F464161

General Info

Members Datasets Scaffolds Average Seq Length
564 272 1128 446

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000284|Ga0105240_1000028439
Length 472
Sequence MAKADDAELLEVDGRRVRISSPGKPYFTRGVKLTKLDIVRYFLSVAPAAVRGIVDRPVVLKRFVNGAEAEPFYQKRAPGDLPEWMRTVTLSFPSGRTAEEVVVDDAAGLAWVVNLGCMELHPHPVRSADLDHPDELRVDLDPQPGVEWKDVRAVAMEVKALLDELGLKGWPKTSGSRGIHINVRIEPRWTFTEVRRAALALARAVEKRCSLASSKWWKEERHGVFLDYNQNAKDRTTCSAYSVRPLPDARVSTPLHWDEVMTCDPADFTVLTVPGRLEKTGDPNAEMDQYAGVLDGLLELAARDEAEGLGDAPWPPHFAKQEGEGKRVAPSKAKRFSDQLQEGFGEHRFRRQSKKKAVASAEGAAAEGSVKATAETKAAKPKRGARVSKMPLIIVAQSPDKAAAEAGLERWKAAHPEAAASLLADDILVDRMRGASYVWYRIRVNLRHVPEDQRPAQGAPDPDDDPTRDWKK

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.53
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 4.26
Rhizosphere 93.97
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10000284 3300009093 Bacteria 99440
2 JGI24034J26672_10000857 3300002239 Bacteria 3954
3 rootH2_10013843 3300003320 Bacteria 5404
4 Ga0065714_10002198 3300005288 Bacteria 90565
5 Ga0065712_10000119 3300005290 Bacteria 137052
6 Ga0065715_10103851 3300005293 Unclassified 3004
7 Ga0070658_10002172 3300005327 Bacteria 16462
8 Ga0070658_10008674 3300005327 Bacteria 8167
9 Ga0070658_10142755 3300005327 Bacteria 2001
10 Ga0070676_10037210 3300005328 Bacteria 2806
11 Ga0070683_100003057 3300005329 Bacteria 13456
12 Ga0070683_100006648 3300005329 Bacteria 9711
13 Ga0070683_100169603 3300005329 Unclassified 2071
14 Ga0070690_100013227 3300005330 Bacteria 4872
15 Ga0070670_100009899 3300005331 Bacteria 8140
16 Ga0068869_100056310 3300005334 Bacteria 2867
17 Ga0070682_100029087 3300005337 Bacteria 3326
18 Ga0070660_100001529 3300005339 Bacteria 15887
19 Ga0070689_100012336 3300005340 Bacteria 6153
20 Ga0070669_100006840 3300005353 Bacteria 8204
21 Ga0070675_100007202 3300005354 Bacteria 8574
22 Ga0070675_100205765 3300005354 Bacteria 1709
23 Ga0070671_100068083 3300005355 Bacteria 2969
24 Ga0070674_100002349 3300005356 Bacteria 10435
25 Ga0070659_100007853 3300005366 Bacteria 7768
26 Ga0070714_100036640 3300005435 Bacteria 4115
27 Ga0070714_100198228 3300005435 Bacteria 1836
28 Ga0070713_100087287 3300005436 Bacteria 2675
29 Ga0070705_100060608 3300005440 Bacteria 2245
30 Ga0070700_100000118 3300005441 Bacteria 49489
31 Ga0070681_10001350 3300005458 Bacteria 21438
32 Ga0070681_10009586 3300005458 Bacteria 9520
33 Ga0070681_10017112 3300005458 Bacteria 7247
34 Ga0070681_10061348 3300005458 Bacteria 3735
35 Ga0070681_10085992 3300005458 Bacteria 3097
36 Ga0070681_10090048 3300005458 Bacteria 3019
37 Ga0068867_100046707 3300005459 Bacteria 3181
38 Ga0068867_100107187 3300005459 Bacteria 2141
39 Ga0070706_100000224 3300005467 Bacteria 69180
40 Ga0070706_100165801 3300005467 Bacteria 2063
41 Ga0070679_100001545 3300005530 Bacteria 20550
42 Ga0070679_100014432 3300005530 Bacteria 7587
43 Ga0070679_100091764 3300005530 Bacteria 3025
44 Ga0070684_100003621 3300005535 Bacteria 11631
45 Ga0068853_100004114 3300005539 Bacteria 11211
46 Ga0068853_100044186 3300005539 Bacteria 3814
47 Ga0070672_100020661 3300005543 Bacteria 4805
48 Ga0070686_100008785 3300005544 Bacteria 5660
49 Ga0070696_100040468 3300005546 Bacteria 3218
50 Ga0070696_100043966 3300005546 Bacteria 3092
51 Ga0070693_100002343 3300005547 Bacteria 8708
52 Ga0070693_100012268 3300005547 Bacteria 4334
53 Ga0070693_100022474 3300005547 Unclassified 3355
54 Ga0070665_100010655 3300005548 Bacteria 9306
55 Ga0070665_100011082 3300005548 Bacteria 9109
56 Ga0068855_100009162 3300005563 Bacteria 11954
57 Ga0068855_100013949 3300005563 Bacteria 9688
58 Ga0068855_100028702 3300005563 Bacteria 6657
59 Ga0068855_100028988 3300005563 Bacteria 6621
60 Ga0068855_100104471 3300005563 Bacteria 3258
61 Ga0068855_100109588 3300005563 Bacteria 3170
62 Ga0068855_100146237 3300005563 Bacteria 2690
63 Ga0070664_100000536 3300005564 Bacteria 28952
64 Ga0070664_100004114 3300005564 Bacteria 11685
65 Ga0070664_100042730 3300005564 Bacteria 3825
66 Ga0070664_100231187 3300005564 Bacteria 1657
67 Ga0068857_100000402 3300005577 Bacteria 30398
68 Ga0068857_100000904 3300005577 Bacteria 22401
69 Ga0068857_100008378 3300005577 Bacteria 8935
70 Ga0068854_100031069 3300005578 Unclassified 3709
71 Ga0068854_100035864 3300005578 Bacteria 3474
72 Ga0068854_100117942 3300005578 Unclassified 2010
73 Ga0068856_100031151 3300005614 Bacteria 5217
74 Ga0068856_100105968 3300005614 Bacteria 2805
75 Ga0068856_100114694 3300005614 Bacteria 2694
76 Ga0068856_100216780 3300005614 Bacteria 1929
77 Ga0068852_100045795 3300005616 Bacteria 3723
78 Ga0068852_100168279 3300005616 Bacteria 2052
79 Ga0068859_100009967 3300005617 Bacteria 9585
80 Ga0068859_100012408 3300005617 Bacteria 8572
81 Ga0068859_100054155 3300005617 Unclassified 4034
82 Ga0068859_100200298 3300005617 Bacteria 2081
83 Ga0068864_100004199 3300005618 Bacteria 11844
84 Ga0068866_10001945 3300005718 Bacteria 8612
85 Ga0068866_10024931 3300005718 Bacteria 2806
86 Ga0068861_100020449 3300005719 Bacteria 4742
87 Ga0068851_10008693 3300005834 Bacteria 4704
88 Ga0068870_10000502 3300005840 Bacteria 14804
89 Ga0068863_100159621 3300005841 Bacteria 2160
90 Ga0068863_100173773 3300005841 Bacteria 2067
91 Ga0068863_100216382 3300005841 Unclassified 1845
92 Ga0068863_100358192 3300005841 Bacteria 1422
93 Ga0068860_100211924 3300005843 Bacteria 1879
94 Ga0068862_100003038 3300005844 Bacteria 14609
95 Ga0081538_10001078 3300005981 Bacteria 29015
96 Ga0081538_10032979 3300005981 Bacteria 3457
97 Ga0081538_10037385 3300005981 Bacteria 3150
98 Ga0081540_1054647 3300005983 Bacteria 1950
99 Ga0070717_10048495 3300006028 Bacteria 3483
100 Ga0070717_10054703 3300006028 Bacteria 3292
101 Ga0070717_10094335 3300006028 Bacteria 2531
102 Ga0097621_100000867 3300006237 Bacteria 21249
103 Ga0097621_100166384 3300006237 Bacteria 1898
104 Ga0068871_100001599 3300006358 Bacteria 15228
105 Ga0068871_100073098 3300006358 Bacteria 2826
106 Ga0075428_100002015 3300006844 Bacteria 21915
107 Ga0075428_100194832 3300006844 Bacteria 2191
108 Ga0075428_100225829 3300006844 Bacteria 2021
109 Ga0075431_100004327 3300006847 Bacteria 13915
110 Ga0075431_100007822 3300006847 Bacteria 10650
111 Ga0075431_100233862 3300006847 Bacteria 1872
112 Ga0075433_10014857 3300006852 Bacteria 6372
113 Ga0075433_10044156 3300006852 Bacteria 3872
114 Ga0075433_10045519 3300006852 Bacteria 3815
115 Ga0075433_10163768 3300006852 Bacteria 1979
116 Ga0075434_100000227 3300006871 Bacteria 38631
117 Ga0075434_100007020 3300006871 Bacteria 10386
118 Ga0075434_100072113 3300006871 Bacteria 3445
119 Ga0075434_100293332 3300006871 Bacteria 1646
120 Ga0068865_100002777 3300006881 Bacteria 10402
121 Ga0068865_100015535 3300006881 Bacteria 4857
122 Ga0075436_100002003 3300006914 Bacteria 14074
123 Ga0075436_100008474 3300006914 Bacteria 7030
124 Ga0075436_100020044 3300006914 Bacteria 4589
125 Ga0097620_100009968 3300006931 Bacteria 9585
126 Ga0097620_100012408 3300006931 Bacteria 8572
127 Ga0097620_100054156 3300006931 Unclassified 4034
128 Ga0097620_100200295 3300006931 Bacteria 2081
129 Ga0075435_100000939 3300007076 Bacteria 18368
130 Ga0075435_100065292 3300007076 Bacteria 2958
131 Ga0075435_100103383 3300007076 Bacteria 2363
132 Ga0105251_10040677 3300009011 Bacteria 2266
133 Ga0105250_10044942 3300009092 Bacteria 1771
134 Ga0105240_10006746 3300009093 Bacteria 16806
135 Ga0105240_10007610 3300009093 Bacteria 15688
136 Ga0105240_10032270 3300009093 Bacteria 6783
137 Ga0111539_10025658 3300009094 Bacteria 7223
138 Ga0111539_10443862 3300009094 Bacteria 1511
139 Ga0105245_10027706 3300009098 Bacteria 4992
140 Ga0105245_10033524 3300009098 Unclassified 4553
141 Ga0105245_10036628 3300009098 Bacteria 4359
142 Ga0105245_10072371 3300009098 Bacteria 3131
143 Ga0114129_10009218 3300009147 Bacteria 14075
144 Ga0114129_10021299 3300009147 Bacteria 9203
145 Ga0114129_10021417 3300009147 Bacteria 9177
146 Ga0114129_10042086 3300009147 Bacteria 6432
147 Ga0114129_10061388 3300009147 Bacteria 5253
148 Ga0114129_10081335 3300009147 Bacteria 4503
149 Ga0114129_10123161 3300009147 Bacteria 3567
150 Ga0114129_10388586 3300009147 Bacteria 1841
151 Ga0114129_10400625 3300009147 Bacteria 1808
152 Ga0105241_10000072 3300009174 Bacteria 76927
153 Ga0105241_10003893 3300009174 Bacteria 11058
154 Ga0105241_10012188 3300009174 Bacteria 6309
155 Ga0105241_10016897 3300009174 Bacteria 5356
156 Ga0105241_10054622 3300009174 Unclassified 3058
157 Ga0105241_10060959 3300009174 Bacteria 2904
158 Ga0105242_10012597 3300009176 Bacteria 6511
159 Ga0105242_10019686 3300009176 Bacteria 5289
160 Ga0105242_10077603 3300009176 Bacteria 2771
161 Ga0105248_10001564 3300009177 Bacteria 25451
162 Ga0105248_10012835 3300009177 Bacteria 9241
163 Ga0105248_10014439 3300009177 Bacteria 8693
164 Ga0105248_10040326 3300009177 Bacteria 5233
165 Ga0105248_10104965 3300009177 Bacteria 3186
166 Ga0105237_10002126 3300009545 Bacteria 24939
167 Ga0105237_10097988 3300009545 Bacteria 2923
168 Ga0105238_10000338 3300009551 Bacteria 51021
169 Ga0105238_10003922 3300009551 Bacteria 14765
170 Ga0105238_10142979 3300009551 Bacteria 2369
171 Ga0105249_10027115 3300009553 Bacteria 5168
172 Ga0105239_10000334 3300010375 Bacteria 68928
173 Ga0105239_10016059 3300010375 Bacteria 8284
174 Ga0105239_10055705 3300010375 Bacteria 4336
175 Ga0105239_10174773 3300010375 Bacteria 2402
176 Ga0157373_10004452 3300013100 Bacteria 10544
177 Ga0157373_10020916 3300013100 Unclassified 4751
178 Ga0157373_10029100 3300013100 Unclassified 3982
179 Ga0157371_10022412 3300013102 Bacteria 4629
180 Ga0157370_10004867 3300013104 Bacteria 15245
181 Ga0157370_10037234 3300013104 Bacteria 4716
182 Ga0157370_10049926 3300013104 Bacteria 4001
183 Ga0157370_10064312 3300013104 Bacteria 3473
184 Ga0157369_10001807 3300013105 Bacteria 25881
185 Ga0157369_10002755 3300013105 Bacteria 20990
186 Ga0157369_10011210 3300013105 Bacteria 10189
187 Ga0157369_10012962 3300013105 Bacteria 9445
188 Ga0157369_10048721 3300013105 Bacteria 4597
189 Ga0157369_10054950 3300013105 Bacteria 4299
190 Ga0157369_10098585 3300013105 Bacteria 3116
191 Ga0157374_10001976 3300013296 Bacteria 17206
192 Ga0157374_10046456 3300013296 Bacteria 4021
193 Ga0157374_10069244 3300013296 Bacteria 3322
194 Ga0157374_10141446 3300013296 Bacteria 2336
195 Ga0157378_10000086 3300013297 Bacteria 86864
196 Ga0157378_10006664 3300013297 Bacteria 10090
197 Ga0157378_10008592 3300013297 Bacteria 8886
198 Ga0163162_10000176 3300013306 Bacteria 59007
199 Ga0163162_10013002 3300013306 Bacteria 8123
200 Ga0163162_10047698 3300013306 Bacteria 4292
201 Ga0163162_10064045 3300013306 Bacteria 3721
202 Ga0157372_10017636 3300013307 Bacteria 7662
203 Ga0157372_10019316 3300013307 Bacteria 7340
204 Ga0157372_10046461 3300013307 Unclassified 4820
205 Ga0157372_10106807 3300013307 Bacteria 3203
206 Ga0157372_10277827 3300013307 Unclassified 1947
207 Ga0157375_10002269 3300013308 Bacteria 16650
208 Ga0157375_10027969 3300013308 Bacteria 5278
209 Ga0157375_10099210 3300013308 Bacteria 2991
210 Ga0157375_10123016 3300013308 Bacteria 2706
211 Ga0163163_10010546 3300014325 Bacteria 8316
212 Ga0163163_10021871 3300014325 Bacteria 6043
213 Ga0163163_10140317 3300014325 Bacteria 2459
214 Ga0157377_10015615 3300014745 Bacteria 3891
215 Ga0157379_10003452 3300014968 Bacteria 13377
216 Ga0157379_10033199 3300014968 Bacteria 4603
217 Ga0157379_10071185 3300014968 Bacteria 3111
218 Ga0157376_10006248 3300014969 Bacteria 8398
219 Ga0157376_10108416 3300014969 Bacteria 2440
220 Ga0157376_10180976 3300014969 Bacteria 1927
221 Ga0157376_10198843 3300014969 Bacteria 1843
222 Ga0182007_10015852 3300015262 Bacteria 2797
223 Ga0163161_10001674 3300017792 Bacteria 16258
224 Ga0207697_10008185 3300025315 Bacteria 4598
225 Ga0207642_10005751 3300025899 Bacteria 4071
226 Ga0207642_10057015 3300025899 Bacteria 1795
227 Ga0207688_10005120 3300025901 Bacteria 7119
228 Ga0207680_10012354 3300025903 Bacteria 4347
229 Ga0207680_10027687 3300025903 Bacteria 3160
230 Ga0207647_10003019 3300025904 Bacteria 12663
231 Ga0207647_10004011 3300025904 Bacteria 10985
232 Ga0207645_10000490 3300025907 Bacteria 32564
233 Ga0207643_10000448 3300025908 Bacteria 26776
234 Ga0207705_10006576 3300025909 Bacteria 8607
235 Ga0207705_10009690 3300025909 Bacteria 7006
236 Ga0207705_10054845 3300025909 Bacteria 2873
237 Ga0207684_10000310 3300025910 Bacteria 69199
238 Ga0207654_10000013 3300025911 Bacteria 241873
239 Ga0207654_10057427 3300025911 Bacteria 2262
240 Ga0207707_10001817 3300025912 Bacteria 19578
241 Ga0207707_10008082 3300025912 Bacteria 9133
242 Ga0207707_10041962 3300025912 Bacteria 3994
243 Ga0207707_10123393 3300025912 Bacteria 2265
244 Ga0207707_10233892 3300025912 Bacteria 1599
245 Ga0207695_10000098 3300025913 Bacteria 261213
246 Ga0207695_10002494 3300025913 Bacteria 27107
247 Ga0207695_10003668 3300025913 Bacteria 21407
248 Ga0207695_10023367 3300025913 Bacteria 6986
249 Ga0207695_10075842 3300025913 Bacteria 3420
250 Ga0207693_10061769 3300025915 Bacteria 2935
251 Ga0207663_10003331 3300025916 Bacteria 7844
252 Ga0207662_10005145 3300025918 Bacteria 6940
253 Ga0207657_10000400 3300025919 Bacteria 45936
254 Ga0207657_10001063 3300025919 Bacteria 29134
255 Ga0207657_10002846 3300025919 Bacteria 18595
256 Ga0207657_10072282 3300025919 Bacteria 2918
257 Ga0207649_10000398 3300025920 Bacteria 32611
258 Ga0207649_10008686 3300025920 Bacteria 5548
259 Ga0207652_10003175 3300025921 Bacteria 13673
260 Ga0207652_10014490 3300025921 Bacteria 6387
261 Ga0207652_10031338 3300025921 Bacteria 4465
262 Ga0207652_10049117 3300025921 Bacteria 3610
263 Ga0207652_10091279 3300025921 Bacteria 2678
264 Ga0207652_10110120 3300025921 Bacteria 2442
265 Ga0207694_10000105 3300025924 Bacteria 89920
266 Ga0207694_10003745 3300025924 Bacteria 12050
267 Ga0207694_10054448 3300025924 Bacteria 3104
268 Ga0207650_10000121 3300025925 Bacteria 102877
269 Ga0207650_10030044 3300025925 Bacteria 3911
270 Ga0207650_10178007 3300025925 Bacteria 1694
271 Ga0207659_10022989 3300025926 Bacteria 4157
272 Ga0207687_10021627 3300025927 Bacteria 4275
273 Ga0207687_10048088 3300025927 Bacteria 2960
274 Ga0207664_10013814 3300025929 Bacteria 5813
275 Ga0207664_10042353 3300025929 Bacteria 3553
276 Ga0207664_10062056 3300025929 Bacteria 2984
277 Ga0207644_10059827 3300025931 Bacteria 2756
278 Ga0207690_10016322 3300025932 Bacteria 4514
279 Ga0207706_10000896 3300025933 Bacteria 30564
280 Ga0207706_10006465 3300025933 Bacteria 10881
281 Ga0207706_10041160 3300025933 Bacteria 4097
282 Ga0207670_10003632 3300025936 Bacteria 8186
283 Ga0207691_10002248 3300025940 Bacteria 18936
284 Ga0207691_10013851 3300025940 Bacteria 7699
285 Ga0207711_10011345 3300025941 Bacteria 7402
286 Ga0207711_10126188 3300025941 Bacteria 2289
287 Ga0207689_10000587 3300025942 Bacteria 34686
288 Ga0207689_10090418 3300025942 Bacteria 2515
289 Ga0207661_10003207 3300025944 Bacteria 11336
290 Ga0207661_10068627 3300025944 Bacteria 2888
291 Ga0207679_10000104 3300025945 Bacteria 69451
292 Ga0207679_10088013 3300025945 Bacteria 2393
293 Ga0207667_10003355 3300025949 Bacteria 19758
294 Ga0207667_10016131 3300025949 Bacteria 8449
295 Ga0207667_10070135 3300025949 Bacteria 3648
296 Ga0207667_10088222 3300025949 Bacteria 3208
297 Ga0207667_10091535 3300025949 Bacteria 3141
298 Ga0207667_10159229 3300025949 Unclassified 2323
299 Ga0207668_10007033 3300025972 Bacteria 6676
300 Ga0207640_10128622 3300025981 Unclassified 1827
301 Ga0207703_10025046 3300026035 Bacteria 4693
302 Ga0207639_10027172 3300026041 Bacteria 4165
303 Ga0207639_10140369 3300026041 Bacteria 2012
304 Ga0207678_10000534 3300026067 Bacteria 34691
305 Ga0207678_10086930 3300026067 Bacteria 2671
306 Ga0207678_10093020 3300026067 Bacteria 2576
307 Ga0207708_10000037 3300026075 Bacteria 137489
308 Ga0207708_10027680 3300026075 Bacteria 4293
309 Ga0207708_10029201 3300026075 Bacteria 4178
310 Ga0207702_10034324 3300026078 Bacteria 4240
311 Ga0207702_10086363 3300026078 Bacteria 2736
312 Ga0207702_10154556 3300026078 Bacteria 2090
313 Ga0207702_10221171 3300026078 Bacteria 1764
314 Ga0207641_10000379 3300026088 Bacteria 53006
315 Ga0207641_10055527 3300026088 Bacteria 3363
316 Ga0207641_10125561 3300026088 Bacteria 2297
317 Ga0207641_10154627 3300026088 Bacteria 2080
318 Ga0207648_10000951 3300026089 Bacteria 32773
319 Ga0207648_10058577 3300026089 Bacteria 3359
320 Ga0207676_10000076 3300026095 Bacteria 98185
321 Ga0207674_10000117 3300026116 Bacteria 92896
322 Ga0207674_10000212 3300026116 Bacteria 71941
323 Ga0207674_10014036 3300026116 Bacteria 8852
324 Ga0207674_10042220 3300026116 Bacteria 4712
325 Ga0207675_100004940 3300026118 Bacteria 12849
326 Ga0207683_10000234 3300026121 Bacteria 49310
327 Ga0207698_10024727 3300026142 Bacteria 4221
328 Ga0209974_10042398 3300027876 Bacteria 1515
329 Ga0268266_10003436 3300028379 Bacteria 15814
330 Ga0268266_10003556 3300028379 Bacteria 15449
331 Ga0268266_10016096 3300028379 Bacteria 6393
332 Ga0268266_10060905 3300028379 Bacteria 3254
333 Ga0268265_10006405 3300028380 Bacteria 7979
334 Ga0265338_10047144 3300028800 Unclassified 3940
335 Ga0265760_10004368 3300031090 Bacteria 4061
336 Ga0265760_10006076 3300031090 Unclassified 3449
337 Ga0265760_10020649 3300031090 Bacteria 1902
338 Ga0265330_10000285 3300031235 Bacteria 37301
339 Ga0265328_10007264 3300031239 Bacteria 4630
340 Ga0265320_10000017 3300031240 Bacteria 196688
341 Ga0265329_10002375 3300031242 Bacteria 8553
342 Ga0265331_10000027 3300031250 Bacteria 220058
343 Ga0265331_10008851 3300031250 Bacteria 5697
344 Ga0265316_10021489 3300031344 Bacteria 5464
345 Ga0265316_10116718 3300031344 Unclassified 2018
346 Ga0265313_10003215 3300031595 Bacteria 13429
347 Ga0265314_10000333 3300031711 Bacteria 66259
348 Ga0265314_10003579 3300031711 Bacteria 14961
349 Ga0265342_10009943 3300031712 Bacteria 6651
350 Ga0265342_10026027 3300031712 Bacteria 3671
351 Ga0307406_10000239 3300031901 Bacteria 33330
352 Ga0307409_100139923 3300031995 Unclassified 2084
353 Ga0307510_10014867 3300033180 Bacteria 9210
354 Ga0307510_10058103 3300033180 Bacteria 4009
355 Ga0373950_0000049 3300034818 Bacteria 87604
356 Ga0373926_0024201 3300035083 Bacteria 2113
357 Ga0373943_0010164 3300035170 Bacteria 4220
358 Ga0373927_0002732 3300035695 Bacteria 12872
359 Ga0373927_0005803 3300035695 Bacteria 8471
360 Ga0373947_0000184 3300035725 Bacteria 34389
361 Ga0373947_0104055 3300035725 Bacteria 1787
362 Ga0373925_0013356 3300037068 Bacteria 5943
363 Ga0373925_0028059 3300037068 Unclassified 4123
364 Ga0373925_0054405 3300037068 Bacteria 2994
365 Ga0436364_0754288 3300037853 Bacteria 21981
366 Ga0436365_0512862 3300039437 Unclassified 1491
367 Ga0436361_0315071 3300039447 Unclassified 1725
368 Ga0436363_1143068 3300039450 Bacteria 3224
369 Ga0436363_1464423 3300039450 Bacteria 1821
370 Ga0436362_0032241 3300039453 Bacteria 2425
371 Ga0436362_0443420 3300039453 Plasmid 3745
372 Ga0439458_0003801 3300042157 Unclassified 3493
373 Ga0453683_0061877 3300044673 Bacteria 2340
374 Ga0466963_0058375 3300044694 Unclassified 2572
375 Ga0466963_0166010 3300044694 Bacteria 1538
376 Ga0453684_0002240 3300044712 Bacteria 47976
377 Ga0451576_0101132 3300045051 Bacteria 2998
378 Ga0451576_0316352 3300045051 Bacteria 1633
379 Ga0466967_0001263 3300045976 Bacteria 14323
380 Ga0466967_0003475 3300045976 Bacteria 10291
381 Ga0495592_0043321 3300046454 Bacteria 3367
382 Ga0495603_0004785 3300046455 Bacteria 8087
383 Ga0495603_0017196 3300046455 Bacteria 4377
384 Ga0495629_0001676 3300046459 Bacteria 17401
385 Ga0495629_0004906 3300046459 Bacteria 10042
386 Ga0495629_0020322 3300046459 Bacteria 4742
387 Ga0495651_0006224 3300046462 Bacteria 9124
388 Ga0495651_0106459 3300046462 Bacteria 2078
389 Ga0495653_0003661 3300046463 Bacteria 12411
390 Ga0495650_0003916 3300046471 Bacteria 10507
391 Ga0495580_0004254 3300046472 Bacteria 12043
392 Ga0495580_0032732 3300046472 Bacteria 3749
393 Ga0495582_0000888 3300046473 Bacteria 16590
394 Ga0495582_0001413 3300046473 Bacteria 13528
395 Ga0495639_0000243 3300046475 Bacteria 27102
396 Ga0495639_0001470 3300046475 Bacteria 10535
397 Ga0495662_0000245 3300046476 Bacteria 23042
398 Ga0495662_0006702 3300046476 Bacteria 5739
399 Ga0495585_0002970 3300046492 Bacteria 11709
400 Ga0495594_0000618 3300046499 Bacteria 18272
401 Ga0495594_0005346 3300046499 Bacteria 6596
402 Ga0495618_0021006 3300046514 Bacteria 4022
403 Ga0495618_0110509 3300046514 Bacteria 1760
404 Ga0495628_0161915 3300046516 Bacteria 1700
405 Ga0495630_0019264 3300046517 Bacteria 5015
406 Ga0495630_0043873 3300046517 Bacteria 3341
407 Ga0495644_0000011 3300046523 Bacteria 97543
408 Ga0495666_0001001 3300046526 Bacteria 13398
409 Ga0495652_0009398 3300046529 Bacteria 8887
410 Ga0495665_0000121 3300046531 Bacteria 37260
411 Ga0495665_0001532 3300046531 Bacteria 12315
412 Ga0495640_0029056 3300046533 Bacteria 3973
413 Ga0495640_0076089 3300046533 Bacteria 2240
414 Ga0495586_0004122 3300046535 Bacteria 7787
415 Ga0495645_0000983 3300046543 Bacteria 19437
416 Ga0495645_0046510 3300046543 Bacteria 3162
417 Ga0495667_0001062 3300046559 Bacteria 17862
418 Ga0495667_0036161 3300046559 Bacteria 3297
419 Ga0495667_0102228 3300046559 Bacteria 1853
420 Ga0495634_0002938 3300046642 Bacteria 13928
421 Ga0495625_0002024 3300046660 Bacteria 22832
422 Ga0495625_0043055 3300046660 Bacteria 3277
423 Ga0495625_0055909 3300046660 Bacteria 2812
424 Ga0495635_0008501 3300046663 Bacteria 7171
425 Ga0495588_0001869 3300046674 Bacteria 8979
426 Ga0495599_0006132 3300046678 Bacteria 7239
427 Ga0495599_0025670 3300046678 Bacteria 3689
428 Ga0495623_0022536 3300046679 Bacteria 4069
429 Ga0495646_0045016 3300046680 Bacteria 2697
430 Ga0495658_0000154 3300046683 Bacteria 38312
431 Ga0495669_0013588 3300046684 Bacteria 3472
432 Ga0495613_0001047 3300046689 Bacteria 21087
433 Ga0495613_0066588 3300046689 Bacteria 2630
434 Ga0495600_0006197 3300046809 Bacteria 7253
435 Ga0495600_0023571 3300046809 Bacteria 3960
436 Ga0495600_0069919 3300046809 Bacteria 2294
437 Ga0495581_0000690 3300047315 Bacteria 17725
438 Ga0495581_0004845 3300047315 Bacteria 7784
439 Ga0495604_0001906 3300047317 Bacteria 16900
440 Ga0495604_0028176 3300047317 Bacteria 4467
441 Ga0495604_0093058 3300047317 Bacteria 2231
442 Ga0495674_0041300 3300047319 Bacteria 4121
443 Ga0495674_0065125 3300047319 Bacteria 3166
444 Ga0495674_0076013 3300047319 Bacteria 2889
445 Ga0495672_0078481 3300047320 Bacteria 1847
446 Ga0495676_0016871 3300047321 Bacteria 6465
447 Ga0495680_0010879 3300047322 Bacteria 8089
448 Ga0495680_0023393 3300047322 Bacteria 5138
449 Ga0495680_0066793 3300047322 Bacteria 2751
450 Ga0495680_0190018 3300047322 Bacteria 1478
451 Ga0495675_0001681 3300047444 Bacteria 13284
452 Ga0495673_0035218 3300047469 Bacteria 2309
453 Ga0495684_0004940 3300047471 Bacteria 10412
454 Ga0495686_0008572 3300047472 Bacteria 7488
455 Ga0495686_0014055 3300047472 Bacteria 5528
456 Ga0495593_0002435 3300047673 Bacteria 11187
457 Ga0495614_0000006 3300048089 Bacteria 71718
458 Ga0495614_0000387 3300048089 Bacteria 17860
459 Ga0495614_0010605 3300048089 Bacteria 4062
460 Ga0496100_0006431 3300048903 Bacteria 6406
461 Ga0496101_0032132 3300048904 Bacteria 3693
462 Ga0496102_0002047 3300048905 Bacteria 17400
463 Ga0496104_0012449 3300048907 Bacteria 7650
464 Ga0496104_0041491 3300048907 Bacteria 4315
465 Ga0496105_0055454 3300048908 Bacteria 3272
466 Ga0496106_0017100 3300048909 Bacteria 5368
467 Ga0496108_0012181 3300048911 Bacteria 6993
468 Ga0496108_0123815 3300048911 Bacteria 2219
469 Ga0496108_0155613 3300048911 Bacteria 1974
470 Ga0496109_0000143 3300048912 Bacteria 71725
471 Ga0496109_0043579 3300048912 Bacteria 4067
472 Ga0496110_0001992 3300048913 Bacteria 15186
473 Ga0496110_0040466 3300048913 Bacteria 4062
474 Ga0496110_0042286 3300048913 Bacteria 3978
475 Ga0496111_0066680 3300048914 Bacteria 2614
476 Ga0496112_0000073 3300048915 Bacteria 66054
477 Ga0496112_0012318 3300048915 Bacteria 7855
478 Ga0496112_0048971 3300048915 Bacteria 4141
479 Ga0496112_0068496 3300048915 Bacteria 3504
480 Ga0496113_0000912 3300048916 Bacteria 15615
481 Ga0496114_0001738 3300048917 Bacteria 16532
482 Ga0496114_0112551 3300048917 Bacteria 2333
483 Ga0496115_0029655 3300048918 Bacteria 4298
484 Ga0496126_0000091 3300048929 Bacteria 209427
485 Ga0496126_0000303 3300048929 Bacteria 104690
486 Ga0501032_0003099 3300049569 Bacteria 12819
487 Ga0501033_0006063 3300049570 Bacteria 9479
488 Ga0501033_0049791 3300049570 Bacteria 3110
489 Ga0501034_0000354 3300049571 Bacteria 78713
490 Ga0501034_0002515 3300049571 Bacteria 21990
491 Ga0501034_0027051 3300049571 Bacteria 5835
492 Ga0501036_0009092 3300049572 Bacteria 8173
493 Ga0501036_0043694 3300049572 Bacteria 3795
494 Ga0501037_0019407 3300049573 Bacteria 5015
495 Ga0501037_0107359 3300049573 Bacteria 2011
496 Ga0501038_0002342 3300049574 Bacteria 17660
497 Ga0501038_0002733 3300049574 Bacteria 16441
498 Ga0501039_0004077 3300049575 Bacteria 10987
499 Ga0501040_0001818 3300049576 Bacteria 13720
500 Ga0501041_0000775 3300049577 Bacteria 17140
501 Ga0501042_0000226 3300049578 Bacteria 27005
502 Ga0501043_0000343 3300049579 Bacteria 42161
503 Ga0501043_0006298 3300049579 Bacteria 9530
504 Ga0501043_0041390 3300049579 Bacteria 3620
505 Ga0501046_0000199 3300049580 Bacteria 62001
506 Ga0501046_0025399 3300049580 Bacteria 4849
507 Ga0501047_0000831 3300049581 Bacteria 31839
508 Ga0501047_0008731 3300049581 Bacteria 9563
509 Ga0501048_0001341 3300049582 Bacteria 18664
510 Ga0501048_0012770 3300049582 Bacteria 6244
511 Ga0501067_0005521 3300049583 Bacteria 7009
512 Ga0501068_0007699 3300049584 Bacteria 5960
513 Ga0501068_0025928 3300049584 Bacteria 3450
514 Ga0501068_0049064 3300049584 Bacteria 2549
515 Ga0501070_0003090 3300049586 Bacteria 14500
516 Ga0501072_0000019 3300049588 Bacteria 158156
517 Ga0501072_0000274 3300049588 Bacteria 37244
518 Ga0501073_0000437 3300049589 Bacteria 28708
519 Ga0501073_0014901 3300049589 Bacteria 5641
520 Ga0501075_0000535 3300049591 Bacteria 23011
521 Ga0501076_0001328 3300049592 Bacteria 16522
522 Ga0501077_0013191 3300049593 Bacteria 5178
523 Ga0501235_009109 3300049669 Unclassified 2168
524 Ga0501079_0000958 3300049741 Bacteria 19916
525 Ga0501079_0010562 3300049741 Bacteria 7022
526 Ga0501080_0008623 3300049742 Bacteria 9250
527 Ga0501080_0052258 3300049742 Bacteria 3803
528 Ga0501080_0058375 3300049742 Bacteria 3592
529 Ga0501083_0036257 3300049744 Bacteria 3364
530 Ga0501083_0090677 3300049744 Bacteria 2019
531 Ga0501035_0006934 3300049822 Bacteria 10582
532 Ga0501035_0089438 3300049822 Bacteria 2712
533 Ga0501045_0122292 3300049824 Bacteria 1932
534 nmdc:mga05p37_350944_c1 3300050507 Bacteria 1737
535 nmdc:mga05p37_756_c1 3300050507 Bacteria 35847
536 nmdc:mga0qj67_242548_c1 3300050509 Bacteria 1462
537 nmdc:mga06r32_5566_c1 3300050510 Bacteria 11346
538 nmdc:mga08y16_119562_c1 3300050511 Bacteria 2742
539 nmdc:mga08y16_4201_c2 3300050511 Bacteria 7317
540 nmdc:mga08y16_43953_c1 3300050511 Bacteria 4681
541 nmdc:mga0n895_188552_c1 3300050512 Bacteria 2093
542 nmdc:mga0n895_2350_c1 3300050512 Bacteria 14746
543 nmdc:mga0n895_360150_c1 3300050512 Bacteria 1473
544 nmdc:mga0n895_425_c1 3300050512 Bacteria 28339
545 nmdc:mga0n895_48765_c1 3300050512 Bacteria 4147
546 nmdc:mga0n895_7721_c1 3300050512 Bacteria 9259
547 nmdc:mga0n895_87670_c1 3300050512 Unclassified 3110
548 nmdc:mga0rr50_33554_c1 3300050513 Bacteria 3668
549 nmdc:mga0rr50_79345_c1 3300050513 Bacteria 2528
550 nmdc:mga08x19_21438_c1 3300050514 Bacteria 3988
551 nmdc:mga08x19_23903_c1 3300050514 Bacteria 3793
552 nmdc:mga08x19_3585_c1 3300050514 Bacteria 9235
553 nmdc:mga0a205_100968_c1 3300050515 Bacteria 2784
554 nmdc:mga0a205_143172_c1 3300050515 Bacteria 2291
555 nmdc:mga0a205_15590_c1 3300050515 Bacteria 7102
556 nmdc:mga0a205_65850_c1 3300050515 Bacteria 3501
557 nmdc:mga0a205_68175_c1 3300050515 Bacteria 3436
558 nmdc:mga0a205_85_c1 3300050515 Bacteria 51430
559 Ga0500595_000025 3300053119 Bacteria 142073
560 Ga0501084_0000075 3300054114 Bacteria 72001
561 Ga0501084_0019157 3300054114 Bacteria 5700
562 Ga0501082_0004536 3300060353 Bacteria 12120
563 Ga0501082_0012106 3300060353 Bacteria 7412
564 2884218652 2884215851 Bacteria 4554841
565 Ga0105240_10000284
566 JGI24034J26672_10000857
567 rootH2_10013843
568 Ga0065714_10002198
569 Ga0065712_10000119
570 Ga0065715_10103851
571 Ga0070658_10002172
572 Ga0070658_10008674
573 Ga0070658_10142755
574 Ga0070676_10037210
575 Ga0070683_100003057
576 Ga0070683_100006648
577 Ga0070683_100169603
578 Ga0070690_100013227
579 Ga0070670_100009899
580 Ga0068869_100056310
581 Ga0070682_100029087
582 Ga0070660_100001529
583 Ga0070689_100012336
584 Ga0070669_100006840
585 Ga0070675_100007202
586 Ga0070675_100205765
587 Ga0070671_100068083
588 Ga0070674_100002349
589 Ga0070659_100007853
590 Ga0070714_100036640
591 Ga0070714_100198228
592 Ga0070713_100087287
593 Ga0070705_100060608
594 Ga0070700_100000118
595 Ga0070681_10001350
596 Ga0070681_10009586
597 Ga0070681_10017112
598 Ga0070681_10061348
599 Ga0070681_10085992
600 Ga0070681_10090048
601 Ga0068867_100046707
602 Ga0068867_100107187
603 Ga0070706_100000224
604 Ga0070706_100165801
605 Ga0070679_100001545
606 Ga0070679_100014432
607 Ga0070679_100091764
608 Ga0070684_100003621
609 Ga0068853_100004114
610 Ga0068853_100044186
611 Ga0070672_100020661
612 Ga0070686_100008785
613 Ga0070696_100040468
614 Ga0070696_100043966
615 Ga0070693_100002343
616 Ga0070693_100012268
617 Ga0070693_100022474
618 Ga0070665_100010655
619 Ga0070665_100011082
620 Ga0068855_100009162
621 Ga0068855_100013949
622 Ga0068855_100028702
623 Ga0068855_100028988
624 Ga0068855_100104471
625 Ga0068855_100109588
626 Ga0068855_100146237
627 Ga0070664_100000536
628 Ga0070664_100004114
629 Ga0070664_100042730
630 Ga0070664_100231187
631 Ga0068857_100000402
632 Ga0068857_100000904
633 Ga0068857_100008378
634 Ga0068854_100031069
635 Ga0068854_100035864
636 Ga0068854_100117942
637 Ga0068856_100031151
638 Ga0068856_100105968
639 Ga0068856_100114694
640 Ga0068856_100216780
641 Ga0068852_100045795
642 Ga0068852_100168279
643 Ga0068859_100009967
644 Ga0068859_100012408
645 Ga0068859_100054155
646 Ga0068859_100200298
647 Ga0068864_100004199
648 Ga0068866_10001945
649 Ga0068866_10024931
650 Ga0068861_100020449
651 Ga0068851_10008693
652 Ga0068870_10000502
653 Ga0068863_100159621
654 Ga0068863_100173773
655 Ga0068863_100216382
656 Ga0068863_100358192
657 Ga0068860_100211924
658 Ga0068862_100003038
659 Ga0081538_10001078
660 Ga0081538_10032979
661 Ga0081538_10037385
662 Ga0081540_1054647
663 Ga0070717_10048495
664 Ga0070717_10054703
665 Ga0070717_10094335
666 Ga0097621_100000867
667 Ga0097621_100166384
668 Ga0068871_100001599
669 Ga0068871_100073098
670 Ga0075428_100002015
671 Ga0075428_100194832
672 Ga0075428_100225829
673 Ga0075431_100004327
674 Ga0075431_100007822
675 Ga0075431_100233862
676 Ga0075433_10014857
677 Ga0075433_10044156
678 Ga0075433_10045519
679 Ga0075433_10163768
680 Ga0075434_100000227
681 Ga0075434_100007020
682 Ga0075434_100072113
683 Ga0075434_100293332
684 Ga0068865_100002777
685 Ga0068865_100015535
686 Ga0075436_100002003
687 Ga0075436_100008474
688 Ga0075436_100020044
689 Ga0097620_100009968
690 Ga0097620_100012408
691 Ga0097620_100054156
692 Ga0097620_100200295
693 Ga0075435_100000939
694 Ga0075435_100065292
695 Ga0075435_100103383
696 Ga0105251_10040677
697 Ga0105250_10044942
698 Ga0105240_10006746
699 Ga0105240_10007610
700 Ga0105240_10032270
701 Ga0111539_10025658
702 Ga0111539_10443862
703 Ga0105245_10027706
704 Ga0105245_10033524
705 Ga0105245_10036628
706 Ga0105245_10072371
707 Ga0114129_10009218
708 Ga0114129_10021299
709 Ga0114129_10021417
710 Ga0114129_10042086
711 Ga0114129_10061388
712 Ga0114129_10081335
713 Ga0114129_10123161
714 Ga0114129_10388586
715 Ga0114129_10400625
716 Ga0105241_10000072
717 Ga0105241_10003893
718 Ga0105241_10012188
719 Ga0105241_10016897
720 Ga0105241_10054622
721 Ga0105241_10060959
722 Ga0105242_10012597
723 Ga0105242_10019686
724 Ga0105242_10077603
725 Ga0105248_10001564
726 Ga0105248_10012835
727 Ga0105248_10014439
728 Ga0105248_10040326
729 Ga0105248_10104965
730 Ga0105237_10002126
731 Ga0105237_10097988
732 Ga0105238_10000338
733 Ga0105238_10003922
734 Ga0105238_10142979
735 Ga0105249_10027115
736 Ga0105239_10000334
737 Ga0105239_10016059
738 Ga0105239_10055705
739 Ga0105239_10174773
740 Ga0157373_10004452
741 Ga0157373_10020916
742 Ga0157373_10029100
743 Ga0157371_10022412
744 Ga0157370_10004867
745 Ga0157370_10037234
746 Ga0157370_10049926
747 Ga0157370_10064312
748 Ga0157369_10001807
749 Ga0157369_10002755
750 Ga0157369_10011210
751 Ga0157369_10012962
752 Ga0157369_10048721
753 Ga0157369_10054950
754 Ga0157369_10098585
755 Ga0157374_10001976
756 Ga0157374_10046456
757 Ga0157374_10069244
758 Ga0157374_10141446
759 Ga0157378_10000086
760 Ga0157378_10006664
761 Ga0157378_10008592
762 Ga0163162_10000176
763 Ga0163162_10013002
764 Ga0163162_10047698
765 Ga0163162_10064045
766 Ga0157372_10017636
767 Ga0157372_10019316
768 Ga0157372_10046461
769 Ga0157372_10106807
770 Ga0157372_10277827
771 Ga0157375_10002269
772 Ga0157375_10027969
773 Ga0157375_10099210
774 Ga0157375_10123016
775 Ga0163163_10010546
776 Ga0163163_10021871
777 Ga0163163_10140317
778 Ga0157377_10015615
779 Ga0157379_10003452
780 Ga0157379_10033199
781 Ga0157379_10071185
782 Ga0157376_10006248
783 Ga0157376_10108416
784 Ga0157376_10180976
785 Ga0157376_10198843
786 Ga0182007_10015852
787 Ga0163161_10001674
788 Ga0207697_10008185
789 Ga0207642_10005751
790 Ga0207642_10057015
791 Ga0207688_10005120
792 Ga0207680_10012354
793 Ga0207680_10027687
794 Ga0207647_10003019
795 Ga0207647_10004011
796 Ga0207645_10000490
797 Ga0207643_10000448
798 Ga0207705_10006576
799 Ga0207705_10009690
800 Ga0207705_10054845
801 Ga0207684_10000310
802 Ga0207654_10000013
803 Ga0207654_10057427
804 Ga0207707_10001817
805 Ga0207707_10008082
806 Ga0207707_10041962
807 Ga0207707_10123393
808 Ga0207707_10233892
809 Ga0207695_10000098
810 Ga0207695_10002494
811 Ga0207695_10003668
812 Ga0207695_10023367
813 Ga0207695_10075842
814 Ga0207693_10061769
815 Ga0207663_10003331
816 Ga0207662_10005145
817 Ga0207657_10000400
818 Ga0207657_10001063
819 Ga0207657_10002846
820 Ga0207657_10072282
821 Ga0207649_10000398
822 Ga0207649_10008686
823 Ga0207652_10003175
824 Ga0207652_10014490
825 Ga0207652_10031338
826 Ga0207652_10049117
827 Ga0207652_10091279
828 Ga0207652_10110120
829 Ga0207694_10000105
830 Ga0207694_10003745
831 Ga0207694_10054448
832 Ga0207650_10000121
833 Ga0207650_10030044
834 Ga0207650_10178007
835 Ga0207659_10022989
836 Ga0207687_10021627
837 Ga0207687_10048088
838 Ga0207664_10013814
839 Ga0207664_10042353
840 Ga0207664_10062056
841 Ga0207644_10059827
842 Ga0207690_10016322
843 Ga0207706_10000896
844 Ga0207706_10006465
845 Ga0207706_10041160
846 Ga0207670_10003632
847 Ga0207691_10002248
848 Ga0207691_10013851
849 Ga0207711_10011345
850 Ga0207711_10126188
851 Ga0207689_10000587
852 Ga0207689_10090418
853 Ga0207661_10003207
854 Ga0207661_10068627
855 Ga0207679_10000104
856 Ga0207679_10088013
857 Ga0207667_10003355
858 Ga0207667_10016131
859 Ga0207667_10070135
860 Ga0207667_10088222
861 Ga0207667_10091535
862 Ga0207667_10159229
863 Ga0207668_10007033
864 Ga0207640_10128622
865 Ga0207703_10025046
866 Ga0207639_10027172
867 Ga0207639_10140369
868 Ga0207678_10000534
869 Ga0207678_10086930
870 Ga0207678_10093020
871 Ga0207708_10000037
872 Ga0207708_10027680
873 Ga0207708_10029201
874 Ga0207702_10034324
875 Ga0207702_10086363
876 Ga0207702_10154556
877 Ga0207702_10221171
878 Ga0207641_10000379
879 Ga0207641_10055527
880 Ga0207641_10125561
881 Ga0207641_10154627
882 Ga0207648_10000951
883 Ga0207648_10058577
884 Ga0207676_10000076
885 Ga0207674_10000117
886 Ga0207674_10000212
887 Ga0207674_10014036
888 Ga0207674_10042220
889 Ga0207675_100004940
890 Ga0207683_10000234
891 Ga0207698_10024727
892 Ga0209974_10042398
893 Ga0268266_10003436
894 Ga0268266_10003556
895 Ga0268266_10016096
896 Ga0268266_10060905
897 Ga0268265_10006405
898 Ga0265338_10047144
899 Ga0265760_10004368
900 Ga0265760_10006076
901 Ga0265760_10020649
902 Ga0265330_10000285
903 Ga0265328_10007264
904 Ga0265320_10000017
905 Ga0265329_10002375
906 Ga0265331_10000027
907 Ga0265331_10008851
908 Ga0265316_10021489
909 Ga0265316_10116718
910 Ga0265313_10003215
911 Ga0265314_10000333
912 Ga0265314_10003579
913 Ga0265342_10009943
914 Ga0265342_10026027
915 Ga0307406_10000239
916 Ga0307409_100139923
917 Ga0307510_10014867
918 Ga0307510_10058103
919 Ga0373950_0000049
920 Ga0373926_0024201
921 Ga0373943_0010164
922 Ga0373927_0002732
923 Ga0373927_0005803
924 Ga0373947_0000184
925 Ga0373947_0104055
926 Ga0373925_0013356
927 Ga0373925_0028059
928 Ga0373925_0054405
929 Ga0436364_0754288
930 Ga0436365_0512862
931 Ga0436361_0315071
932 Ga0436363_1143068
933 Ga0436363_1464423
934 Ga0436362_0032241
935 Ga0436362_0443420
936 Ga0439458_0003801
937 Ga0453683_0061877
938 Ga0466963_0058375
939 Ga0466963_0166010
940 Ga0453684_0002240
941 Ga0451576_0101132
942 Ga0451576_0316352
943 Ga0466967_0001263
944 Ga0466967_0003475
945 Ga0495592_0043321
946 Ga0495603_0004785
947 Ga0495603_0017196
948 Ga0495629_0001676
949 Ga0495629_0004906
950 Ga0495629_0020322
951 Ga0495651_0006224
952 Ga0495651_0106459
953 Ga0495653_0003661
954 Ga0495650_0003916
955 Ga0495580_0004254
956 Ga0495580_0032732
957 Ga0495582_0000888
958 Ga0495582_0001413
959 Ga0495639_0000243
960 Ga0495639_0001470
961 Ga0495662_0000245
962 Ga0495662_0006702
963 Ga0495585_0002970
964 Ga0495594_0000618
965 Ga0495594_0005346
966 Ga0495618_0021006
967 Ga0495618_0110509
968 Ga0495628_0161915
969 Ga0495630_0019264
970 Ga0495630_0043873
971 Ga0495644_0000011
972 Ga0495666_0001001
973 Ga0495652_0009398
974 Ga0495665_0000121
975 Ga0495665_0001532
976 Ga0495640_0029056
977 Ga0495640_0076089
978 Ga0495586_0004122
979 Ga0495645_0000983
980 Ga0495645_0046510
981 Ga0495667_0001062
982 Ga0495667_0036161
983 Ga0495667_0102228
984 Ga0495634_0002938
985 Ga0495625_0002024
986 Ga0495625_0043055
987 Ga0495625_0055909
988 Ga0495635_0008501
989 Ga0495588_0001869
990 Ga0495599_0006132
991 Ga0495599_0025670
992 Ga0495623_0022536
993 Ga0495646_0045016
994 Ga0495658_0000154
995 Ga0495669_0013588
996 Ga0495613_0001047
997 Ga0495613_0066588
998 Ga0495600_0006197
999 Ga0495600_0023571
1000 Ga0495600_0069919
1001 Ga0495581_0000690
1002 Ga0495581_0004845
1003 Ga0495604_0001906
1004 Ga0495604_0028176
1005 Ga0495604_0093058
1006 Ga0495674_0041300
1007 Ga0495674_0065125
1008 Ga0495674_0076013
1009 Ga0495672_0078481
1010 Ga0495676_0016871
1011 Ga0495680_0010879
1012 Ga0495680_0023393
1013 Ga0495680_0066793
1014 Ga0495680_0190018
1015 Ga0495675_0001681
1016 Ga0495673_0035218
1017 Ga0495684_0004940
1018 Ga0495686_0008572
1019 Ga0495686_0014055
1020 Ga0495593_0002435
1021 Ga0495614_0000006
1022 Ga0495614_0000387
1023 Ga0495614_0010605
1024 Ga0496100_0006431
1025 Ga0496101_0032132
1026 Ga0496102_0002047
1027 Ga0496104_0012449
1028 Ga0496104_0041491
1029 Ga0496105_0055454
1030 Ga0496106_0017100
1031 Ga0496108_0012181
1032 Ga0496108_0123815
1033 Ga0496108_0155613
1034 Ga0496109_0000143
1035 Ga0496109_0043579
1036 Ga0496110_0001992
1037 Ga0496110_0040466
1038 Ga0496110_0042286
1039 Ga0496111_0066680
1040 Ga0496112_0000073
1041 Ga0496112_0012318
1042 Ga0496112_0048971
1043 Ga0496112_0068496
1044 Ga0496113_0000912
1045 Ga0496114_0001738
1046 Ga0496114_0112551
1047 Ga0496115_0029655
1048 Ga0496126_0000091
1049 Ga0496126_0000303
1050 Ga0501032_0003099
1051 Ga0501033_0006063
1052 Ga0501033_0049791
1053 Ga0501034_0000354
1054 Ga0501034_0002515
1055 Ga0501034_0027051
1056 Ga0501036_0009092
1057 Ga0501036_0043694
1058 Ga0501037_0019407
1059 Ga0501037_0107359
1060 Ga0501038_0002342
1061 Ga0501038_0002733
1062 Ga0501039_0004077
1063 Ga0501040_0001818
1064 Ga0501041_0000775
1065 Ga0501042_0000226
1066 Ga0501043_0000343
1067 Ga0501043_0006298
1068 Ga0501043_0041390
1069 Ga0501046_0000199
1070 Ga0501046_0025399
1071 Ga0501047_0000831
1072 Ga0501047_0008731
1073 Ga0501048_0001341
1074 Ga0501048_0012770
1075 Ga0501067_0005521
1076 Ga0501068_0007699
1077 Ga0501068_0025928
1078 Ga0501068_0049064
1079 Ga0501070_0003090
1080 Ga0501072_0000019
1081 Ga0501072_0000274
1082 Ga0501073_0000437
1083 Ga0501073_0014901
1084 Ga0501075_0000535
1085 Ga0501076_0001328
1086 Ga0501077_0013191
1087 Ga0501235_009109
1088 Ga0501079_0000958
1089 Ga0501079_0010562
1090 Ga0501080_0008623
1091 Ga0501080_0052258
1092 Ga0501080_0058375
1093 Ga0501083_0036257
1094 Ga0501083_0090677
1095 Ga0501035_0006934
1096 Ga0501035_0089438
1097 Ga0501045_0122292
1098 nmdc:mga05p37_350944_c1
1099 nmdc:mga05p37_756_c1
1100 nmdc:mga0qj67_242548_c1
1101 nmdc:mga06r32_5566_c1
1102 nmdc:mga08y16_119562_c1
1103 nmdc:mga08y16_4201_c2
1104 nmdc:mga08y16_43953_c1
1105 nmdc:mga0n895_188552_c1
1106 nmdc:mga0n895_2350_c1
1107 nmdc:mga0n895_360150_c1
1108 nmdc:mga0n895_425_c1
1109 nmdc:mga0n895_48765_c1
1110 nmdc:mga0n895_7721_c1
1111 nmdc:mga0n895_87670_c1
1112 nmdc:mga0rr50_33554_c1
1113 nmdc:mga0rr50_79345_c1
1114 nmdc:mga08x19_21438_c1
1115 nmdc:mga08x19_23903_c1
1116 nmdc:mga08x19_3585_c1
1117 nmdc:mga0a205_100968_c1
1118 nmdc:mga0a205_143172_c1
1119 nmdc:mga0a205_15590_c1
1120 nmdc:mga0a205_65850_c1
1121 nmdc:mga0a205_68175_c1
1122 nmdc:mga0a205_85_c1
1123 Ga0500595_000025
1124 Ga0501084_0000075
1125 Ga0501084_0019157
1126 Ga0501082_0004536
1127 Ga0501082_0012106
1128 2884218652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21686

LigD_Prim-Pol

LigD, primase-polymerase domain

34

284

0.97

PF01896

DNA_primase_S

DNA primase small subunit

129

257

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.9305 6 328
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.9296 1 294
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.9145 6 328
2far-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa ligd polymerase domain with datp and manganese 0.9058 17 300
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.9058 1 294
ID Description Score Start End Superfamily
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9786 25 301 3.90.920.10
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9726 25 301 3.90.920.10
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9582 25 301 3.90.920.10
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9491 25 301 3.90.920.10
af_P9WNV3_16_301_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9214 26 291 3.90.920.10
ID Description Score Start End GO Terms
AF-A0A535G9L7-F1-model_v4 DNA primase 0.9917 3 210
AF-A0A536HYM9-F1-model_v4 DNA polymerase domain-containing protein 0.9889 4 291
AF-A0A535IWF2-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.9878 37 184
AF-A0A2S8MCV2-F1-model_v4 deleted 0.9841 19 270
AF-A0A7V9L321-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.9839 1 229

Map