F464095

General Info

Members Datasets Scaffolds Average Seq Length
563 284 1126 153

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0088680|Ga0495602_0088680_1260_1796
Length 178
Sequence MFDTSLRASSGSLARLMVGEPRGGTLPPVVSLEPITQSNRDALDALRVSQAQRRFVSGVSESLRQAAEHPGARAIPWGVYADETPVGFVMIADEVDGPPYIAQYVWKLLIDERHQRKGYGTATLDLIVEYFRGRPGVEVIWTSAGQGEGSPIPFYERYGFEQTGEIQDGEVKLRLSII

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 14.03
Rhizosphere 85.44
Stem 0
Stem Tuber 0
Unclassified 10.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_0088680 3300048088 Bacteria 2574
2 JGI24743J22301_10053862 3300001991 Archaea 822
3 Ga0070676_10111172 3300005328 Bacteria 1706
4 Ga0070676_10146123 3300005328 Bacteria 1509
5 Ga0070690_100186079 3300005330 Archaea 1437
6 Ga0068869_100531550 3300005334 Unclassified 985
7 Ga0068869_100932320 3300005334 Bacteria 753
8 Ga0070680_100007777 3300005336 Bacteria 8170
9 Ga0070680_100234119 3300005336 Bacteria 1551
10 Ga0070680_100703023 3300005336 Bacteria 870
11 Ga0068868_100004965 3300005338 Bacteria 9340
12 Ga0068868_100047511 3300005338 Bacteria 3364
13 Ga0068868_100270612 3300005338 Bacteria 1435
14 Ga0070660_100028252 3300005339 Bacteria 4195
15 Ga0070660_100551209 3300005339 Unclassified 962
16 Ga0070689_100204156 3300005340 Bacteria 1615
17 Ga0070691_10736824 3300005341 Bacteria 595
18 Ga0070687_100103967 3300005343 Bacteria 1596
19 Ga0070692_10070967 3300005345 Bacteria 1855
20 Ga0070692_10296503 3300005345 Bacteria 986
21 Ga0070668_100192583 3300005347 Bacteria 1670
22 Ga0070675_100186508 3300005354 Bacteria 1795
23 Ga0070671_100066882 3300005355 Bacteria 2995
24 Ga0070671_100296157 3300005355 Bacteria 1377
25 Ga0070674_100009291 3300005356 Bacteria 5887
26 Ga0070673_100609605 3300005364 Bacteria 996
27 Ga0070688_100343911 3300005365 Bacteria 1090
28 Ga0070688_100560605 3300005365 Bacteria 870
29 Ga0070688_100740888 3300005365 Bacteria 764
30 Ga0070659_100022071 3300005366 Bacteria 4857
31 Ga0070659_100162972 3300005366 Bacteria 1824
32 Ga0070667_100459638 3300005367 Bacteria 1164
33 Ga0070714_100451134 3300005435 Bacteria 1222
34 Ga0070714_100463627 3300005435 Bacteria 1205
35 Ga0070713_100282604 3300005436 Bacteria 1523
36 Ga0070713_100305920 3300005436 Bacteria 1465
37 Ga0070713_101228236 3300005436 Bacteria 726
38 Ga0070710_10339193 3300005437 Bacteria 992
39 Ga0070711_100006543 3300005439 Bacteria 7028
40 Ga0070711_100141223 3300005439 Bacteria 1806
41 Ga0070711_100342575 3300005439 Bacteria 1200
42 Ga0070711_101336191 3300005439 Bacteria 622
43 Ga0070705_100011675 3300005440 Unclassified 4440
44 Ga0070705_100370582 3300005440 Bacteria 1051
45 Ga0070700_100086942 3300005441 Bacteria 2031
46 Ga0070700_100694965 3300005441 Bacteria 808
47 Ga0070694_100362569 3300005444 Unclassified 1126
48 Ga0070694_100520863 3300005444 Bacteria 948
49 Ga0070708_101470193 3300005445 Bacteria 635
50 Ga0070662_100065666 3300005457 Bacteria 2660
51 Ga0068867_100021970 3300005459 Unclassified 4557
52 Ga0068867_100095051 3300005459 Unclassified 2267
53 Ga0068867_100124009 3300005459 Bacteria 2000
54 Ga0068867_100137691 3300005459 Bacteria 1905
55 Ga0068867_100938235 3300005459 Bacteria 781
56 Ga0070685_10810909 3300005466 Bacteria 691
57 Ga0070707_100243648 3300005468 Bacteria 1750
58 Ga0070698_100046156 3300005471 Bacteria 4455
59 Ga0070699_100087792 3300005518 Bacteria 2715
60 Ga0070679_100174213 3300005530 Bacteria 2124
61 Ga0070679_100694858 3300005530 Unclassified 960
62 Ga0070679_101755497 3300005530 Unclassified 569
63 Ga0070684_100806332 3300005535 Unclassified 878
64 Ga0070697_100073548 3300005536 Bacteria 2807
65 Ga0068853_100592015 3300005539 Bacteria 1053
66 Ga0070686_100018078 3300005544 Bacteria 4131
67 Ga0070686_100019944 3300005544 Bacteria 3961
68 Ga0070695_100140794 3300005545 Unclassified 1672
69 Ga0070695_100176722 3300005545 Bacteria 1510
70 Ga0070695_100304204 3300005545 Bacteria 1180
71 Ga0070695_100384042 3300005545 Bacteria 1060
72 Ga0070696_100029484 3300005546 Unclassified 3751
73 Ga0070696_100225964 3300005546 Bacteria 1406
74 Ga0070696_101463901 3300005546 Bacteria 584
75 Ga0070693_100086016 3300005547 Bacteria 1885
76 Ga0070693_100108067 3300005547 Unclassified 1706
77 Ga0070665_100207501 3300005548 Bacteria 1960
78 Ga0070665_100519854 3300005548 Bacteria 1202
79 Ga0070704_100006227 3300005549 Archaea 7017
80 Ga0070704_100601344 3300005549 Bacteria 967
81 Ga0068855_100013143 3300005563 Bacteria 9985
82 Ga0068855_101778852 3300005563 Bacteria 627
83 Ga0068854_100089236 3300005578 Bacteria 2291
84 Ga0068854_100392956 3300005578 Bacteria 1146
85 Ga0068856_100012105 3300005614 Bacteria 8355
86 Ga0070702_100411292 3300005615 Bacteria 971
87 Ga0070702_100752969 3300005615 Bacteria 748
88 Ga0068852_100090529 3300005616 Bacteria 2736
89 Ga0068859_100597265 3300005617 Bacteria 1197
90 Ga0068859_100743186 3300005617 Bacteria 1070
91 Ga0068864_100013673 3300005618 Bacteria 6730
92 Ga0068864_100079473 3300005618 Bacteria 2871
93 Ga0068864_100263834 3300005618 Bacteria 1603
94 Ga0068866_10002765 3300005718 Archaea 7234
95 Ga0068866_10025706 3300005718 Bacteria 2771
96 Ga0068866_10050627 3300005718 Bacteria 2110
97 Ga0068861_101161046 3300005719 Unclassified 745
98 Ga0068870_10139758 3300005840 Bacteria 1416
99 Ga0068863_101332319 3300005841 Bacteria 725
100 Ga0068858_100027131 3300005842 Bacteria 5320
101 Ga0070717_10086248 3300006028 Bacteria 2642
102 Ga0070717_10173454 3300006028 Bacteria 1877
103 Ga0070715_10016512 3300006163 Bacteria 2775
104 Ga0070716_100489473 3300006173 Bacteria 905
105 Ga0070712_100202433 3300006175 Bacteria 1560
106 Ga0070712_100569157 3300006175 Bacteria 956
107 Ga0097621_100032617 3300006237 Bacteria 4142
108 Ga0097621_100176357 3300006237 Unclassified 1845
109 Ga0097621_100189844 3300006237 Bacteria 1779
110 Ga0068871_101183824 3300006358 Unclassified 716
111 Ga0075428_100166955 3300006844 Bacteria 2387
112 Ga0075428_100555834 3300006844 Unclassified 1227
113 Ga0075431_100401070 3300006847 Unclassified 1372
114 Ga0075431_100516026 3300006847 Bacteria 1185
115 Ga0075433_10723679 3300006852 Bacteria 871
116 Ga0075434_100001102 3300006871 Bacteria 22150
117 Ga0075434_101117951 3300006871 Unclassified 801
118 Ga0068865_100095749 3300006881 Bacteria 2164
119 Ga0068865_100288949 3300006881 Bacteria 1308
120 Ga0075436_100191024 3300006914 Bacteria 1449
121 Ga0097620_100597386 3300006931 Bacteria 1197
122 Ga0097620_100743135 3300006931 Bacteria 1070
123 Ga0075435_100010566 3300007076 Bacteria 6756
124 Ga0105240_10981348 3300009093 Bacteria 904
125 Ga0111539_10681535 3300009094 Unclassified 1197
126 Ga0111539_12277942 3300009094 Bacteria 628
127 Ga0105245_10029941 3300009098 Bacteria 4814
128 Ga0105245_10035096 3300009098 Bacteria 4450
129 Ga0105245_10039760 3300009098 Bacteria 4186
130 Ga0105245_10063461 3300009098 Bacteria 3335
131 Ga0105245_10090007 3300009098 Bacteria 2822
132 Ga0105245_10285154 3300009098 Bacteria 1616
133 Ga0105245_10352308 3300009098 Bacteria 1459
134 Ga0105245_10580292 3300009098 Bacteria 1146
135 Ga0105245_10823723 3300009098 Bacteria 967
136 Ga0105245_11304885 3300009098 Bacteria 775
137 Ga0105247_10027704 3300009101 Bacteria 3426
138 Ga0105247_10076646 3300009101 Bacteria 2100
139 Ga0105247_11083592 3300009101 Bacteria 631
140 Ga0114129_10360303 3300009147 Bacteria 1924
141 Ga0114129_11123757 3300009147 Bacteria 982
142 Ga0114129_11435025 3300009147 Bacteria 850
143 Ga0114129_12998466 3300009147 Bacteria 555
144 Ga0105243_10009735 3300009148 Bacteria 7321
145 Ga0105243_10037922 3300009148 Unclassified 3750
146 Ga0105243_10259600 3300009148 Bacteria 1555
147 Ga0105243_10331515 3300009148 Bacteria 1390
148 Ga0105243_10336361 3300009148 Bacteria 1381
149 Ga0105241_10311199 3300009174 Bacteria 1355
150 Ga0105242_10054819 3300009176 Unclassified 3260
151 Ga0105242_10139709 3300009176 Bacteria 2100
152 Ga0105242_10160126 3300009176 Unclassified 1969
153 Ga0105248_10003547 3300009177 Bacteria 17289
154 Ga0105237_10122323 3300009545 Bacteria 2596
155 Ga0105238_10015675 3300009551 Bacteria 7672
156 Ga0105238_10037202 3300009551 Bacteria 4949
157 Ga0105249_10016489 3300009553 Bacteria 6554
158 Ga0105249_10043101 3300009553 Bacteria 4105
159 Ga0105249_10185340 3300009553 Bacteria 2028
160 Ga0105249_10467199 3300009553 Unclassified 1303
161 Ga0105249_10474933 3300009553 Bacteria 1292
162 Ga0105249_12174605 3300009553 Bacteria 628
163 Ga0105239_10060040 3300010375 Bacteria 4173
164 Ga0105239_10994803 3300010375 Bacteria 964
165 Ga0105246_10019918 3300011119 Bacteria 4298
166 Ga0105246_10069732 3300011119 Bacteria 2470
167 Ga0105246_10215041 3300011119 Bacteria 1503
168 Ga0105246_10292184 3300011119 Bacteria 1312
169 Ga0105246_10452615 3300011119 Bacteria 1079
170 Ga0157369_10073178 3300013105 Bacteria 3677
171 Ga0157374_10024618 3300013296 Bacteria 5398
172 Ga0157374_11906591 3300013296 Unclassified 620
173 Ga0157378_10004504 3300013297 Bacteria 12227
174 Ga0157378_10011142 3300013297 Bacteria 7868
175 Ga0157378_10161813 3300013297 Unclassified 2094
176 Ga0163162_10136262 3300013306 Bacteria 2566
177 Ga0163162_10200287 3300013306 Bacteria 2125
178 Ga0163162_10486974 3300013306 Bacteria 1365
179 Ga0157372_10106793 3300013307 Bacteria 3203
180 Ga0157372_11786411 3300013307 Bacteria 707
181 Ga0157375_10004284 3300013308 Bacteria 12376
182 Ga0163163_10016482 3300014325 Bacteria 6871
183 Ga0163163_10072635 3300014325 Bacteria 3430
184 Ga0157380_10190619 3300014326 Bacteria 1809
185 Ga0157380_10409916 3300014326 Bacteria 1289
186 Ga0157377_10003811 3300014745 Bacteria 6851
187 Ga0157377_10017844 3300014745 Bacteria 3679
188 Ga0157377_10529110 3300014745 Bacteria 829
189 Ga0157379_10005516 3300014968 Bacteria 10870
190 Ga0157379_11154578 3300014968 Bacteria 743
191 Ga0157376_10006517 3300014969 Bacteria 8253
192 Ga0157376_10086890 3300014969 Bacteria 2697
193 Ga0157376_10124465 3300014969 Unclassified 2290
194 Ga0163161_11719002 3300017792 Bacteria 556
195 Ga0207692_10055291 3300025898 Bacteria 2031
196 Ga0207692_10121119 3300025898 Bacteria 1465
197 Ga0207642_10010952 3300025899 Plasmid 3218
198 Ga0207710_10137348 3300025900 Bacteria 1178
199 Ga0207710_10546377 3300025900 Bacteria 603
200 Ga0207688_10018738 3300025901 Bacteria 3764
201 Ga0207688_10019524 3300025901 Bacteria 3694
202 Ga0207688_10101528 3300025901 Bacteria 1662
203 Ga0207685_10000790 3300025905 Bacteria 5838
204 Ga0207645_10078300 3300025907 Bacteria 2118
205 Ga0207645_10080203 3300025907 Bacteria 2092
206 Ga0207643_10134782 3300025908 Bacteria 1472
207 Ga0207707_10852501 3300025912 Bacteria 756
208 Ga0207671_10093507 3300025914 Bacteria 2268
209 Ga0207693_10000939 3300025915 Bacteria 26161
210 Ga0207693_10294279 3300025915 Bacteria 1272
211 Ga0207693_10530556 3300025915 Bacteria 918
212 Ga0207663_10243472 3300025916 Bacteria 1320
213 Ga0207660_10078534 3300025917 Unclassified 2419
214 Ga0207662_10090864 3300025918 Bacteria 1878
215 Ga0207657_10032646 3300025919 Bacteria 4701
216 Ga0207652_10373657 3300025921 Bacteria 1287
217 Ga0207646_10077014 3300025922 Bacteria 2981
218 Ga0207694_10009556 3300025924 Bacteria 7316
219 Ga0207694_10047395 3300025924 Bacteria 3325
220 Ga0207650_10043907 3300025925 Bacteria 3284
221 Ga0207659_10021068 3300025926 Bacteria 4320
222 Ga0207687_10008602 3300025927 Bacteria 6675
223 Ga0207687_10015537 3300025927 Bacteria 4993
224 Ga0207687_10185048 3300025927 Bacteria 1616
225 Ga0207687_11077632 3300025927 Bacteria 690
226 Ga0207700_10305182 3300025928 Bacteria 1375
227 Ga0207644_10216240 3300025931 Bacteria 1517
228 Ga0207644_10258298 3300025931 Bacteria 1392
229 Ga0207690_10075790 3300025932 Bacteria 2334
230 Ga0207690_10176848 3300025932 Bacteria 1604
231 Ga0207690_11010510 3300025932 Archaea 692
232 Ga0207706_10058372 3300025933 Bacteria 3399
233 Ga0207706_10120396 3300025933 Bacteria 2308
234 Ga0207686_10108231 3300025934 Unclassified 1869
235 Ga0207686_10296630 3300025934 Bacteria 1199
236 Ga0207686_10303620 3300025934 Bacteria 1186
237 Ga0207709_10030420 3300025935 Bacteria 3141
238 Ga0207709_10037936 3300025935 Unclassified 2866
239 Ga0207709_10060958 3300025935 Bacteria 2355
240 Ga0207670_10204691 3300025936 Bacteria 1501
241 Ga0207669_10005015 3300025937 Bacteria 5888
242 Ga0207704_10014033 3300025938 Bacteria 4034
243 Ga0207665_10183853 3300025939 Bacteria 1515
244 Ga0207711_10030335 3300025941 Bacteria 4560
245 Ga0207689_10017931 3300025942 Bacteria 5979
246 Ga0207661_10172866 3300025944 Unclassified 1882
247 Ga0207679_10383276 3300025945 Bacteria 1233
248 Ga0207712_10039611 3300025961 Bacteria 3230
249 Ga0207712_10053768 3300025961 Bacteria 2826
250 Ga0207712_10215366 3300025961 Bacteria 1532
251 Ga0207668_10535578 3300025972 Bacteria 1012
252 Ga0207640_10120014 3300025981 Bacteria 1881
253 Ga0207640_10258189 3300025981 Bacteria 1356
254 Ga0207640_11094628 3300025981 Bacteria 705
255 Ga0207658_10746772 3300025986 Unclassified 886
256 Ga0207677_10013407 3300026023 Bacteria 4750
257 Ga0207677_10059851 3300026023 Bacteria 2629
258 Ga0207677_10477300 3300026023 Bacteria 1074
259 Ga0207703_10030182 3300026035 Bacteria 4283
260 Ga0207639_10562759 3300026041 Bacteria 1048
261 Ga0207708_10097665 3300026075 Bacteria 2270
262 Ga0207708_10228071 3300026075 Archaea 1494
263 Ga0207708_10335570 3300026075 Bacteria 1237
264 Ga0207708_10501097 3300026075 Unclassified 1018
265 Ga0207702_10018686 3300026078 Bacteria 5734
266 Ga0207641_10529278 3300026088 Bacteria 1147
267 Ga0207648_10003949 3300026089 Bacteria 15426
268 Ga0207648_10119140 3300026089 Bacteria 2320
269 Ga0207648_10193604 3300026089 Bacteria 1803
270 Ga0207676_10218113 3300026095 Bacteria 1697
271 Ga0207675_100186532 3300026118 Bacteria 1988
272 Ga0207683_10220308 3300026121 Bacteria 1729
273 Ga0207698_10077035 3300026142 Bacteria 2672
274 Ga0209974_10429875 3300027876 Bacteria 522
275 Ga0268266_11614744 3300028379 Bacteria 624
276 Ga0268264_10105281 3300028381 Bacteria 2460
277 Ga0265338_10140844 3300028800 Bacteria 1889
278 Ga0265327_10011646 3300031251 Bacteria 6030
279 Ga0307405_11755952 3300031731 Bacteria 551
280 Ga0307406_10301761 3300031901 Bacteria 1231
281 Ga0307409_100422660 3300031995 Bacteria 1279
282 Ga0373926_0041921 3300035083 Bacteria 1636
283 Ga0373944_0123453 3300035089 Bacteria 894
284 Ga0373949_0066021 3300035090 Bacteria 940
285 Ga0373936_0003480 3300035113 Bacteria 5915
286 Ga0373945_0007250 3300035116 Bacteria 3589
287 Ga0373945_0043222 3300035116 Bacteria 1634
288 Ga0373945_0135084 3300035116 Bacteria 991
289 Ga0373956_0419530 3300035119 Bacteria 639
290 Ga0373957_0090197 3300035120 Bacteria 1218
291 Ga0373943_0000638 3300035170 Bacteria 15156
292 Ga0373946_0079518 3300035171 Bacteria 1432
293 Ga0373955_0055736 3300035172 Bacteria 2166
294 Ga0373931_0094149 3300035691 Bacteria 1674
295 Ga0373931_0710760 3300035691 Archaea 664
296 Ga0373935_0028082 3300035692 Bacteria 3477
297 Ga0373935_0071238 3300035692 Bacteria 2242
298 Ga0373935_0241036 3300035692 Bacteria 1262
299 Ga0373927_0003943 3300035695 Bacteria 10514
300 Ga0373933_0018744 3300035724 Bacteria 3896
301 Ga0373947_0002543 3300035725 Bacteria 10958
302 Ga0373947_0006692 3300035725 Bacteria 6689
303 Ga0373925_0000824 3300037068 Bacteria 28544
304 Ga0373925_0006355 3300037068 Bacteria 8696
305 Ga0373925_0014782 3300037068 Bacteria 5642
306 Ga0373925_0428830 3300037068 Bacteria 1081
307 Ga0373925_0669441 3300037068 Bacteria 855
308 Ga0395899_0045758 3300037312 Bacteria 3260
309 Ga0395900_0187756 3300037418 Unclassified 2097
310 Ga0395900_0636533 3300037418 Bacteria 1004
311 Ga0395900_0852603 3300037418 Bacteria 836
312 Ga0395898_0241228 3300037466 Bacteria 1724
313 Ga0395898_0303633 3300037466 Unclassified 1522
314 Ga0395905_0405129 3300037471 Bacteria 1259
315 Ga0395901_0074107 3300038443 Bacteria 3551
316 Ga0242420_124488 3300038996 Bacteria 564
317 Ga0451800_0247682 3300041459 Bacteria 586
318 Ga0453683_0045465 3300044673 Bacteria 2753
319 Ga0495603_0134330 3300046455 Bacteria 1440
320 Ga0495629_0002277 3300046459 Bacteria 14789
321 Ga0495629_0025533 3300046459 Bacteria 4197
322 Ga0495641_0001651 3300046461 Bacteria 18717
323 Ga0495641_0019538 3300046461 Bacteria 3463
324 Ga0495641_0276097 3300046461 Bacteria 756
325 Ga0495651_0026997 3300046462 Bacteria 4470
326 Ga0495651_0187872 3300046462 Bacteria 1456
327 Ga0495582_0003778 3300046473 Bacteria 8535
328 Ga0495582_0008374 3300046473 Bacteria 5706
329 Ga0495582_0049656 3300046473 Bacteria 2310
330 Ga0495639_0000471 3300046475 Bacteria 19185
331 Ga0495639_0000758 3300046475 Bacteria 14732
332 Ga0495639_0064510 3300046475 Bacteria 1683
333 Ga0495662_0132521 3300046476 Bacteria 1225
334 Ga0495664_0331343 3300046477 Bacteria 917
335 Ga0495594_0181600 3300046499 Bacteria 1198
336 Ga0495594_0285003 3300046499 Bacteria 941
337 Ga0495596_0093134 3300046500 Bacteria 1170
338 Ga0495607_0303354 3300046501 Bacteria 751
339 Ga0495608_0009988 3300046511 Bacteria 6625
340 Ga0495618_0006475 3300046514 Bacteria 7109
341 Ga0495628_0884794 3300046516 Bacteria 621
342 Ga0495630_0000547 3300046517 Bacteria 27532
343 Ga0495630_0020963 3300046517 Bacteria 4824
344 Ga0495630_0419347 3300046517 Bacteria 1025
345 Ga0495666_0002949 3300046526 Bacteria 8524
346 Ga0495652_0397040 3300046529 Bacteria 977
347 Ga0495652_0397260 3300046529 Bacteria 977
348 Ga0495665_0003351 3300046531 Bacteria 8689
349 Ga0495665_0007961 3300046531 Bacteria 5745
350 Ga0495665_0019107 3300046531 Bacteria 3683
351 Ga0495665_0060660 3300046531 Bacteria 1997
352 Ga0495640_0036016 3300046533 Bacteria 3499
353 Ga0495640_0143260 3300046533 Bacteria 1539
354 Ga0495640_0336565 3300046533 Unclassified 933
355 Ga0495640_0358938 3300046533 Bacteria 898
356 Ga0495586_0001845 3300046535 Bacteria 11529
357 Ga0495587_0101911 3300046536 Bacteria 1653
358 Ga0495587_0164858 3300046536 Bacteria 1260
359 Ga0495622_0168299 3300046557 Bacteria 986
360 Ga0495667_0014904 3300046559 Bacteria 5252
361 Ga0495668_0141061 3300046616 Bacteria 1319
362 Ga0495634_0002956 3300046642 Bacteria 13882
363 Ga0495634_0011245 3300046642 Bacteria 6524
364 Ga0495634_0097134 3300046642 Bacteria 1907
365 Ga0495634_0111118 3300046642 Bacteria 1762
366 Ga0495634_0285553 3300046642 Bacteria 1001
367 Ga0495635_0000947 3300046663 Bacteria 19152
368 Ga0495635_0161097 3300046663 Bacteria 1527
369 Ga0495635_0208361 3300046663 Bacteria 1324
370 Ga0495635_0651487 3300046663 Bacteria 685
371 Ga0495661_0181602 3300046665 Bacteria 1115
372 Ga0495588_0084773 3300046674 Bacteria 1656
373 Ga0495588_0211992 3300046674 Unclassified 1023
374 Ga0495657_0001269 3300046675 Bacteria 21972
375 Ga0495599_0138674 3300046678 Bacteria 1509
376 Ga0495623_0150486 3300046679 Bacteria 1376
377 Ga0495646_0033846 3300046680 Bacteria 3177
378 Ga0495647_0000463 3300046681 Bacteria 11731
379 Ga0495647_0001396 3300046681 Bacteria 7451
380 Ga0495658_0005973 3300046683 Bacteria 5978
381 Ga0495658_0055462 3300046683 Bacteria 2257
382 Ga0495613_0029349 3300046689 Bacteria 4089
383 Ga0495613_0598964 3300046689 Bacteria 733
384 Ga0495624_0001864 3300046690 Bacteria 16075
385 Ga0495624_0042892 3300046690 Bacteria 2889
386 Ga0495624_0070584 3300046690 Bacteria 2174
387 Ga0495581_0009336 3300047315 Bacteria 5677
388 Ga0495581_0013939 3300047315 Bacteria 4662
389 Ga0495581_0030095 3300047315 Bacteria 3147
390 Ga0495581_0051336 3300047315 Bacteria 2381
391 Ga0495581_0128272 3300047315 Bacteria 1478
392 Ga0495674_0014404 3300047319 Bacteria 7404
393 Ga0495674_0014444 3300047319 Bacteria 7391
394 Ga0495674_0139513 3300047319 Bacteria 2038
395 Ga0495674_0222306 3300047319 Bacteria 1560
396 Ga0495676_0015322 3300047321 Bacteria 6831
397 Ga0495676_0049920 3300047321 Bacteria 3359
398 Ga0495676_0124035 3300047321 Bacteria 1874
399 Ga0495676_0607338 3300047321 Bacteria 712
400 Ga0495680_0012340 3300047322 Bacteria 7522
401 Ga0495680_0037408 3300047322 Bacteria 3887
402 Ga0495680_0206716 3300047322 Bacteria 1407
403 Ga0495673_0114288 3300047469 Bacteria 1076
404 Ga0495684_0010043 3300047471 Bacteria 7318
405 Ga0495684_0947638 3300047471 Bacteria 551
406 Ga0495593_0006231 3300047673 Bacteria 7006
407 Ga0495614_0027193 3300048089 Bacteria 2467
408 Ga0495614_0040391 3300048089 Bacteria 2002
409 Ga0496100_0005241 3300048903 Bacteria 6964
410 Ga0496100_0007502 3300048903 Bacteria 6025
411 Ga0496100_0015466 3300048903 Bacteria 4457
412 Ga0496100_0015654 3300048903 Bacteria 4432
413 Ga0496100_0045473 3300048903 Bacteria 2818
414 Ga0496100_0057690 3300048903 Bacteria 2544
415 Ga0496100_0975286 3300048903 Bacteria 667
416 Ga0496101_0003860 3300048904 Bacteria 9370
417 Ga0496101_0008926 3300048904 Bacteria 6569
418 Ga0496101_0039688 3300048904 Bacteria 3350
419 Ga0496101_0573179 3300048904 Bacteria 892
420 Ga0496102_0007501 3300048905 Bacteria 9328
421 Ga0496102_0018975 3300048905 Bacteria 6050
422 Ga0496102_0109458 3300048905 Bacteria 2574
423 Ga0496102_0228480 3300048905 Bacteria 1754
424 Ga0496103_0016324 3300048906 Bacteria 4431
425 Ga0496103_0017670 3300048906 Unclassified 4270
426 Ga0496103_0030943 3300048906 Bacteria 3258
427 Ga0496103_0078244 3300048906 Bacteria 2077
428 Ga0496104_0017833 3300048907 Bacteria 6472
429 Ga0496104_0027661 3300048907 Bacteria 5250
430 Ga0496104_0083729 3300048907 Bacteria 3042
431 Ga0496104_0224403 3300048907 Bacteria 1791
432 Ga0496104_0419642 3300048907 Bacteria 1250
433 Ga0496104_0472018 3300048907 Bacteria 1166
434 Ga0496105_0107647 3300048908 Bacteria 2301
435 Ga0496105_0293971 3300048908 Bacteria 1307
436 Ga0496105_0354093 3300048908 Bacteria 1172
437 Ga0496106_0001008 3300048909 Bacteria 20618
438 Ga0496106_0004803 3300048909 Bacteria 9998
439 Ga0496106_0013134 3300048909 Bacteria 6112
440 Ga0496106_0018100 3300048909 Bacteria 5209
441 Ga0496106_0050207 3300048909 Bacteria 3144
442 Ga0496107_0000925 3300048910 Bacteria 17305
443 Ga0496107_0010376 3300048910 Bacteria 6473
444 Ga0496107_0025755 3300048910 Bacteria 4166
445 Ga0496107_0029313 3300048910 Bacteria 3914
446 Ga0496107_0146905 3300048910 Unclassified 1743
447 Ga0496107_0266629 3300048910 Bacteria 1274
448 Ga0496108_0000471 3300048911 Bacteria 32268
449 Ga0496108_0003449 3300048911 Bacteria 12682
450 Ga0496108_0011204 3300048911 Bacteria 7285
451 Ga0496108_0015560 3300048911 Bacteria 6203
452 Ga0496108_0103655 3300048911 Bacteria 2427
453 Ga0496108_0164719 3300048911 Bacteria 1917
454 Ga0496108_0428439 3300048911 Bacteria 1155
455 Ga0496109_0004394 3300048912 Bacteria 11773
456 Ga0496109_0008077 3300048912 Bacteria 8921
457 Ga0496109_0012338 3300048912 Bacteria 7376
458 Ga0496109_0052514 3300048912 Bacteria 3715
459 Ga0496110_0000285 3300048913 Bacteria 33083
460 Ga0496110_0023060 3300048913 Bacteria 5293
461 Ga0496110_0624293 3300048913 Bacteria 976
462 Ga0496111_0002662 3300048914 Bacteria 10834
463 Ga0496111_0048462 3300048914 Bacteria 3060
464 Ga0496111_0127443 3300048914 Bacteria 1882
465 Ga0496111_0254398 3300048914 Bacteria 1303
466 Ga0496111_0317687 3300048914 Unclassified 1154
467 Ga0496111_0776762 3300048914 Bacteria 694
468 Ga0496111_1226151 3300048914 Bacteria 531
469 Ga0496112_0009975 3300048915 Bacteria 8595
470 Ga0496112_0041028 3300048915 Bacteria 4527
471 Ga0496112_0066920 3300048915 Bacteria 3545
472 Ga0496112_0078001 3300048915 Bacteria 3276
473 Ga0496112_0396218 3300048915 Unclassified 1320
474 Ga0496112_1119445 3300048915 Bacteria 705
475 Ga0496113_0003846 3300048916 Bacteria 9083
476 Ga0496113_0034870 3300048916 Bacteria 3675
477 Ga0496113_0050909 3300048916 Bacteria 3089
478 Ga0496113_0104258 3300048916 Bacteria 2200
479 Ga0496114_0001573 3300048917 Bacteria 17348
480 Ga0496114_0003491 3300048917 Bacteria 12076
481 Ga0496114_0050394 3300048917 Bacteria 3465
482 Ga0496114_0090434 3300048917 Bacteria 2598
483 Ga0496115_0029092 3300048918 Bacteria 4337
484 Ga0496115_0096433 3300048918 Bacteria 2421
485 Ga0496115_0332911 3300048918 Bacteria 1240
486 Ga0496115_0531748 3300048918 Bacteria 942
487 Ga0501031_0127636 3300049568 Unclassified 1661
488 Ga0501032_0039387 3300049569 Unclassified 3215
489 Ga0501033_0152802 3300049570 Bacteria 1664
490 Ga0501034_0705181 3300049571 Bacteria 907
491 Ga0501036_0028357 3300049572 Bacteria 4731
492 Ga0501036_0052199 3300049572 Unclassified 3462
493 Ga0501036_1281146 3300049572 Unclassified 596
494 Ga0501037_0007451 3300049573 Bacteria 8005
495 Ga0501037_0075525 3300049573 Bacteria 2447
496 Ga0501038_0039017 3300049574 Bacteria 4156
497 Ga0501038_0120400 3300049574 Unclassified 2165
498 Ga0501039_0477898 3300049575 Unclassified 978
499 Ga0501040_0030290 3300049576 Bacteria 3655
500 Ga0501040_0174066 3300049576 Unclassified 1525
501 Ga0501041_0395992 3300049577 Bacteria 874
502 Ga0501042_0142920 3300049578 Bacteria 1725
503 Ga0501042_0168287 3300049578 Unclassified 1581
504 Ga0501042_0324025 3300049578 Unclassified 1113
505 Ga0501043_0022422 3300049579 Bacteria 4953
506 Ga0501043_0127358 3300049579 Unclassified 1996
507 Ga0501046_0290605 3300049580 Bacteria 1195
508 Ga0501047_0123636 3300049581 Unclassified 2468
509 Ga0501048_0101400 3300049582 Bacteria 2031
510 Ga0501048_0111280 3300049582 Bacteria 1933
511 Ga0501067_0057268 3300049583 Bacteria 2158
512 Ga0501067_0079961 3300049583 Bacteria 1812
513 Ga0501068_0290403 3300049584 Bacteria 1046
514 Ga0501069_0063578 3300049585 Unclassified 2061
515 Ga0501069_0739217 3300049585 Bacteria 594
516 Ga0501070_0148628 3300049586 Bacteria 1933
517 Ga0501070_0171223 3300049586 Unclassified 1788
518 Ga0501071_0133328 3300049587 Bacteria 1846
519 Ga0501071_0149989 3300049587 Bacteria 1739
520 Ga0501071_0162467 3300049587 Bacteria 1670
521 Ga0501071_0275956 3300049587 Bacteria 1272
522 Ga0501072_0361834 3300049588 Bacteria 1152
523 Ga0501072_0631192 3300049588 Bacteria 844
524 Ga0501073_0007865 3300049589 Bacteria 7914
525 Ga0501073_0093772 3300049589 Bacteria 2085
526 Ga0501073_0342139 3300049589 Bacteria 1033
527 Ga0501074_0050757 3300049590 Unclassified 2994
528 Ga0501075_0170697 3300049591 Bacteria 1660
529 Ga0501076_0266495 3300049592 Bacteria 1402
530 Ga0501077_0212098 3300049593 Unclassified 1230
531 Ga0501079_0035754 3300049741 Unclassified 3824
532 Ga0501080_0002840 3300049742 Bacteria 15217
533 Ga0501083_0489444 3300049744 Bacteria 800
534 Ga0501083_0544749 3300049744 Bacteria 755
535 Ga0501035_0240075 3300049822 Bacteria 1541
536 Ga0501044_0205064 3300049823 Bacteria 1928
537 Ga0501045_0097783 3300049824 Bacteria 2172
538 Ga0501045_0158629 3300049824 Unclassified 1683
539 nmdc:mga08y16_1603663_c1 3300050511 Bacteria 608
540 nmdc:mga0n895_11168_c1 3300050512 Bacteria 7995
541 nmdc:mga0rr50_224564_c1 3300050513 Bacteria 1552
542 nmdc:mga0rr50_251240_c1 3300050513 Bacteria 1469
543 nmdc:mga08x19_166539_c1 3300050514 Bacteria 1499
544 nmdc:mga0a205_59412_c1 3300050515 Bacteria 3693
545 nmdc:mga0a205_908181_c1 3300050515 Bacteria 727
546 Ga0495601_0016038 3300053077 Bacteria 4533
547 Ga0495601_0021720 3300053077 Bacteria 3933
548 Ga0495601_0354620 3300053077 Bacteria 953
549 Ga0495601_0528669 3300053077 Unclassified 760
550 Ga0495612_0046562 3300053078 Bacteria 1776
551 Ga0495595_0002251 3300053084 Bacteria 7510
552 Ga0495595_0066120 3300053084 Bacteria 1702
553 Ga0495595_0566814 3300053084 Bacteria 580
554 Ga0495619_0007331 3300053085 Bacteria 6989
555 Ga0495619_0041633 3300053085 Bacteria 3006
556 Ga0495619_0063267 3300053085 Bacteria 2465
557 Ga0495619_0502798 3300053085 Bacteria 833
558 Ga0500556_0001095 3300053104 Bacteria 13582
559 Ga0500616_0001539 3300053153 Bacteria 21684
560 Ga0500599_010230 3300053736 Bacteria 1238
561 Ga0501084_0288867 3300054114 Bacteria 1385
562 Ga0501082_0172708 3300060353 Bacteria 1879
563 Ga0530510_0291277 3300061734 Bacteria 1220
564 Ga0495602_0088680
565 JGI24743J22301_10053862
566 Ga0070676_10111172
567 Ga0070676_10146123
568 Ga0070690_100186079
569 Ga0068869_100531550
570 Ga0068869_100932320
571 Ga0070680_100007777
572 Ga0070680_100234119
573 Ga0070680_100703023
574 Ga0068868_100004965
575 Ga0068868_100047511
576 Ga0068868_100270612
577 Ga0070660_100028252
578 Ga0070660_100551209
579 Ga0070689_100204156
580 Ga0070691_10736824
581 Ga0070687_100103967
582 Ga0070692_10070967
583 Ga0070692_10296503
584 Ga0070668_100192583
585 Ga0070675_100186508
586 Ga0070671_100066882
587 Ga0070671_100296157
588 Ga0070674_100009291
589 Ga0070673_100609605
590 Ga0070688_100343911
591 Ga0070688_100560605
592 Ga0070688_100740888
593 Ga0070659_100022071
594 Ga0070659_100162972
595 Ga0070667_100459638
596 Ga0070714_100451134
597 Ga0070714_100463627
598 Ga0070713_100282604
599 Ga0070713_100305920
600 Ga0070713_101228236
601 Ga0070710_10339193
602 Ga0070711_100006543
603 Ga0070711_100141223
604 Ga0070711_100342575
605 Ga0070711_101336191
606 Ga0070705_100011675
607 Ga0070705_100370582
608 Ga0070700_100086942
609 Ga0070700_100694965
610 Ga0070694_100362569
611 Ga0070694_100520863
612 Ga0070708_101470193
613 Ga0070662_100065666
614 Ga0068867_100021970
615 Ga0068867_100095051
616 Ga0068867_100124009
617 Ga0068867_100137691
618 Ga0068867_100938235
619 Ga0070685_10810909
620 Ga0070707_100243648
621 Ga0070698_100046156
622 Ga0070699_100087792
623 Ga0070679_100174213
624 Ga0070679_100694858
625 Ga0070679_101755497
626 Ga0070684_100806332
627 Ga0070697_100073548
628 Ga0068853_100592015
629 Ga0070686_100018078
630 Ga0070686_100019944
631 Ga0070695_100140794
632 Ga0070695_100176722
633 Ga0070695_100304204
634 Ga0070695_100384042
635 Ga0070696_100029484
636 Ga0070696_100225964
637 Ga0070696_101463901
638 Ga0070693_100086016
639 Ga0070693_100108067
640 Ga0070665_100207501
641 Ga0070665_100519854
642 Ga0070704_100006227
643 Ga0070704_100601344
644 Ga0068855_100013143
645 Ga0068855_101778852
646 Ga0068854_100089236
647 Ga0068854_100392956
648 Ga0068856_100012105
649 Ga0070702_100411292
650 Ga0070702_100752969
651 Ga0068852_100090529
652 Ga0068859_100597265
653 Ga0068859_100743186
654 Ga0068864_100013673
655 Ga0068864_100079473
656 Ga0068864_100263834
657 Ga0068866_10002765
658 Ga0068866_10025706
659 Ga0068866_10050627
660 Ga0068861_101161046
661 Ga0068870_10139758
662 Ga0068863_101332319
663 Ga0068858_100027131
664 Ga0070717_10086248
665 Ga0070717_10173454
666 Ga0070715_10016512
667 Ga0070716_100489473
668 Ga0070712_100202433
669 Ga0070712_100569157
670 Ga0097621_100032617
671 Ga0097621_100176357
672 Ga0097621_100189844
673 Ga0068871_101183824
674 Ga0075428_100166955
675 Ga0075428_100555834
676 Ga0075431_100401070
677 Ga0075431_100516026
678 Ga0075433_10723679
679 Ga0075434_100001102
680 Ga0075434_101117951
681 Ga0068865_100095749
682 Ga0068865_100288949
683 Ga0075436_100191024
684 Ga0097620_100597386
685 Ga0097620_100743135
686 Ga0075435_100010566
687 Ga0105240_10981348
688 Ga0111539_10681535
689 Ga0111539_12277942
690 Ga0105245_10029941
691 Ga0105245_10035096
692 Ga0105245_10039760
693 Ga0105245_10063461
694 Ga0105245_10090007
695 Ga0105245_10285154
696 Ga0105245_10352308
697 Ga0105245_10580292
698 Ga0105245_10823723
699 Ga0105245_11304885
700 Ga0105247_10027704
701 Ga0105247_10076646
702 Ga0105247_11083592
703 Ga0114129_10360303
704 Ga0114129_11123757
705 Ga0114129_11435025
706 Ga0114129_12998466
707 Ga0105243_10009735
708 Ga0105243_10037922
709 Ga0105243_10259600
710 Ga0105243_10331515
711 Ga0105243_10336361
712 Ga0105241_10311199
713 Ga0105242_10054819
714 Ga0105242_10139709
715 Ga0105242_10160126
716 Ga0105248_10003547
717 Ga0105237_10122323
718 Ga0105238_10015675
719 Ga0105238_10037202
720 Ga0105249_10016489
721 Ga0105249_10043101
722 Ga0105249_10185340
723 Ga0105249_10467199
724 Ga0105249_10474933
725 Ga0105249_12174605
726 Ga0105239_10060040
727 Ga0105239_10994803
728 Ga0105246_10019918
729 Ga0105246_10069732
730 Ga0105246_10215041
731 Ga0105246_10292184
732 Ga0105246_10452615
733 Ga0157369_10073178
734 Ga0157374_10024618
735 Ga0157374_11906591
736 Ga0157378_10004504
737 Ga0157378_10011142
738 Ga0157378_10161813
739 Ga0163162_10136262
740 Ga0163162_10200287
741 Ga0163162_10486974
742 Ga0157372_10106793
743 Ga0157372_11786411
744 Ga0157375_10004284
745 Ga0163163_10016482
746 Ga0163163_10072635
747 Ga0157380_10190619
748 Ga0157380_10409916
749 Ga0157377_10003811
750 Ga0157377_10017844
751 Ga0157377_10529110
752 Ga0157379_10005516
753 Ga0157379_11154578
754 Ga0157376_10006517
755 Ga0157376_10086890
756 Ga0157376_10124465
757 Ga0163161_11719002
758 Ga0207692_10055291
759 Ga0207692_10121119
760 Ga0207642_10010952
761 Ga0207710_10137348
762 Ga0207710_10546377
763 Ga0207688_10018738
764 Ga0207688_10019524
765 Ga0207688_10101528
766 Ga0207685_10000790
767 Ga0207645_10078300
768 Ga0207645_10080203
769 Ga0207643_10134782
770 Ga0207707_10852501
771 Ga0207671_10093507
772 Ga0207693_10000939
773 Ga0207693_10294279
774 Ga0207693_10530556
775 Ga0207663_10243472
776 Ga0207660_10078534
777 Ga0207662_10090864
778 Ga0207657_10032646
779 Ga0207652_10373657
780 Ga0207646_10077014
781 Ga0207694_10009556
782 Ga0207694_10047395
783 Ga0207650_10043907
784 Ga0207659_10021068
785 Ga0207687_10008602
786 Ga0207687_10015537
787 Ga0207687_10185048
788 Ga0207687_11077632
789 Ga0207700_10305182
790 Ga0207644_10216240
791 Ga0207644_10258298
792 Ga0207690_10075790
793 Ga0207690_10176848
794 Ga0207690_11010510
795 Ga0207706_10058372
796 Ga0207706_10120396
797 Ga0207686_10108231
798 Ga0207686_10296630
799 Ga0207686_10303620
800 Ga0207709_10030420
801 Ga0207709_10037936
802 Ga0207709_10060958
803 Ga0207670_10204691
804 Ga0207669_10005015
805 Ga0207704_10014033
806 Ga0207665_10183853
807 Ga0207711_10030335
808 Ga0207689_10017931
809 Ga0207661_10172866
810 Ga0207679_10383276
811 Ga0207712_10039611
812 Ga0207712_10053768
813 Ga0207712_10215366
814 Ga0207668_10535578
815 Ga0207640_10120014
816 Ga0207640_10258189
817 Ga0207640_11094628
818 Ga0207658_10746772
819 Ga0207677_10013407
820 Ga0207677_10059851
821 Ga0207677_10477300
822 Ga0207703_10030182
823 Ga0207639_10562759
824 Ga0207708_10097665
825 Ga0207708_10228071
826 Ga0207708_10335570
827 Ga0207708_10501097
828 Ga0207702_10018686
829 Ga0207641_10529278
830 Ga0207648_10003949
831 Ga0207648_10119140
832 Ga0207648_10193604
833 Ga0207676_10218113
834 Ga0207675_100186532
835 Ga0207683_10220308
836 Ga0207698_10077035
837 Ga0209974_10429875
838 Ga0268266_11614744
839 Ga0268264_10105281
840 Ga0265338_10140844
841 Ga0265327_10011646
842 Ga0307405_11755952
843 Ga0307406_10301761
844 Ga0307409_100422660
845 Ga0373926_0041921
846 Ga0373944_0123453
847 Ga0373949_0066021
848 Ga0373936_0003480
849 Ga0373945_0007250
850 Ga0373945_0043222
851 Ga0373945_0135084
852 Ga0373956_0419530
853 Ga0373957_0090197
854 Ga0373943_0000638
855 Ga0373946_0079518
856 Ga0373955_0055736
857 Ga0373931_0094149
858 Ga0373931_0710760
859 Ga0373935_0028082
860 Ga0373935_0071238
861 Ga0373935_0241036
862 Ga0373927_0003943
863 Ga0373933_0018744
864 Ga0373947_0002543
865 Ga0373947_0006692
866 Ga0373925_0000824
867 Ga0373925_0006355
868 Ga0373925_0014782
869 Ga0373925_0428830
870 Ga0373925_0669441
871 Ga0395899_0045758
872 Ga0395900_0187756
873 Ga0395900_0636533
874 Ga0395900_0852603
875 Ga0395898_0241228
876 Ga0395898_0303633
877 Ga0395905_0405129
878 Ga0395901_0074107
879 Ga0242420_124488
880 Ga0451800_0247682
881 Ga0453683_0045465
882 Ga0495603_0134330
883 Ga0495629_0002277
884 Ga0495629_0025533
885 Ga0495641_0001651
886 Ga0495641_0019538
887 Ga0495641_0276097
888 Ga0495651_0026997
889 Ga0495651_0187872
890 Ga0495582_0003778
891 Ga0495582_0008374
892 Ga0495582_0049656
893 Ga0495639_0000471
894 Ga0495639_0000758
895 Ga0495639_0064510
896 Ga0495662_0132521
897 Ga0495664_0331343
898 Ga0495594_0181600
899 Ga0495594_0285003
900 Ga0495596_0093134
901 Ga0495607_0303354
902 Ga0495608_0009988
903 Ga0495618_0006475
904 Ga0495628_0884794
905 Ga0495630_0000547
906 Ga0495630_0020963
907 Ga0495630_0419347
908 Ga0495666_0002949
909 Ga0495652_0397040
910 Ga0495652_0397260
911 Ga0495665_0003351
912 Ga0495665_0007961
913 Ga0495665_0019107
914 Ga0495665_0060660
915 Ga0495640_0036016
916 Ga0495640_0143260
917 Ga0495640_0336565
918 Ga0495640_0358938
919 Ga0495586_0001845
920 Ga0495587_0101911
921 Ga0495587_0164858
922 Ga0495622_0168299
923 Ga0495667_0014904
924 Ga0495668_0141061
925 Ga0495634_0002956
926 Ga0495634_0011245
927 Ga0495634_0097134
928 Ga0495634_0111118
929 Ga0495634_0285553
930 Ga0495635_0000947
931 Ga0495635_0161097
932 Ga0495635_0208361
933 Ga0495635_0651487
934 Ga0495661_0181602
935 Ga0495588_0084773
936 Ga0495588_0211992
937 Ga0495657_0001269
938 Ga0495599_0138674
939 Ga0495623_0150486
940 Ga0495646_0033846
941 Ga0495647_0000463
942 Ga0495647_0001396
943 Ga0495658_0005973
944 Ga0495658_0055462
945 Ga0495613_0029349
946 Ga0495613_0598964
947 Ga0495624_0001864
948 Ga0495624_0042892
949 Ga0495624_0070584
950 Ga0495581_0009336
951 Ga0495581_0013939
952 Ga0495581_0030095
953 Ga0495581_0051336
954 Ga0495581_0128272
955 Ga0495674_0014404
956 Ga0495674_0014444
957 Ga0495674_0139513
958 Ga0495674_0222306
959 Ga0495676_0015322
960 Ga0495676_0049920
961 Ga0495676_0124035
962 Ga0495676_0607338
963 Ga0495680_0012340
964 Ga0495680_0037408
965 Ga0495680_0206716
966 Ga0495673_0114288
967 Ga0495684_0010043
968 Ga0495684_0947638
969 Ga0495593_0006231
970 Ga0495614_0027193
971 Ga0495614_0040391
972 Ga0496100_0005241
973 Ga0496100_0007502
974 Ga0496100_0015466
975 Ga0496100_0015654
976 Ga0496100_0045473
977 Ga0496100_0057690
978 Ga0496100_0975286
979 Ga0496101_0003860
980 Ga0496101_0008926
981 Ga0496101_0039688
982 Ga0496101_0573179
983 Ga0496102_0007501
984 Ga0496102_0018975
985 Ga0496102_0109458
986 Ga0496102_0228480
987 Ga0496103_0016324
988 Ga0496103_0017670
989 Ga0496103_0030943
990 Ga0496103_0078244
991 Ga0496104_0017833
992 Ga0496104_0027661
993 Ga0496104_0083729
994 Ga0496104_0224403
995 Ga0496104_0419642
996 Ga0496104_0472018
997 Ga0496105_0107647
998 Ga0496105_0293971
999 Ga0496105_0354093
1000 Ga0496106_0001008
1001 Ga0496106_0004803
1002 Ga0496106_0013134
1003 Ga0496106_0018100
1004 Ga0496106_0050207
1005 Ga0496107_0000925
1006 Ga0496107_0010376
1007 Ga0496107_0025755
1008 Ga0496107_0029313
1009 Ga0496107_0146905
1010 Ga0496107_0266629
1011 Ga0496108_0000471
1012 Ga0496108_0003449
1013 Ga0496108_0011204
1014 Ga0496108_0015560
1015 Ga0496108_0103655
1016 Ga0496108_0164719
1017 Ga0496108_0428439
1018 Ga0496109_0004394
1019 Ga0496109_0008077
1020 Ga0496109_0012338
1021 Ga0496109_0052514
1022 Ga0496110_0000285
1023 Ga0496110_0023060
1024 Ga0496110_0624293
1025 Ga0496111_0002662
1026 Ga0496111_0048462
1027 Ga0496111_0127443
1028 Ga0496111_0254398
1029 Ga0496111_0317687
1030 Ga0496111_0776762
1031 Ga0496111_1226151
1032 Ga0496112_0009975
1033 Ga0496112_0041028
1034 Ga0496112_0066920
1035 Ga0496112_0078001
1036 Ga0496112_0396218
1037 Ga0496112_1119445
1038 Ga0496113_0003846
1039 Ga0496113_0034870
1040 Ga0496113_0050909
1041 Ga0496113_0104258
1042 Ga0496114_0001573
1043 Ga0496114_0003491
1044 Ga0496114_0050394
1045 Ga0496114_0090434
1046 Ga0496115_0029092
1047 Ga0496115_0096433
1048 Ga0496115_0332911
1049 Ga0496115_0531748
1050 Ga0501031_0127636
1051 Ga0501032_0039387
1052 Ga0501033_0152802
1053 Ga0501034_0705181
1054 Ga0501036_0028357
1055 Ga0501036_0052199
1056 Ga0501036_1281146
1057 Ga0501037_0007451
1058 Ga0501037_0075525
1059 Ga0501038_0039017
1060 Ga0501038_0120400
1061 Ga0501039_0477898
1062 Ga0501040_0030290
1063 Ga0501040_0174066
1064 Ga0501041_0395992
1065 Ga0501042_0142920
1066 Ga0501042_0168287
1067 Ga0501042_0324025
1068 Ga0501043_0022422
1069 Ga0501043_0127358
1070 Ga0501046_0290605
1071 Ga0501047_0123636
1072 Ga0501048_0101400
1073 Ga0501048_0111280
1074 Ga0501067_0057268
1075 Ga0501067_0079961
1076 Ga0501068_0290403
1077 Ga0501069_0063578
1078 Ga0501069_0739217
1079 Ga0501070_0148628
1080 Ga0501070_0171223
1081 Ga0501071_0133328
1082 Ga0501071_0149989
1083 Ga0501071_0162467
1084 Ga0501071_0275956
1085 Ga0501072_0361834
1086 Ga0501072_0631192
1087 Ga0501073_0007865
1088 Ga0501073_0093772
1089 Ga0501073_0342139
1090 Ga0501074_0050757
1091 Ga0501075_0170697
1092 Ga0501076_0266495
1093 Ga0501077_0212098
1094 Ga0501079_0035754
1095 Ga0501080_0002840
1096 Ga0501083_0489444
1097 Ga0501083_0544749
1098 Ga0501035_0240075
1099 Ga0501044_0205064
1100 Ga0501045_0097783
1101 Ga0501045_0158629
1102 nmdc:mga08y16_1603663_c1
1103 nmdc:mga0n895_11168_c1
1104 nmdc:mga0rr50_224564_c1
1105 nmdc:mga0rr50_251240_c1
1106 nmdc:mga08x19_166539_c1
1107 nmdc:mga0a205_59412_c1
1108 nmdc:mga0a205_908181_c1
1109 Ga0495601_0016038
1110 Ga0495601_0021720
1111 Ga0495601_0354620
1112 Ga0495601_0528669
1113 Ga0495612_0046562
1114 Ga0495595_0002251
1115 Ga0495595_0066120
1116 Ga0495595_0566814
1117 Ga0495619_0007331
1118 Ga0495619_0041633
1119 Ga0495619_0063267
1120 Ga0495619_0502798
1121 Ga0500556_0001095
1122 Ga0500616_0001539
1123 Ga0500599_010230
1124 Ga0501084_0288867
1125 Ga0501082_0172708
1126 Ga0530510_0291277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

40

160

0.82

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

72

162

0.82

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

38

171

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hmn-assembly1.cif.gz_C crystal structure of an aminoglycoside acetyltransferase hmb0005 from an uncultured soil metagenomic sample, unknown active site density modeled as polyethylene glycol 0.7928 46 139
2p0w-assembly1.cif.gz_A human histone acetyltransferase 1 (hat1) 0.7833 46 114
4y49-assembly2.cif.gz_I crystal structure of yeast n-terminal acetyltransferase (ppgpp) nate in complex with a bisubstrate 0.7731 46 148
4u9v-assembly1.cif.gz_B crystal structure of natd (naa40p) bound to acetyl coa 0.7714 46 150
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.7628 46 148
ID Description Score Start End Superfamily
2fl4A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8752 46 148 3.40.630.30
2fl4A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8365 46 148 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8128 71 148 3.40.630.30
af_K7LHF0_767_874_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8081 46 137 3.40.630.30
af_K7LQW1_676_805_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7941 46 140 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A3D1ZN61-F1-model_v4 N-acetyltransferase domain-containing protein 0.9855 82 148
AF-A0A7V9D953-F1-model_v4 GNAT family N-acetyltransferase 0.985 1 150 GO:0016747
AF-A0A7V9D953-F1-model_v4 GNAT family N-acetyltransferase 0.9786 1 150 GO:0016747
AF-A0A5M3WGC4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9718 2 150 GO:0016747
AF-A0A6L3FDI7-F1-model_v4 GNAT family N-acetyltransferase 0.9704 78 150 GO:0016747

Map