 Bacteria 7054431
554 2970192577 2970191845 Bacteria 7032787
555 2977519296 2977516862 Bacteria 6940108
556 2977528105 2977523885 Bacteria 6960446
557 2977543361 2977537788 Bacteria 6929320
558 2977553001 2977551784 Bacteria 7125765
559 2977564134 2977558990 Bacteria 6863948
560 2977568797 2977565890 Bacteria 6901543
561 2977585969 2977579622 Bacteria 6772100
562 642619730 642555113 Bacteria 8214658
563 648739480 648276728 Bacteria 6968865
564 8003994417 8003992118 Bacteria 7266902
565 8055911844 8055909800 Bacteria 7278581
566 Ga0307514_10000567
567 JGI25159J45721_1004403
568 JGI25151J46595_10000203
569 JGI25406J46586_10000108
570 rootH1_10029231
571 rootH1_10315688
572 Ga0065165_1000631
573 Ga0070658_10080725
574 Ga0070682_100813270
575 Ga0068868_100669660
576 Ga0070660_100655030
577 Ga0070661_101695857
578 Ga0070688_100288475
579 Ga0070659_100000784
580 Ga0070659_101202038
581 Ga0070714_100005014
582 Ga0070713_100004799
583 Ga0070713_100214489
584 Ga0070710_10009413
585 Ga0070711_100010806
586 Ga0070681_10059521
587 Ga0068867_100684950
588 Ga0070699_101108104
589 Ga0070679_100040560
590 Ga0070679_100293234
591 Ga0070697_100359316
592 Ga0068853_100155406
593 Ga0068853_100201203
594 Ga0070665_100050490
595 Ga0070665_100440851
596 Ga0070665_100562834
597 Ga0068855_100032993
598 Ga0068855_100232957
599 Ga0068855_100272011
600 Ga0068855_101291428
601 Ga0068857_100492227
602 Ga0068856_100004184
603 Ga0068856_100392473
604 Ga0068852_100169080
605 Ga0068852_100368409
606 Ga0068851_10063741
607 Ga0068858_100997330
608 Ga0068862_100949199
609 Ga0081455_10008907
610 Ga0081455_10146972
611 Ga0081455_10304374
612 Ga0081540_1032618
613 Ga0081540_1043692
614 Ga0081540_1090653
615 Ga0081539_10000008
616 Ga0070717_10000379
617 Ga0070717_10071210
618 Ga0075365_10044407
619 Ga0075365_10064243
620 Ga0075365_10649005
621 Ga0075363_100222964
622 Ga0075363_100423502
623 Ga0075364_10057126
624 Ga0075364_10079814
625 Ga0070715_10164489
626 Ga0070716_100351387
627 Ga0070712_100038098
628 Ga0070712_100212403
629 Ga0075362_10083423
630 Ga0075367_10005310
631 Ga0075369_10538844
632 Ga0075370_10028633
633 Ga0099794_10011346
634 Ga0099794_10015303
635 Ga0099795_10061748
636 Ga0105240_10000308
637 Ga0105240_10033370
638 Ga0105240_10104267
639 Ga0105240_10290663
640 Ga0105240_10652839
641 Ga0105245_12247341
642 Ga0105243_10233456
643 Ga0105243_10264075
644 Ga0105243_10874038
645 Ga0105241_10165649
646 Ga0105248_10176370
647 Ga0105248_11415975
648 Ga0105237_10183770
649 Ga0105238_10384241
650 Ga0105238_10772339
651 Ga0123340_1012919
652 Ga0123341_1014410
653 Ga0099796_10060737
654 Ga0099796_10149158
655 Ga0105239_10019181
656 Ga0105239_11889771
657 Ga0105239_12722211
658 Ga0157371_10777651
659 Ga0157370_10000481
660 Ga0157370_10226623
661 Ga0157370_10276468
662 Ga0157369_10104463
663 Ga0157369_10177540
664 Ga0157374_10171700
665 Ga0157374_10262708
666 Ga0157378_10163624
667 Ga0157378_10889633
668 Ga0163163_10457857
669 Ga0163163_10940521
670 Ga0157380_10100654
671 Ga0182008_10033584
672 Ga0182008_10037774
673 Ga0182008_10401414
674 Ga0157377_10774507
675 Ga0182006_1061448
676 Ga0182007_10006340
677 Ga0182007_10040055
678 Ga0213872_10054271
679 Ga0213875_10000009
680 Ga0209677_106441
681 Ga0209233_1028337
682 Ga0209673_1026625
683 Ga0209130_1001794
684 Ga0209025_1000003
685 Ga0209256_1056368
686 Ga0207426_1107005
687 Ga0207656_10013038
688 Ga0207692_10000441
689 Ga0207692_10700559
690 Ga0207710_10399375
691 Ga0207647_10039896
692 Ga0207647_10304698
693 Ga0207685_10003777
694 Ga0207699_10096886
695 Ga0207707_10597493
696 Ga0207695_10000416
697 Ga0207695_10029188
698 Ga0207695_10289750
699 Ga0207695_10417852
700 Ga0207695_10521465
701 Ga0207671_10163821
702 Ga0207693_10003385
703 Ga0207693_10027784
704 Ga0207693_10166826
705 Ga0207663_10005251
706 Ga0207657_10079377
707 Ga0207657_10516084
708 Ga0207652_10094420
709 Ga0207652_10304901
710 Ga0207681_11593021
711 Ga0207694_10413331
712 Ga0207687_10172104
713 Ga0207687_10828779
714 Ga0207700_10002199
715 Ga0207664_10038720
716 Ga0207690_10006960
717 Ga0207665_10003165
718 Ga0207711_10930131
719 Ga0207667_10040998
720 Ga0207667_10117624
721 Ga0207667_10237867
722 Ga0207667_10644172
723 Ga0207677_10801214
724 Ga0207703_10575863
725 Ga0207639_10166085
726 Ga0207639_10207773
727 Ga0207702_10000556
728 Ga0207702_10528531
729 Ga0207674_10797291
730 Ga0207698_10050658
731 Ga0207698_10480910
732 Ga0207698_11139786
733 Ga0209179_1005681
734 Ga0265357_1012328
735 Ga0268266_10244561
736 Ga0268266_11200873
737 Ga0268265_11492486
738 Ga0307515_10350937
739 Ga0265338_10000414
740 Ga0265338_10160078
741 Ga0265763_1000905
742 Ga0265773_1004748
743 Ga0265328_10007324
744 Ga0265320_10033937
745 Ga0265320_10119519
746 Ga0265325_10006834
747 Ga0265340_10049069
748 Ga0265340_10074056
749 Ga0265339_10000053
750 Ga0265331_10169903
751 Ga0265327_10092822
752 Ga0307509_10191860
753 Ga0307509_10416084
754 Ga0307408_100012130
755 Ga0307408_100036399
756 Ga0265313_10000098
757 Ga0265314_10014686
758 Ga0265314_10197890
759 Ga0307516_10042764
760 Ga0307516_10628216
761 Ga0307405_10133151
762 Ga0307409_100661101
763 Ga0307416_100466951
764 Ga0307415_101203456
765 Ga0307510_10157068
766 Ga0373945_0355643
767 Ga0373927_0043366
768 Ga0373947_0158970
769 Ga0373937_1270199
770 Ga0373925_0204692
771 Ga0395900_0138525
772 Ga0395898_0162226
773 Ga0395905_0455368
774 Ga0395905_0576399
775 Ga0436360_0673824
776 Ga0436361_0283842
777 Ga0436361_0468928
778 Ga0436361_0622461
779 Ga0436361_0945442
780 Ga0436363_0520243
781 Ga0436363_1696702
782 Ga0439436_0026267
783 Ga0451837_1304551
784 Ga0451849_0627580
785 Ga0439431_0012539
786 Ga0439431_0126415
787 Ga0450905_040351
788 Ga0466959_1049672
789 Ga0451576_1606081
790 Ga0495617_147754
791 Ga0495603_0236571
792 Ga0495629_0528054
793 Ga0495638_0021265
794 Ga0495638_0298469
795 Ga0495641_0145216
796 Ga0495651_0176691
797 Ga0495650_0055675
798 Ga0495582_0661689
799 Ga0495605_0077900
800 Ga0495605_0462472
801 Ga0495639_0120363
802 Ga0495664_0049991
803 Ga0495584_0191896
804 Ga0495585_0020059
805 Ga0495594_0213177
806 Ga0495596_0087502
807 Ga0495606_0227258
808 Ga0495610_0091393
809 Ga0495616_0014348
810 Ga0495620_0140556
811 Ga0495631_0276785
812 Ga0495632_0136926
813 Ga0495643_0215631
814 Ga0495648_0195983
815 Ga0495609_0124188
816 Ga0495621_0422966
817 Ga0495622_0146042
818 Ga0495633_0073014
819 Ga0495633_0309949
820 Ga0495667_0183577
821 Ga0495656_0016267
822 Ga0495668_0008380
823 Ga0495611_0097684
824 Ga0495625_0209885
825 Ga0495625_0264115
826 Ga0495647_0399412
827 Ga0495613_0870957
828 Ga0495670_0155401
829 Ga0495671_0305009
830 Ga0495671_0384601
831 Ga0495589_0057597
832 Ga0495600_0018184
833 Ga0495660_0240278
834 Ga0495581_0077865
835 Ga0495581_0265884
836 Ga0495672_0101809
837 Ga0495676_0496559
838 Ga0495683_0190523
839 Ga0495673_0043643
840 Ga0495686_0146401
841 Ga0495686_0495644
842 Ga0495626_0170522
843 Ga0496101_0066593
844 Ga0496101_0291002
845 Ga0496102_0005186
846 Ga0496102_1203326
847 Ga0496102_1415138
848 Ga0496103_0004959
849 Ga0496104_0348715
850 Ga0496104_0936399
851 Ga0496107_0683202
852 Ga0496107_0691547
853 Ga0496108_0162734
854 Ga0496108_0283410
855 Ga0496108_0984946
856 Ga0496109_0660112
857 Ga0496110_0586191
858 Ga0496110_0714175
859 Ga0496111_0126658
860 Ga0496111_0859835
861 Ga0496112_0106756
862 Ga0496112_0335553
863 Ga0496113_0079802
864 Ga0496113_0662153
865 Ga0496113_1268187
866 Ga0496114_1160027
867 Ga0496115_0391954
868 Ga0496115_0536091
869 Ga0496116_0034384
870 Ga0496116_0354607
871 Ga0496117_0002157
872 Ga0496117_0022426
873 Ga0496117_0204647
874 Ga0496118_0006937
875 Ga0496118_0014192
876 Ga0496118_0142032
877 Ga0496119_0212796
878 Ga0496119_0271256
879 Ga0496120_0015388
880 Ga0496120_0252773
881 Ga0496121_0007985
882 Ga0496121_0301172
883 Ga0496121_0321978
884 Ga0496121_0434937
885 Ga0496122_0053950
886 Ga0496123_0058034
887 Ga0496124_0138710
888 Ga0496124_0301520
889 Ga0496124_0735702
890 Ga0496125_0028718
891 Ga0496125_0067441
892 Ga0496126_0080426
893 Ga0496126_0402595
894 Ga0496126_0441420
895 Ga0496126_0614236
896 Ga0501031_0391858
897 Ga0501032_0304208
898 Ga0501033_0005658
899 Ga0501034_0006880
900 Ga0501034_0204056
901 Ga0501034_0247229
902 Ga0501036_0001639
903 Ga0501037_0001679
904 Ga0501037_0034404
905 Ga0501038_0001267
906 Ga0501038_0255267
907 Ga0501039_0005317
908 Ga0501039_0714551
909 Ga0501040_0294863
910 Ga0501041_0282911
911 Ga0501042_0314440
912 Ga0501043_0003315
913 Ga0501043_0075263
914 Ga0501046_0023260
915 Ga0501047_0107162
916 Ga0501072_0452437
917 Ga0501072_0708432
918 Ga0501075_0294486
919 Ga0501076_0227698
920 Ga0501076_0570191
921 Ga0501077_0368150
922 Ga0501081_0891399
923 Ga0501035_0001126
924 Ga0501035_0698931
925 Ga0501044_0014011
926 Ga0501045_0002447
927 Ga0501045_0111272
928 nmdc:mga03683_518149_c1
929 nmdc:mga03683_63960_c1
930 nmdc:mga03n38_351883_c1
931 nmdc:mga00v17_66429_c1
932 nmdc:mga0yw44_15153_c1
933 nmdc:mga0yw44_406237_c1
934 nmdc:mga0yw44_5970_c1
935 nmdc:mga06z11_53776_c1
936 nmdc:mga04h51_469674_c1
937 nmdc:mga07m45_92238_c1
938 nmdc:mga0sz30_157299_c1
939 nmdc:mga0sz30_224334_c1
940 nmdc:mga0sz30_366440_c1
941 nmdc:mga0sz30_41211_c1
942 Ga0495655_0242918
943 Ga0500595_017051
944 Ga0500568_0031656
945 Ga0500568_0055386
946 Ga0500604_0087325
947 Ga0500620_000059
948 Ga0500627_0109698
949 Ga0500637_0018750
950 Ga0500645_099368
951 Ga0530510_0403285
952 Ga0530510_0570104
953 2510305352
954 2511196489
955 2511502490
956 2513588417
957 2513619546
958 2513887156
959 2513904515
960 2513913250
961 2516017061
962 2516210561
963 2516893865
964 2551675719
965 2551688767
966 2551694930
967 2551698937
968 2551710604
969 2551720135
970 2551731294
971 2551738701
972 2551744542
973 2585534489
974 2585556145
975 2586004482
976 2616311496
977 2644747735
978 2758638504
979 2819643584
980 2842515647
981 2855826591
982 2855841981
983 2858802655
984 2915989258
985 2915999052
986 2916005032
987 2916012698
988 2916018974
989 2916023003
990 2916033842
991 2916039377
992 2916044360
993 2916050408
994 2916060320
995 2916073833
996 2916078351
997 2921205750
998 2921212543
999 2921243975
1000 2921244500
1001 2921257836
1002 2921269426
1003 2921284708
1004 2921291095
1005 2921299577
1006 2924150333
1007 2924156515
1008 2924159870
1009 2924167483
1010 2924178444
1011 2924183515
1012 2924187689
1013 2924196424
1014 2924203874
1015 2924210785
1016 2924216844
1017 2924233287
1018 2929206781
1019 2935637187
1020 2937005306
1021 2937012842
1022 2937021893
1023 2937027317
1024 2937048483
1025 2937055588
1026 2937062884
1027 2937068713
1028 2937075910
1029 2937097454
1030 2937100053
1031 2937110194
1032 2937117700
1033 2937124533
1034 2937132272
1035 2941513825
1036 2941521787
1037 2941529456
1038 2957387286
1039 2957389526
1040 2957397234
1041 2957408297
1042 2957412947
1043 2957418919
1044 2957425852
1045 2957435841
1046 2957450219
1047 2957455756
1048 2957460474
1049 2957468796
1050 2957476652
1051 2957483146
1052 2957489202
1053 2957495156
1054 2957498966
1055 2957507077
1056 2960589852
1057 2960602129
1058 2960610248
1059 2960613122
1060 2960617973
1061 2960629757
1062 2960638345
1063 2960647433
1064 2960655061
1065 2960667067
1066 2960670703
1067 2960680548
1068 2964614404
1069 2964618154
1070 2964628057
1071 2964634229
1072 2964639166
1073 2964646226
1074 2964651271
1075 2964656938
1076 2964667688
1077 2964675074
1078 2964682688
1079 2964689243
1080 2964694781
1081 2964704525
1082 2964706522
1083 2964718823
1084 2964725782
1085 2967666789
1086 2967677761
1087 2967685800
1088 2967698661
1089 2967700045
1090 2967720364
1091 2967727218
1092 2967739840
1093 2967745285
1094 2967754225
1095 2967759674
1096 2967768467
1097 2967772679
1098 2967778131
1099 2970024341
1100 2970035958
1101 2970045224
1102 2970051488
1103 2970065478
1104 2970070967
1105 2970079397
1106 2970084634
1107 2970094309
1108 2970099947
1109 2970103991
1110 2970111919
1111 2970120535
1112 2970134673
1113 2970152432
1114 2970162241
1115 2970168252
1116 2970175954
1117 2970181129
1118 2970186220
1119 2970192577
1120 2977519296
1121 2977528105
1122 2977543361
1123 2977553001
1124 2977564134
1125 2977568797
1126 2977585969
1127 642619730
1128 648739480
1129 8003994417
1130 8055911844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

31

153

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.9306 2 131
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.9206 1 131
6ifm-assembly1.cif.gz_C crystal structure of dna bound vapbc from salmonella typhimurium 0.9154 1 131
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.913 1 131
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.9072 1 131
ID Description Score Start End Superfamily
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8985 1 131 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.894 2 131 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8845 1 131 3.40.50.1010
af_O07783_4_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8765 3 130 3.40.50.1010
6nklA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8706 2 133 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1H7Z5U3-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 1.004 1 133 GO:0000287
GO:0004519
GO:0004540
GO:0090729
AF-A0A7W6CPD2-F1-model_v4 tRNA(fMet)-specific endonuclease VapC (EC 3.1.-.-) 0.9968 2 133 GO:0004519
GO:0046872
AF-A0A3S2GHS1-F1-model_v4 deleted 0.9947 2 133
AF-A0A259RWL1-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9923 2 133 GO:0000287
GO:0004540
GO:0090729
AF-A0A4R8FII5-F1-model_v4 deleted 0.9922 2 133

Map