F464078
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 563 | 328 | 521 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0851813|Ga0436365_0851813_194_1066 |
| Length | 290 |
| Sequence | MLHDMNSILSQPAGVTFGPRLEGRVAAVTGGAAGIGRAICLRLAAEGARVAVLDLDRSRAQQTVDAAGGGGFAAEVDVSDSAAVEAAVAAVENELGALDIFVNNAGASGAEHIMRISARLAAQREEAAVGAIKTPLDALVRLRDDEWRTLLGIHLDGTFYGTRSAVRSMVARGTGGAIVNMASICGIEGCTGHPHYSAAKAGIIGFTRAVAKELILQGIRVNAVAPGFIDTTTARGHLSDNRTEMVRRTPAGRLGTPEEVAATVAFLVSDDASYFVGATLSPNGGLVTAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 2 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 3 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 4 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 5 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 6 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 7 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 8 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 9 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 10 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 11 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 12 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 13 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 14 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 15 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 16 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 17 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 18 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 19 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 20 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 21 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 22 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 23 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 24 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 25 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 26 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 27 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 28 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 29 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 30 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 31 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 32 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 33 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 34 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 35 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 36 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 37 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 38 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 39 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 40 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 41 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 42 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 43 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 45 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 46 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 215 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 216 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 217 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 218 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 278 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 279 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 306 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 309 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 319 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 320 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 323 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 328 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.36 |
| Metatranscriptomes | 0.36 |
| Isolates | 7.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.71 |
| Bulb | 0 |
| Endosphere | 4.26 |
| Nodule | 3.37 |
| Rhizoplane | 16.52 |
| Rhizosphere | 68.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10016614 | 3300002239 | Bacteria | 1135 |
| 2 | JGI25151J46595_10018848 | 3300003187 | Bacteria | 2950 |
| 3 | JGI25406J46586_10001925 | 3300003203 | Bacteria | 9789 |
| 4 | rootH2_10205803 | 3300003320 | Bacteria | 1953 |
| 5 | JGI25160J50197_1000459 | 3300003354 | Bacteria | 25342 |
| 6 | Ga0058692_1001859 | 3300003856 | Bacteria | 7413 |
| 7 | Ga0058692_1004350 | 3300003856 | Bacteria | 4209 |
| 8 | Ga0070683_100247370 | 3300005329 | Bacteria | 1696 |
| 9 | Ga0068869_100051337 | 3300005334 | Bacteria | 2992 |
| 10 | Ga0070666_10007782 | 3300005335 | Bacteria | 6619 |
| 11 | Ga0070682_100142357 | 3300005337 | Bacteria | 1636 |
| 12 | Ga0070660_100272928 | 3300005339 | Bacteria | 1382 |
| 13 | Ga0070689_100206921 | 3300005340 | Bacteria | 1604 |
| 14 | Ga0070661_100130654 | 3300005344 | Bacteria | 1886 |
| 15 | Ga0070692_10028129 | 3300005345 | Bacteria | 2793 |
| 16 | Ga0070692_10053888 | 3300005345 | Bacteria | 2099 |
| 17 | Ga0070668_100000586 | 3300005347 | Bacteria | 24429 |
| 18 | Ga0070668_100006105 | 3300005347 | Bacteria | 8933 |
| 19 | Ga0070668_100112750 | 3300005347 | Bacteria | 2165 |
| 20 | Ga0070669_100485861 | 3300005353 | Bacteria | 1023 |
| 21 | Ga0070671_100096403 | 3300005355 | Bacteria | 2480 |
| 22 | Ga0070671_100176770 | 3300005355 | Bacteria | 1807 |
| 23 | Ga0070674_100164653 | 3300005356 | Bacteria | 1685 |
| 24 | Ga0070659_100165864 | 3300005366 | Bacteria | 1807 |
| 25 | Ga0070667_100000100 | 3300005367 | Bacteria | 108128 |
| 26 | Ga0070667_100000714 | 3300005367 | Bacteria | 31992 |
| 27 | Ga0070709_10005748 | 3300005434 | Bacteria | 6726 |
| 28 | Ga0070714_100183638 | 3300005435 | Bacteria | 1904 |
| 29 | Ga0070714_100349458 | 3300005435 | Unclassified | 1388 |
| 30 | Ga0070713_100087691 | 3300005436 | Bacteria | 2670 |
| 31 | Ga0070713_100315488 | 3300005436 | Bacteria | 1442 |
| 32 | Ga0070710_10014368 | 3300005437 | Bacteria | 3985 |
| 33 | Ga0070710_10016218 | 3300005437 | Bacteria | 3786 |
| 34 | Ga0070711_100010492 | 3300005439 | Bacteria | 5736 |
| 35 | Ga0070711_100030464 | 3300005439 | Bacteria | 3572 |
| 36 | Ga0070711_100127724 | 3300005439 | Bacteria | 1889 |
| 37 | Ga0070694_100008823 | 3300005444 | Bacteria | 6176 |
| 38 | Ga0070694_100168044 | 3300005444 | Bacteria | 1614 |
| 39 | Ga0070708_100033942 | 3300005445 | Bacteria | 4435 |
| 40 | Ga0070708_100051688 | 3300005445 | Bacteria | 3641 |
| 41 | Ga0070706_100005596 | 3300005467 | Bacteria | 11956 |
| 42 | Ga0070706_100022266 | 3300005467 | Bacteria | 5834 |
| 43 | Ga0070707_100086155 | 3300005468 | Bacteria | 3037 |
| 44 | Ga0070707_100537519 | 3300005468 | Bacteria | 1131 |
| 45 | Ga0070698_100011143 | 3300005471 | Bacteria | 9551 |
| 46 | Ga0070698_100152198 | 3300005471 | Bacteria | 2261 |
| 47 | Ga0070698_100452038 | 3300005471 | Bacteria | 1220 |
| 48 | Ga0070698_100597426 | 3300005471 | Bacteria | 1044 |
| 49 | Ga0070699_100001932 | 3300005518 | Bacteria | 18701 |
| 50 | Ga0070699_100080219 | 3300005518 | Bacteria | 2844 |
| 51 | Ga0070684_100137362 | 3300005535 | Bacteria | 2209 |
| 52 | Ga0070684_100153746 | 3300005535 | Bacteria | 2085 |
| 53 | Ga0070697_100056849 | 3300005536 | Bacteria | 3183 |
| 54 | Ga0068853_100038485 | 3300005539 | Bacteria | 4074 |
| 55 | Ga0070672_100068411 | 3300005543 | Bacteria | 2816 |
| 56 | Ga0070686_100273307 | 3300005544 | Bacteria | 1243 |
| 57 | Ga0070693_100280014 | 3300005547 | Bacteria | 1116 |
| 58 | Ga0070665_100044923 | 3300005548 | Bacteria | 4435 |
| 59 | Ga0070665_100050192 | 3300005548 | Bacteria | 4186 |
| 60 | Ga0070665_100185705 | 3300005548 | Bacteria | 2080 |
| 61 | Ga0070704_100032095 | 3300005549 | Bacteria | 3539 |
| 62 | Ga0068855_100131379 | 3300005563 | Bacteria | 2859 |
| 63 | Ga0070664_100079854 | 3300005564 | Bacteria | 2817 |
| 64 | Ga0070664_100653253 | 3300005564 | Bacteria | 977 |
| 65 | Ga0068856_100087335 | 3300005614 | Bacteria | 3100 |
| 66 | Ga0068856_100262991 | 3300005614 | Bacteria | 1741 |
| 67 | Ga0070702_100132072 | 3300005615 | Bacteria | 1578 |
| 68 | Ga0068852_100313909 | 3300005616 | Bacteria | 1520 |
| 69 | Ga0068859_100260164 | 3300005617 | Bacteria | 1826 |
| 70 | Ga0068861_100203198 | 3300005719 | Bacteria | 1664 |
| 71 | Ga0068870_10024159 | 3300005840 | Bacteria | 3005 |
| 72 | Ga0068863_100000075 | 3300005841 | Bacteria | 109825 |
| 73 | Ga0068863_100172972 | 3300005841 | Bacteria | 2072 |
| 74 | Ga0068860_100019066 | 3300005843 | Bacteria | 6661 |
| 75 | Ga0068860_100220799 | 3300005843 | Bacteria | 1840 |
| 76 | Ga0068862_100003205 | 3300005844 | Bacteria | 14175 |
| 77 | Ga0081455_10012614 | 3300005937 | Bacteria | 8419 |
| 78 | Ga0081455_10174259 | 3300005937 | Bacteria | 1635 |
| 79 | Ga0081539_10000969 | 3300005985 | Bacteria | 53653 |
| 80 | Ga0081539_10001899 | 3300005985 | Bacteria | 32393 |
| 81 | Ga0070717_10007603 | 3300006028 | Bacteria | 8052 |
| 82 | Ga0070717_10017450 | 3300006028 | Bacteria | 5586 |
| 83 | Ga0070717_10018881 | 3300006028 | Bacteria | 5394 |
| 84 | Ga0070717_10065196 | 3300006028 | Bacteria | 3027 |
| 85 | Ga0070717_10072333 | 3300006028 | Bacteria | 2879 |
| 86 | Ga0070717_10167569 | 3300006028 | Bacteria | 1909 |
| 87 | Ga0070717_10440373 | 3300006028 | Bacteria | 1173 |
| 88 | Ga0070717_10603253 | 3300006028 | Bacteria | 996 |
| 89 | Ga0075363_100156503 | 3300006048 | Bacteria | 1288 |
| 90 | Ga0070715_10034131 | 3300006163 | Bacteria | 2083 |
| 91 | Ga0070715_10075787 | 3300006163 | Bacteria | 1514 |
| 92 | Ga0070716_100025729 | 3300006173 | Bacteria | 3144 |
| 93 | Ga0070712_100125671 | 3300006175 | Bacteria | 1937 |
| 94 | Ga0070712_100226895 | 3300006175 | Unclassified | 1481 |
| 95 | Ga0070712_100304572 | 3300006175 | Bacteria | 1291 |
| 96 | Ga0075369_10192290 | 3300006186 | Bacteria | 940 |
| 97 | Ga0075366_10231691 | 3300006195 | Bacteria | 1125 |
| 98 | Ga0075370_10273184 | 3300006353 | Bacteria | 1003 |
| 99 | Ga0068871_100395400 | 3300006358 | Bacteria | 1230 |
| 100 | Ga0075431_100352612 | 3300006847 | Bacteria | 1479 |
| 101 | Ga0075433_10172258 | 3300006852 | Bacteria | 1926 |
| 102 | Ga0075434_100098474 | 3300006871 | Bacteria | 2929 |
| 103 | Ga0075434_100247990 | 3300006871 | Bacteria | 1800 |
| 104 | Ga0075434_100299371 | 3300006871 | Bacteria | 1629 |
| 105 | Ga0097620_100260172 | 3300006931 | Bacteria | 1826 |
| 106 | Ga0099826_10035288 | 3300006948 | Bacteria | 3559 |
| 107 | Ga0075435_100053155 | 3300007076 | Bacteria | 3266 |
| 108 | Ga0105245_10024784 | 3300009098 | Bacteria | 5271 |
| 109 | Ga0105247_10031535 | 3300009101 | Bacteria | 3217 |
| 110 | Ga0105243_10026247 | 3300009148 | Bacteria | 4458 |
| 111 | Ga0105243_10096268 | 3300009148 | Bacteria | 2448 |
| 112 | Ga0105243_10232122 | 3300009148 | Bacteria | 1637 |
| 113 | Ga0105243_10547355 | 3300009148 | Bacteria | 1105 |
| 114 | Ga0105242_10043115 | 3300009176 | Bacteria | 3648 |
| 115 | Ga0105242_10325827 | 3300009176 | Bacteria | 1411 |
| 116 | Ga0105242_10681704 | 3300009176 | Bacteria | 1003 |
| 117 | Ga0105248_10140384 | 3300009177 | Bacteria | 2725 |
| 118 | Ga0105248_10338475 | 3300009177 | Bacteria | 1694 |
| 119 | Ga0105237_10098848 | 3300009545 | Bacteria | 2909 |
| 120 | Ga0105249_10001446 | 3300009553 | Bacteria | 20789 |
| 121 | Ga0105239_10204458 | 3300010375 | Bacteria | 2213 |
| 122 | Ga0105246_10581008 | 3300011119 | Bacteria | 965 |
| 123 | Ga0157371_10000268 | 3300013102 | Bacteria | 70868 |
| 124 | Ga0157371_10046360 | 3300013102 | Bacteria | 3091 |
| 125 | Ga0157370_10009085 | 3300013104 | Bacteria | 10660 |
| 126 | Ga0157378_10018830 | 3300013297 | Bacteria | 6068 |
| 127 | Ga0163162_10157609 | 3300013306 | Bacteria | 2391 |
| 128 | Ga0163162_10593024 | 3300013306 | Bacteria | 1235 |
| 129 | Ga0163162_10626195 | 3300013306 | Bacteria | 1201 |
| 130 | Ga0157372_10883196 | 3300013307 | Bacteria | 1037 |
| 131 | Ga0157375_10124685 | 3300013308 | Bacteria | 2689 |
| 132 | Ga0163163_10788596 | 3300014325 | Bacteria | 1013 |
| 133 | Ga0163163_11028408 | 3300014325 | Bacteria | 887 |
| 134 | Ga0157380_10523913 | 3300014326 | Bacteria | 1157 |
| 135 | Ga0157377_10387827 | 3300014745 | Bacteria | 948 |
| 136 | Ga0157379_10004216 | 3300014968 | Bacteria | 12277 |
| 137 | Ga0157379_10010734 | 3300014968 | Bacteria | 7983 |
| 138 | Ga0157379_10018185 | 3300014968 | Bacteria | 6193 |
| 139 | Ga0157376_10075956 | 3300014969 | Bacteria | 2869 |
| 140 | Ga0157376_10180260 | 3300014969 | Bacteria | 1930 |
| 141 | Ga0206350_11519635 | 3300020080 | Bacteria | 1058 |
| 142 | Ga0213874_10016978 | 3300021377 | Bacteria | 1946 |
| 143 | Ga0213874_10017898 | 3300021377 | Bacteria | 1908 |
| 144 | Ga0213876_10057020 | 3300021384 | Bacteria | 2062 |
| 145 | Ga0213876_10094508 | 3300021384 | Bacteria | 1584 |
| 146 | Ga0213876_10116357 | 3300021384 | Bacteria | 1419 |
| 147 | Ga0213875_10006448 | 3300021388 | Bacteria | 6156 |
| 148 | Ga0213871_10041621 | 3300021441 | Bacteria | 1235 |
| 149 | Ga0209025_1000227 | 3300025294 | Bacteria | 132244 |
| 150 | Ga0207426_1000300 | 3300025302 | Bacteria | 96857 |
| 151 | Ga0207426_1000748 | 3300025302 | Bacteria | 36575 |
| 152 | Ga0207653_10022761 | 3300025885 | Bacteria | 1992 |
| 153 | Ga0207692_10014943 | 3300025898 | Bacteria | 3404 |
| 154 | Ga0207710_10122997 | 3300025900 | Bacteria | 1241 |
| 155 | Ga0207688_10016830 | 3300025901 | Bacteria | 3969 |
| 156 | Ga0207680_10000730 | 3300025903 | Bacteria | 15464 |
| 157 | Ga0207680_10129226 | 3300025903 | Bacteria | 1663 |
| 158 | Ga0207680_10251102 | 3300025903 | Bacteria | 1222 |
| 159 | Ga0207647_10049250 | 3300025904 | Bacteria | 2614 |
| 160 | Ga0207685_10020251 | 3300025905 | Bacteria | 2207 |
| 161 | Ga0207699_10100182 | 3300025906 | Bacteria | 1837 |
| 162 | Ga0207699_10101808 | 3300025906 | Bacteria | 1824 |
| 163 | Ga0207645_10075461 | 3300025907 | Bacteria | 2158 |
| 164 | Ga0207643_10001930 | 3300025908 | Bacteria | 11466 |
| 165 | Ga0207684_10007915 | 3300025910 | Bacteria | 9499 |
| 166 | Ga0207684_10020183 | 3300025910 | Bacteria | 5690 |
| 167 | Ga0207654_10350682 | 3300025911 | Bacteria | 1016 |
| 168 | Ga0207671_10155114 | 3300025914 | Bacteria | 1771 |
| 169 | Ga0207693_10002392 | 3300025915 | Bacteria | 16289 |
| 170 | Ga0207693_10005702 | 3300025915 | Bacteria | 10351 |
| 171 | Ga0207693_10015494 | 3300025915 | Bacteria | 6116 |
| 172 | Ga0207693_10101015 | 3300025915 | Bacteria | 2261 |
| 173 | Ga0207663_10018429 | 3300025916 | Bacteria | 3912 |
| 174 | Ga0207662_10000263 | 3300025918 | Bacteria | 24233 |
| 175 | Ga0207657_10031844 | 3300025919 | Bacteria | 4770 |
| 176 | Ga0207649_10323562 | 3300025920 | Bacteria | 1134 |
| 177 | Ga0207646_10021030 | 3300025922 | Bacteria | 6035 |
| 178 | Ga0207646_10067243 | 3300025922 | Bacteria | 3199 |
| 179 | Ga0207646_10080672 | 3300025922 | Bacteria | 2909 |
| 180 | Ga0207646_10379081 | 3300025922 | Bacteria | 1278 |
| 181 | Ga0207681_10088114 | 3300025923 | Bacteria | 2210 |
| 182 | Ga0207681_10269146 | 3300025923 | Bacteria | 1337 |
| 183 | Ga0207700_10054849 | 3300025928 | Bacteria | 2993 |
| 184 | Ga0207700_10106639 | 3300025928 | Bacteria | 2246 |
| 185 | Ga0207700_10138232 | 3300025928 | Bacteria | 1998 |
| 186 | Ga0207664_10044631 | 3300025929 | Bacteria | 3472 |
| 187 | Ga0207664_10099759 | 3300025929 | Bacteria | 2397 |
| 188 | Ga0207664_10161683 | 3300025929 | Bacteria | 1910 |
| 189 | Ga0207664_10324562 | 3300025929 | Unclassified | 1359 |
| 190 | Ga0207644_10064047 | 3300025931 | Bacteria | 2671 |
| 191 | Ga0207644_10243446 | 3300025931 | Bacteria | 1433 |
| 192 | Ga0207706_10520280 | 3300025933 | Bacteria | 1026 |
| 193 | Ga0207686_10027667 | 3300025934 | Bacteria | 3322 |
| 194 | Ga0207709_10011270 | 3300025935 | Bacteria | 4931 |
| 195 | Ga0207709_10074524 | 3300025935 | Bacteria | 2166 |
| 196 | Ga0207709_10114032 | 3300025935 | Bacteria | 1813 |
| 197 | Ga0207665_10000520 | 3300025939 | Bacteria | 26052 |
| 198 | Ga0207691_10017927 | 3300025940 | Bacteria | 6709 |
| 199 | Ga0207711_10341197 | 3300025941 | Bacteria | 1386 |
| 200 | Ga0207689_10008875 | 3300025942 | Bacteria | 8721 |
| 201 | Ga0207689_10065300 | 3300025942 | Bacteria | 2993 |
| 202 | Ga0207679_10047466 | 3300025945 | Bacteria | 3120 |
| 203 | Ga0207679_10528081 | 3300025945 | Bacteria | 1056 |
| 204 | Ga0207651_10232470 | 3300025960 | Bacteria | 1498 |
| 205 | Ga0207712_10004438 | 3300025961 | Bacteria | 8861 |
| 206 | Ga0207668_10000707 | 3300025972 | Bacteria | 20413 |
| 207 | Ga0207668_10002606 | 3300025972 | Bacteria | 10545 |
| 208 | Ga0207640_10392980 | 3300025981 | Bacteria | 1127 |
| 209 | Ga0207658_10000079 | 3300025986 | Bacteria | 107980 |
| 210 | Ga0207658_10012090 | 3300025986 | Bacteria | 5888 |
| 211 | Ga0207677_10243252 | 3300026023 | Bacteria | 1457 |
| 212 | Ga0207703_10053934 | 3300026035 | Bacteria | 3268 |
| 213 | Ga0207703_10094651 | 3300026035 | Bacteria | 2519 |
| 214 | Ga0207678_10001771 | 3300026067 | Bacteria | 19766 |
| 215 | Ga0207708_10050239 | 3300026075 | Bacteria | 3175 |
| 216 | Ga0207702_10052200 | 3300026078 | Bacteria | 3459 |
| 217 | Ga0207702_10171932 | 3300026078 | Bacteria | 1987 |
| 218 | Ga0207641_10000381 | 3300026088 | Bacteria | 52796 |
| 219 | Ga0207648_10004835 | 3300026089 | Bacteria | 13739 |
| 220 | Ga0207674_10641724 | 3300026116 | Bacteria | 1025 |
| 221 | Ga0207675_100000619 | 3300026118 | Bacteria | 34751 |
| 222 | Ga0207683_10020088 | 3300026121 | Bacteria | 5709 |
| 223 | Ga0207683_10072818 | 3300026121 | Bacteria | 3039 |
| 224 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 225 | Ga0209371_1000729 | 3300027312 | Bacteria | 27629 |
| 226 | Ga0209282_1000039 | 3300027666 | Bacteria | 128517 |
| 227 | Ga0268266_10006494 | 3300028379 | Bacteria | 10704 |
| 228 | Ga0268266_10038101 | 3300028379 | Bacteria | 4094 |
| 229 | Ga0268266_10076394 | 3300028379 | Bacteria | 2911 |
| 230 | Ga0268266_10190208 | 3300028379 | Bacteria | 1874 |
| 231 | Ga0268265_10005132 | 3300028380 | Bacteria | 8967 |
| 232 | Ga0268264_10017383 | 3300028381 | Bacteria | 5891 |
| 233 | Ga0268264_10024577 | 3300028381 | Bacteria | 4919 |
| 234 | Ga0268264_10228034 | 3300028381 | Bacteria | 1718 |
| 235 | Ga0307515_10014013 | 3300028794 | Bacteria | 14919 |
| 236 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 237 | Ga0268256_1031119 | 3300030500 | Bacteria | 1284 |
| 238 | Ga0316181_1085764 | 3300030744 | Bacteria | 2164 |
| 239 | Ga0307509_10001655 | 3300031507 | Bacteria | 37324 |
| 240 | Ga0307412_10009071 | 3300031911 | Bacteria | 5700 |
| 241 | Ga0307409_100223647 | 3300031995 | Bacteria | 1701 |
| 242 | Ga0307416_100376431 | 3300032002 | Bacteria | 1448 |
| 243 | Ga0307415_100040645 | 3300032126 | Bacteria | 3082 |
| 244 | Ga0307415_100819932 | 3300032126 | Bacteria | 851 |
| 245 | Ga0373944_0100050 | 3300035089 | Bacteria | 978 |
| 246 | Ga0373951_0029836 | 3300035091 | Bacteria | 1282 |
| 247 | Ga0373923_0000585 | 3300035111 | Bacteria | 9008 |
| 248 | Ga0373945_0001065 | 3300035116 | Bacteria | 8251 |
| 249 | Ga0373953_0058902 | 3300035117 | Bacteria | 1567 |
| 250 | Ga0373954_0181294 | 3300035118 | Unclassified | 1033 |
| 251 | Ga0373943_0034426 | 3300035170 | Bacteria | 2416 |
| 252 | Ga0373924_0000036 | 3300035410 | Bacteria | 33897 |
| 253 | Ga0373935_0000076 | 3300035692 | Bacteria | 42294 |
| 254 | Ga0373927_0314378 | 3300035695 | Bacteria | 1031 |
| 255 | Ga0373947_0010040 | 3300035725 | Bacteria | 5435 |
| 256 | Ga0373947_0321613 | 3300035725 | Bacteria | 1035 |
| 257 | Ga0373937_0104707 | 3300036401 | Bacteria | 2629 |
| 258 | Ga0373937_0114869 | 3300036401 | Bacteria | 2506 |
| 259 | Ga0373925_0058017 | 3300037068 | Bacteria | 2901 |
| 260 | Ga0395899_0027178 | 3300037312 | Bacteria | 4316 |
| 261 | Ga0395899_0128079 | 3300037312 | Bacteria | 1815 |
| 262 | Ga0395900_0037911 | 3300037418 | Bacteria | 4969 |
| 263 | Ga0395898_0110997 | 3300037466 | Bacteria | 2628 |
| 264 | Ga0395898_0126648 | 3300037466 | Bacteria | 2447 |
| 265 | Ga0395898_0131499 | 3300037466 | Bacteria | 2397 |
| 266 | Ga0395898_0382117 | 3300037466 | Bacteria | 1343 |
| 267 | Ga0395898_0612936 | 3300037466 | Bacteria | 1031 |
| 268 | Ga0395905_0013742 | 3300037471 | Bacteria | 7750 |
| 269 | Ga0436364_0073474 | 3300037853 | Bacteria | 7776 |
| 270 | Ga0436364_1071016 | 3300037853 | Bacteria | 1051 |
| 271 | Ga0395901_0006847 | 3300038443 | Bacteria | 11512 |
| 272 | Ga0395901_0019370 | 3300038443 | Bacteria | 6957 |
| 273 | Ga0395901_0037884 | 3300038443 | Bacteria | 4986 |
| 274 | Ga0395901_0086826 | 3300038443 | Bacteria | 3271 |
| 275 | Ga0395901_0268273 | 3300038443 | Bacteria | 1776 |
| 276 | Ga0395901_0284095 | 3300038443 | Bacteria | 1719 |
| 277 | Ga0395901_0330235 | 3300038443 | Bacteria | 1577 |
| 278 | Ga0436365_0120675 | 3300039437 | Bacteria | 2215 |
| 279 | Ga0436365_0189733 | 3300039437 | Bacteria | 4408 |
| 280 | Ga0436365_0851813 | 3300039437 | Bacteria | 1439 |
| 281 | Ga0436365_1031261 | 3300039437 | Bacteria | 1553 |
| 282 | Ga0436360_0691402 | 3300039438 | Bacteria | 2534 |
| 283 | Ga0436363_0323951 | 3300039450 | Bacteria | 4151 |
| 284 | Ga0436363_0682228 | 3300039450 | Bacteria | 776 |
| 285 | Ga0436363_1129605 | 3300039450 | Bacteria | 3635 |
| 286 | Ga0436363_1413410 | 3300039450 | Bacteria | 2074 |
| 287 | Ga0439450_020075 | 3300042008 | Bacteria | 1422 |
| 288 | Ga0439440_0013627 | 3300042993 | Bacteria | 1746 |
| 289 | Ga0466969_0013797 | 3300044656 | Bacteria | 4254 |
| 290 | Ga0466969_0065082 | 3300044656 | Bacteria | 1763 |
| 291 | Ga0466969_0074835 | 3300044656 | Bacteria | 1624 |
| 292 | Ga0466965_0252074 | 3300044683 | Bacteria | 947 |
| 293 | Ga0466966_0031125 | 3300044684 | Bacteria | 3461 |
| 294 | Ga0466966_0096577 | 3300044684 | Bacteria | 1830 |
| 295 | Ga0466963_0001567 | 3300044694 | Bacteria | 12397 |
| 296 | Ga0466963_0190111 | 3300044694 | Bacteria | 1434 |
| 297 | Ga0466964_0182630 | 3300044706 | Bacteria | 996 |
| 298 | Ga0466957_0218244 | 3300044842 | Bacteria | 1258 |
| 299 | Ga0466960_0000003 | 3300044901 | Bacteria | 86010 |
| 300 | Ga0466960_0004193 | 3300044901 | Bacteria | 5608 |
| 301 | Ga0466960_0072833 | 3300044901 | Bacteria | 1713 |
| 302 | Ga0466959_0007314 | 3300045049 | Bacteria | 7740 |
| 303 | Ga0466959_0020619 | 3300045049 | Bacteria | 4857 |
| 304 | Ga0466958_0098008 | 3300045836 | Bacteria | 1820 |
| 305 | Ga0466967_0037745 | 3300045976 | Bacteria | 4137 |
| 306 | Ga0466967_0077685 | 3300045976 | Bacteria | 2989 |
| 307 | Ga0466967_0104141 | 3300045976 | Bacteria | 2597 |
| 308 | Ga0495592_0133509 | 3300046454 | Bacteria | 1734 |
| 309 | Ga0495638_0018491 | 3300046460 | Bacteria | 4627 |
| 310 | Ga0495641_0133717 | 3300046461 | Bacteria | 1107 |
| 311 | Ga0495651_0003493 | 3300046462 | Bacteria | 12048 |
| 312 | Ga0495651_0041645 | 3300046462 | Bacteria | 3567 |
| 313 | Ga0495651_0218311 | 3300046462 | Bacteria | 1322 |
| 314 | Ga0495653_0040518 | 3300046463 | Bacteria | 3640 |
| 315 | Ga0495650_0000053 | 3300046471 | Bacteria | 316684 |
| 316 | Ga0495608_0034666 | 3300046511 | Bacteria | 3406 |
| 317 | Ga0495608_0063026 | 3300046511 | Bacteria | 2434 |
| 318 | Ga0495608_0089520 | 3300046511 | Bacteria | 1992 |
| 319 | Ga0495618_0038988 | 3300046514 | Bacteria | 2987 |
| 320 | Ga0495652_0132744 | 3300046529 | Bacteria | 1969 |
| 321 | Ga0495652_0181271 | 3300046529 | Bacteria | 1616 |
| 322 | Ga0495652_0418244 | 3300046529 | Bacteria | 945 |
| 323 | Ga0495640_0080594 | 3300046533 | Bacteria | 2165 |
| 324 | Ga0495586_0140300 | 3300046535 | Bacteria | 1356 |
| 325 | Ga0495587_0172804 | 3300046536 | Bacteria | 1227 |
| 326 | Ga0495587_0172851 | 3300046536 | Bacteria | 1227 |
| 327 | Ga0495633_0028682 | 3300046558 | Bacteria | 2710 |
| 328 | Ga0495667_0062079 | 3300046559 | Bacteria | 2449 |
| 329 | Ga0495667_0070933 | 3300046559 | Bacteria | 2273 |
| 330 | Ga0495667_0091068 | 3300046559 | Bacteria | 1975 |
| 331 | Ga0495667_0141545 | 3300046559 | Bacteria | 1550 |
| 332 | Ga0495635_0024270 | 3300046663 | Bacteria | 4227 |
| 333 | Ga0495635_0066834 | 3300046663 | Bacteria | 2466 |
| 334 | Ga0495588_0001283 | 3300046674 | Bacteria | 10760 |
| 335 | Ga0495657_0008756 | 3300046675 | Bacteria | 7718 |
| 336 | Ga0495657_0032852 | 3300046675 | Bacteria | 3617 |
| 337 | Ga0495657_0050762 | 3300046675 | Bacteria | 2788 |
| 338 | Ga0495599_0056169 | 3300046678 | Unclassified | 2464 |
| 339 | Ga0495623_0121236 | 3300046679 | Bacteria | 1574 |
| 340 | Ga0495600_0084087 | 3300046809 | Bacteria | 2077 |
| 341 | Ga0495600_0160014 | 3300046809 | Bacteria | 1456 |
| 342 | Ga0495581_0051748 | 3300047315 | Bacteria | 2372 |
| 343 | Ga0495581_0177078 | 3300047315 | Bacteria | 1247 |
| 344 | Ga0495604_0252207 | 3300047317 | Bacteria | 1202 |
| 345 | Ga0495674_0356678 | 3300047319 | Bacteria | 1186 |
| 346 | Ga0495680_0003123 | 3300047322 | Bacteria | 16496 |
| 347 | Ga0495680_0013996 | 3300047322 | Bacteria | 6974 |
| 348 | Ga0495680_0023768 | 3300047322 | Bacteria | 5093 |
| 349 | Ga0495680_0147113 | 3300047322 | Bacteria | 1720 |
| 350 | Ga0495684_0126768 | 3300047471 | Bacteria | 1920 |
| 351 | Ga0495684_0389851 | 3300047471 | Unclassified | 980 |
| 352 | Ga0495686_0009637 | 3300047472 | Bacteria | 6937 |
| 353 | Ga0495686_0080026 | 3300047472 | Bacteria | 1998 |
| 354 | Ga0495593_0034360 | 3300047673 | Bacteria | 2758 |
| 355 | Ga0495593_0096608 | 3300047673 | Bacteria | 1518 |
| 356 | Ga0495602_0070618 | 3300048088 | Bacteria | 2987 |
| 357 | Ga0495602_0191093 | 3300048088 | Bacteria | 1570 |
| 358 | Ga0496100_0019669 | 3300048903 | Bacteria | 4033 |
| 359 | Ga0496100_0027128 | 3300048903 | Bacteria | 3518 |
| 360 | Ga0496100_0371779 | 3300048903 | Bacteria | 1084 |
| 361 | Ga0496100_0522164 | 3300048903 | Bacteria | 916 |
| 362 | Ga0496101_0001543 | 3300048904 | Bacteria | 13798 |
| 363 | Ga0496101_0003981 | 3300048904 | Bacteria | 9242 |
| 364 | Ga0496101_0029167 | 3300048904 | Bacteria | 3859 |
| 365 | Ga0496101_0164474 | 3300048904 | Bacteria | 1703 |
| 366 | Ga0496101_0190314 | 3300048904 | Bacteria | 1583 |
| 367 | Ga0496101_0222602 | 3300048904 | Bacteria | 1465 |
| 368 | Ga0496101_0265188 | 3300048904 | Bacteria | 1340 |
| 369 | Ga0496102_0019192 | 3300048905 | Bacteria | 6020 |
| 370 | Ga0496102_0070352 | 3300048905 | Bacteria | 3213 |
| 371 | Ga0496102_0414820 | 3300048905 | Bacteria | 1265 |
| 372 | Ga0496102_0448444 | 3300048905 | Bacteria | 1210 |
| 373 | Ga0496102_0661649 | 3300048905 | Bacteria | 967 |
| 374 | Ga0496104_0004166 | 3300048907 | Bacteria | 12549 |
| 375 | Ga0496104_0023668 | 3300048907 | Bacteria | 5648 |
| 376 | Ga0496104_0038312 | 3300048907 | Bacteria | 4485 |
| 377 | Ga0496104_0062403 | 3300048907 | Bacteria | 3533 |
| 378 | Ga0496104_0074328 | 3300048907 | Bacteria | 3236 |
| 379 | Ga0496104_0113270 | 3300048907 | Bacteria | 2601 |
| 380 | Ga0496104_0123570 | 3300048907 | Bacteria | 2485 |
| 381 | Ga0496104_0161918 | 3300048907 | Unclassified | 2146 |
| 382 | Ga0496104_0646165 | 3300048907 | Bacteria | 967 |
| 383 | Ga0496105_0004808 | 3300048908 | Bacteria | 10204 |
| 384 | Ga0496105_0065649 | 3300048908 | Bacteria | 2995 |
| 385 | Ga0496105_0071779 | 3300048908 | Bacteria | 2861 |
| 386 | Ga0496105_0103823 | 3300048908 | Bacteria | 2347 |
| 387 | Ga0496105_0130321 | 3300048908 | Bacteria | 2073 |
| 388 | Ga0496106_0000884 | 3300048909 | Bacteria | 21849 |
| 389 | Ga0496106_0006038 | 3300048909 | Bacteria | 8965 |
| 390 | Ga0496106_0023141 | 3300048909 | Bacteria | 4615 |
| 391 | Ga0496106_0043455 | 3300048909 | Bacteria | 3371 |
| 392 | Ga0496106_0065379 | 3300048909 | Bacteria | 2769 |
| 393 | Ga0496106_0187975 | 3300048909 | Bacteria | 1641 |
| 394 | Ga0496106_0327885 | 3300048909 | Bacteria | 1229 |
| 395 | Ga0496107_0003332 | 3300048910 | Bacteria | 10736 |
| 396 | Ga0496107_0003365 | 3300048910 | Bacteria | 10686 |
| 397 | Ga0496107_0005688 | 3300048910 | Bacteria | 8529 |
| 398 | Ga0496107_0007932 | 3300048910 | Bacteria | 7328 |
| 399 | Ga0496107_0165916 | 3300048910 | Bacteria | 1637 |
| 400 | Ga0496107_0419344 | 3300048910 | Bacteria | 995 |
| 401 | Ga0496108_0000551 | 3300048911 | Bacteria | 29323 |
| 402 | Ga0496108_0018476 | 3300048911 | Bacteria | 5708 |
| 403 | Ga0496108_0059166 | 3300048911 | Bacteria | 3222 |
| 404 | Ga0496108_0155525 | 3300048911 | Bacteria | 1974 |
| 405 | Ga0496108_0383237 | 3300048911 | Bacteria | 1228 |
| 406 | Ga0496108_0749892 | 3300048911 | Bacteria | 844 |
| 407 | Ga0496109_0025708 | 3300048912 | Bacteria | 5248 |
| 408 | Ga0496109_0038936 | 3300048912 | Bacteria | 4301 |
| 409 | Ga0496109_0039536 | 3300048912 | Bacteria | 4269 |
| 410 | Ga0496109_0043473 | 3300048912 | Bacteria | 4072 |
| 411 | Ga0496109_0051085 | 3300048912 | Bacteria | 3765 |
| 412 | Ga0496109_0120904 | 3300048912 | Bacteria | 2440 |
| 413 | Ga0496109_0431781 | 3300048912 | Bacteria | 1244 |
| 414 | Ga0496109_0486662 | 3300048912 | Bacteria | 1165 |
| 415 | Ga0496109_0605663 | 3300048912 | Bacteria | 1032 |
| 416 | Ga0496110_0018313 | 3300048913 | Bacteria | 5872 |
| 417 | Ga0496110_0039626 | 3300048913 | Bacteria | 4103 |
| 418 | Ga0496110_0055005 | 3300048913 | Bacteria | 3502 |
| 419 | Ga0496110_0190769 | 3300048913 | Bacteria | 1861 |
| 420 | Ga0496110_0309149 | 3300048913 | Bacteria | 1440 |
| 421 | Ga0496110_0647069 | 3300048913 | Bacteria | 957 |
| 422 | Ga0496111_0092712 | 3300048914 | Bacteria | 2214 |
| 423 | Ga0496111_0096328 | 3300048914 | Bacteria | 2172 |
| 424 | Ga0496111_0134356 | 3300048914 | Bacteria | 1832 |
| 425 | Ga0496111_0260508 | 3300048914 | Bacteria | 1287 |
| 426 | Ga0496112_0000316 | 3300048915 | Bacteria | 31040 |
| 427 | Ga0496112_0017270 | 3300048915 | Bacteria | 6775 |
| 428 | Ga0496112_0036526 | 3300048915 | Bacteria | 4793 |
| 429 | Ga0496112_0058783 | 3300048915 | Bacteria | 3787 |
| 430 | Ga0496112_0064629 | 3300048915 | Bacteria | 3611 |
| 431 | Ga0496112_0069693 | 3300048915 | Bacteria | 3473 |
| 432 | Ga0496112_0701019 | 3300048915 | Bacteria | 940 |
| 433 | Ga0496113_0004006 | 3300048916 | Bacteria | 8957 |
| 434 | Ga0496113_0044932 | 3300048916 | Bacteria | 3274 |
| 435 | Ga0496113_0066388 | 3300048916 | Bacteria | 2732 |
| 436 | Ga0496113_0193006 | 3300048916 | Bacteria | 1617 |
| 437 | Ga0496113_0241049 | 3300048916 | Bacteria | 1443 |
| 438 | Ga0496114_0001966 | 3300048917 | Bacteria | 15617 |
| 439 | Ga0496114_0008999 | 3300048917 | Bacteria | 7915 |
| 440 | Ga0496114_0087101 | 3300048917 | Bacteria | 2647 |
| 441 | Ga0496114_0136758 | 3300048917 | Bacteria | 2119 |
| 442 | Ga0496114_0455997 | 3300048917 | Bacteria | 1132 |
| 443 | Ga0496115_0002966 | 3300048918 | Bacteria | 12200 |
| 444 | Ga0496115_0007363 | 3300048918 | Bacteria | 8099 |
| 445 | Ga0496115_0027523 | 3300048918 | Bacteria | 4448 |
| 446 | Ga0496115_0220426 | 3300048918 | Bacteria | 1565 |
| 447 | Ga0496115_0574092 | 3300048918 | Bacteria | 899 |
| 448 | Ga0496116_0048566 | 3300048919 | Bacteria | 2847 |
| 449 | Ga0496117_0000036 | 3300048920 | Bacteria | 325635 |
| 450 | Ga0496118_0008209 | 3300048921 | Bacteria | 10846 |
| 451 | Ga0496119_0011541 | 3300048922 | Bacteria | 7297 |
| 452 | Ga0496120_0000495 | 3300048923 | Bacteria | 61601 |
| 453 | Ga0496121_0009582 | 3300048924 | Bacteria | 11094 |
| 454 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 455 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 456 | Ga0496124_0007696 | 3300048927 | Bacteria | 11395 |
| 457 | Ga0496124_0013261 | 3300048927 | Bacteria | 8056 |
| 458 | Ga0496124_0119824 | 3300048927 | Bacteria | 2105 |
| 459 | Ga0501031_0034011 | 3300049568 | Bacteria | 3325 |
| 460 | Ga0501031_0141080 | 3300049568 | Bacteria | 1575 |
| 461 | Ga0501031_0177047 | 3300049568 | Bacteria | 1393 |
| 462 | Ga0501032_0009948 | 3300049569 | Bacteria | 6866 |
| 463 | Ga0501032_0142928 | 3300049569 | Bacteria | 1576 |
| 464 | Ga0501033_0019503 | 3300049570 | Bacteria | 5126 |
| 465 | Ga0501034_0041459 | 3300049571 | Bacteria | 4657 |
| 466 | Ga0501036_0096771 | 3300049572 | Bacteria | 2495 |
| 467 | Ga0501036_0259683 | 3300049572 | Bacteria | 1455 |
| 468 | Ga0501037_0039122 | 3300049573 | Bacteria | 3492 |
| 469 | Ga0501038_0002245 | 3300049574 | Bacteria | 17949 |
| 470 | Ga0501039_0006422 | 3300049575 | Bacteria | 8932 |
| 471 | Ga0501039_0036456 | 3300049575 | Bacteria | 3795 |
| 472 | Ga0501039_0040725 | 3300049575 | Bacteria | 3586 |
| 473 | Ga0501040_0121420 | 3300049576 | Bacteria | 1833 |
| 474 | Ga0501043_0009765 | 3300049579 | Bacteria | 7523 |
| 475 | Ga0501048_0056591 | 3300049582 | Bacteria | 2782 |
| 476 | Ga0501048_0175233 | 3300049582 | Bacteria | 1520 |
| 477 | Ga0501067_0020854 | 3300049583 | Bacteria | 3626 |
| 478 | Ga0501068_0031041 | 3300049584 | Bacteria | 3173 |
| 479 | Ga0501069_0006757 | 3300049585 | Bacteria | 6007 |
| 480 | Ga0501070_0008200 | 3300049586 | Bacteria | 8835 |
| 481 | Ga0501073_0001829 | 3300049589 | Bacteria | 15834 |
| 482 | Ga0501074_0051170 | 3300049590 | Bacteria | 2981 |
| 483 | Ga0501074_0111948 | 3300049590 | Bacteria | 1953 |
| 484 | Ga0501075_0047661 | 3300049591 | Bacteria | 3220 |
| 485 | Ga0501076_0145862 | 3300049592 | Bacteria | 1924 |
| 486 | Ga0501079_0058776 | 3300049741 | Bacteria | 2967 |
| 487 | Ga0501079_0162419 | 3300049741 | Bacteria | 1742 |
| 488 | Ga0501080_0043678 | 3300049742 | Bacteria | 4173 |
| 489 | Ga0501083_0021402 | 3300049744 | Bacteria | 4494 |
| 490 | Ga0501083_0204344 | 3300049744 | Bacteria | 1288 |
| 491 | Ga0501035_0038182 | 3300049822 | Bacteria | 4348 |
| 492 | Ga0501044_0355977 | 3300049823 | Bacteria | 1382 |
| 493 | nmdc:mga03683_5036_c1 | 3300050489 | Bacteria | 4429 |
| 494 | nmdc:mga03n38_108468_c1 | 3300050490 | Bacteria | 1349 |
| 495 | nmdc:mga00v17_2501_c1 | 3300050491 | Bacteria | 9410 |
| 496 | nmdc:mga0k408_44868_c1 | 3300050493 | Bacteria | 2550 |
| 497 | nmdc:mga06z11_275585_c1 | 3300050494 | Bacteria | 996 |
| 498 | nmdc:mga06z11_9768_c1 | 3300050494 | Bacteria | 4055 |
| 499 | nmdc:mga07m45_265882_c1 | 3300050496 | Bacteria | 998 |
| 500 | nmdc:mga0qj67_131398_c1 | 3300050509 | Bacteria | 2028 |
| 501 | nmdc:mga0n895_305603_c1 | 3300050512 | Bacteria | 1612 |
| 502 | nmdc:mga0n895_98095_c1 | 3300050512 | Bacteria | 2937 |
| 503 | nmdc:mga0rr50_107362_c1 | 3300050513 | Bacteria | 2204 |
| 504 | nmdc:mga0a205_188080_c1 | 3300050515 | Bacteria | 1957 |
| 505 | nmdc:mga0a205_94119_c1 | 3300050515 | Bacteria | 2894 |
| 506 | nmdc:mga0sz30_746_c1 | 3300050516 | Bacteria | 11901 |
| 507 | Ga0495601_0283393 | 3300053077 | Bacteria | 1080 |
| 508 | Ga0495595_0014702 | 3300053084 | Unclassified | 3325 |
| 509 | Ga0495619_0314085 | 3300053085 | Bacteria | 1085 |
| 510 | Ga0500562_006399 | 3300053108 | Bacteria | 2970 |
| 511 | Ga0500562_008199 | 3300053108 | Bacteria | 2637 |
| 512 | Ga0500561_0000260 | 3300053137 | Bacteria | 9203 |
| 513 | Ga0500586_017010 | 3300053145 | Bacteria | 2218 |
| 514 | Ga0500616_0006120 | 3300053153 | Bacteria | 7963 |
| 515 | Ga0500624_001065 | 3300053157 | Bacteria | 5317 |
| 516 | Ga0500634_0031025 | 3300053161 | Bacteria | 2913 |
| 517 | Ga0501084_0044535 | 3300054114 | Bacteria | 3715 |
| 518 | Ga0501084_0673552 | 3300054114 | Bacteria | 873 |
| 519 | Ga0587072_004769 | 3300059643 | Bacteria | 1992 |
| 520 | Ga0501082_0066090 | 3300060353 | Bacteria | 3114 |
| 521 | Ga0466962_0190780 | 3300061719 | Bacteria | 1000 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300054114 | Ga0501084_0673552 | Ga0501084_0673552_12_620 | 198 |
| 2 | 3300021377 | Ga0213874_10016978 | Ga0213874_100169781 | 199 |
| 3 | 3300039450 | Ga0436363_0323951 | Ga0436363_0323951_359_1183 | 199 |
| 4 | 3300039450 | Ga0436363_1413410 | Ga0436363_1413410_80_904 | 199 |
| 5 | 3300042008 | Ga0439450_020075 | Ga0439450_020075_52_762 | 204 |
| 6 | 3300005345 | Ga0070692_10053888 | Ga0070692_100538882 | 206 |
| 7 | 3300005548 | Ga0070665_100185705 | Ga0070665_1001857053 | 206 |
| 8 | 3300028379 | Ga0268266_10190208 | Ga0268266_101902081 | 206 |
| 9 | 3300014325 | Ga0163163_11028408 | Ga0163163_110284081 | 210 |
| 10 | 3300003354 | JGI25160J50197_1000459 | JGI25160J50197_10004593 | 211 |
| 11 | 3300025302 | Ga0207426_1000300 | Ga0207426_100030046 | 211 |
| 12 | 3300037466 | Ga0395898_0612936 | Ga0395898_0612936_85_750 | 215 |
| 13 | 3300048905 | Ga0496102_0448444 | Ga0496102_0448444_24_767 | 215 |
| 14 | 3300039450 | Ga0436363_0682228 | Ga0436363_0682228_51_728 | 217 |
| 15 | 3300048904 | Ga0496101_0265188 | Ga0496101_0265188_483_1166 | 218 |
| 16 | 3300020080 | Ga0206350_11519635 | Ga0206350_115196352 | 219 |
| 17 | 3300014968 | Ga0157379_10004216 | Ga0157379_100042164 | 220 |
| 18 | 3300038443 | Ga0395901_0086826 | Ga0395901_0086826_1511_2194 | 220 |
| 19 | 3300044694 | Ga0466963_0190111 | Ga0466963_0190111_567_1259 | 220 |
| 20 | 3300044901 | Ga0466960_0072833 | Ga0466960_0072833_185_877 | 220 |
| 21 | 3300046471 | Ga0495650_0000053 | Ga0495650_0000053_166333_167016 | 220 |
| 22 | 3300048907 | Ga0496104_0646165 | Ga0496104_0646165_140_823 | 220 |
| 23 | 3300048912 | Ga0496109_0605663 | Ga0496109_0605663_291_974 | 220 |
| 24 | 3300048915 | Ga0496112_0069693 | Ga0496112_0069693_1839_2522 | 220 |
| 25 | 3300048916 | Ga0496113_0044932 | Ga0496113_0044932_466_1149 | 220 |
| 26 | 3300053153 | Ga0500616_0006120 | Ga0500616_0006120_6435_7118 | 220 |
| 27 | 3300044901 | Ga0466960_0000003 | Ga0466960_0000003_70924_71622 | 222 |
| 28 | 3300048915 | Ga0496112_0064629 | Ga0496112_0064629_158_970 | 222 |
| 29 | 3300048927 | Ga0496124_0119824 | Ga0496124_0119824_369_1070 | 223 |
| 30 | 3300014968 | Ga0157379_10010734 | Ga0157379_100107343 | 227 |
| 31 | 3300035170 | Ga0373943_0034426 | Ga0373943_0034426_1660_2400 | 227 |
| 32 | 3300006852 | Ga0075433_10172258 | Ga0075433_101722582 | 229 |
| 33 | 3300006871 | Ga0075434_100247990 | Ga0075434_1002479902 | 229 |
| 34 | 3300028381 | Ga0268264_10228034 | Ga0268264_102280343 | 229 |
| 35 | 3300044901 | Ga0466960_0004193 | Ga0466960_0004193_1678_2409 | 229 |
| 36 | 3300047315 | Ga0495581_0051748 | Ga0495581_0051748_1401_2171 | 230 |
| 37 | 3300047319 | Ga0495674_0356678 | Ga0495674_0356678_83_877 | 230 |
| 38 | 3300005334 | Ga0068869_100051337 | Ga0068869_1000513372 | 231 |
| 39 | 3300025942 | Ga0207689_10065300 | Ga0207689_100653003 | 231 |
| 40 | 3300036401 | Ga0373937_0104707 | Ga0373937_0104707_1299_2039 | 231 |
| 41 | 3300047472 | Ga0495686_0009637 | Ga0495686_0009637_3247_3996 | 231 |
| 42 | 3300047472 | Ga0495686_0080026 | Ga0495686_0080026_715_1455 | 231 |
| 43 | 3300005471 | Ga0070698_100597426 | Ga0070698_1005974262 | 232 |
| 44 | 3300006028 | Ga0070717_10603253 | Ga0070717_106032531 | 232 |
| 45 | 3300046559 | Ga0495667_0141545 | Ga0495667_0141545_732_1526 | 232 |
| 46 | 3300048911 | Ga0496108_0383237 | Ga0496108_0383237_370_1161 | 232 |
| 47 | 3300048913 | Ga0496110_0055005 | Ga0496110_0055005_1437_2228 | 232 |
| 48 | 3300048915 | Ga0496112_0036526 | Ga0496112_0036526_725_1516 | 232 |
| 49 | 3300005439 | Ga0070711_100127724 | Ga0070711_1001277242 | 233 |
| 50 | 3300006163 | Ga0070715_10034131 | Ga0070715_100341314 | 233 |
| 51 | 3300009148 | Ga0105243_10547355 | Ga0105243_105473552 | 233 |
| 52 | 3300013306 | Ga0163162_10593024 | Ga0163162_105930242 | 233 |
| 53 | 3300025905 | Ga0207685_10020251 | Ga0207685_100202514 | 233 |
| 54 | 3300025906 | Ga0207699_10100182 | Ga0207699_101001824 | 233 |
| 55 | 3300048909 | Ga0496106_0065379 | Ga0496106_0065379_1812_2528 | 233 |
| 56 | 3300048910 | Ga0496107_0419344 | Ga0496107_0419344_63_779 | 233 |
| 57 | 3300048912 | Ga0496109_0051085 | Ga0496109_0051085_1748_2464 | 233 |
| 58 | 3300048912 | Ga0496109_0431781 | Ga0496109_0431781_448_1164 | 233 |
| 59 | 3300048913 | Ga0496110_0018313 | Ga0496110_0018313_1123_1839 | 233 |
| 60 | 3300048914 | Ga0496111_0092712 | Ga0496111_0092712_852_1568 | 233 |
| 61 | 3300048914 | Ga0496111_0134356 | Ga0496111_0134356_260_976 | 233 |
| 62 | 3300048915 | Ga0496112_0701019 | Ga0496112_0701019_41_757 | 233 |
| 63 | 3300048917 | Ga0496114_0087101 | Ga0496114_0087101_650_1366 | 233 |
| 64 | 3300048918 | Ga0496115_0027523 | Ga0496115_0027523_1444_2160 | 233 |
| 65 | 3300049568 | Ga0501031_0141080 | Ga0501031_0141080_21_815 | 233 |
| 66 | 3300049572 | Ga0501036_0259683 | Ga0501036_0259683_633_1427 | 233 |
| 67 | 3300049575 | Ga0501039_0040725 | Ga0501039_0040725_1863_2657 | 233 |
| 68 | 3300003203 | JGI25406J46586_10001925 | JGI25406J46586_100019256 | 234 |
| 69 | 3300005985 | Ga0081539_10000969 | Ga0081539_1000096922 | 234 |
| 70 | 3300032126 | Ga0307415_100819932 | Ga0307415_1008199321 | 234 |
| 71 | 3300037466 | Ga0395898_0131499 | Ga0395898_0131499_433_1233 | 234 |
| 72 | 3300049568 | Ga0501031_0177047 | Ga0501031_0177047_539_1339 | 234 |
| 73 | 3300049569 | Ga0501032_0142928 | Ga0501032_0142928_710_1510 | 234 |
| 74 | 3300049575 | Ga0501039_0036456 | Ga0501039_0036456_2468_3268 | 234 |
| 75 | 3300049576 | Ga0501040_0121420 | Ga0501040_0121420_719_1519 | 234 |
| 76 | 3300049582 | Ga0501048_0175233 | Ga0501048_0175233_574_1374 | 234 |
| 77 | 3300049590 | Ga0501074_0111948 | Ga0501074_0111948_1046_1846 | 234 |
| 78 | 3300049591 | Ga0501075_0047661 | Ga0501075_0047661_1888_2688 | 234 |
| 79 | 3300049592 | Ga0501076_0145862 | Ga0501076_0145862_581_1381 | 234 |
| 80 | 3300049744 | Ga0501083_0204344 | Ga0501083_0204344_464_1264 | 234 |
| 81 | 3300054114 | Ga0501084_0044535 | Ga0501084_0044535_651_1451 | 234 |
| 82 | iso_pu_bacteria | 2721755763 | 2723877702 | 234 |
| 83 | 3300005548 | Ga0070665_100050192 | Ga0070665_1000501923 | 235 |
| 84 | 3300005563 | Ga0068855_100131379 | Ga0068855_1001313792 | 235 |
| 85 | 3300005564 | Ga0070664_100653253 | Ga0070664_1006532532 | 235 |
| 86 | 3300005614 | Ga0068856_100087335 | Ga0068856_1000873352 | 235 |
| 87 | 3300005937 | Ga0081455_10012614 | Ga0081455_100126145 | 235 |
| 88 | 3300009176 | Ga0105242_10325827 | Ga0105242_103258272 | 235 |
| 89 | 3300009177 | Ga0105248_10338475 | Ga0105248_103384752 | 235 |
| 90 | 3300013102 | Ga0157371_10046360 | Ga0157371_100463602 | 235 |
| 91 | 3300013306 | Ga0163162_10626195 | Ga0163162_106261952 | 235 |
| 92 | 3300025945 | Ga0207679_10528081 | Ga0207679_105280812 | 235 |
| 93 | 3300026078 | Ga0207702_10052200 | Ga0207702_100522004 | 235 |
| 94 | 3300037466 | Ga0395898_0126648 | Ga0395898_0126648_217_1023 | 235 |
| 95 | 3300038443 | Ga0395901_0330235 | Ga0395901_0330235_212_1018 | 235 |
| 96 | 3300047322 | Ga0495680_0147113 | Ga0495680_0147113_785_1600 | 235 |
| 97 | 3300048912 | Ga0496109_0486662 | Ga0496109_0486662_129_929 | 235 |
| 98 | 3300048915 | Ga0496112_0017270 | Ga0496112_0017270_5782_6588 | 235 |
| 99 | 3300050494 | nmdc:mga06z11_9768_c1 | nmdc:mga06z11_9768_c1_3226_4014 | 235 |
| 100 | 3300035089 | Ga0373944_0100050 | Ga0373944_0100050_177_947 | 236 |
| 101 | 3300035111 | Ga0373923_0000585 | Ga0373923_0000585_2290_3060 | 236 |
| 102 | 3300035116 | Ga0373945_0001065 | Ga0373945_0001065_6833_7603 | 236 |
| 103 | 3300035410 | Ga0373924_0000036 | Ga0373924_0000036_28514_29284 | 236 |
| 104 | 3300035692 | Ga0373935_0000076 | Ga0373935_0000076_5301_6071 | 236 |
| 105 | 3300035725 | Ga0373947_0010040 | Ga0373947_0010040_3706_4476 | 236 |
| 106 | 3300037068 | Ga0373925_0058017 | Ga0373925_0058017_228_998 | 236 |
| 107 | 3300046511 | Ga0495608_0063026 | Ga0495608_0063026_55_825 | 236 |
| 108 | 3300046535 | Ga0495586_0140300 | Ga0495586_0140300_554_1324 | 236 |
| 109 | 3300047471 | Ga0495684_0126768 | Ga0495684_0126768_703_1473 | 236 |
| 110 | 3300047673 | Ga0495593_0034360 | Ga0495593_0034360_871_1641 | 236 |
| 111 | 3300048908 | Ga0496105_0130321 | Ga0496105_0130321_660_1430 | 236 |
| 112 | 3300048915 | Ga0496112_0000316 | Ga0496112_0000316_7546_8316 | 236 |
| 113 | 3300048916 | Ga0496113_0004006 | Ga0496113_0004006_6678_7448 | 236 |
| 114 | iso_pu_bacteria | 2643221558 | 2643810982 | 236 |
| 115 | 3300005347 | Ga0070668_100006105 | Ga0070668_1000061053 | 237 |
| 116 | 3300005355 | Ga0070671_100096403 | Ga0070671_1000964032 | 237 |
| 117 | 3300005367 | Ga0070667_100000714 | Ga0070667_10000071425 | 237 |
| 118 | 3300005435 | Ga0070714_100183638 | Ga0070714_1001836382 | 237 |
| 119 | 3300005444 | Ga0070694_100168044 | Ga0070694_1001680442 | 237 |
| 120 | 3300005468 | Ga0070707_100537519 | Ga0070707_1005375192 | 237 |
| 121 | 3300005548 | Ga0070665_100044923 | Ga0070665_1000449236 | 237 |
| 122 | 3300005841 | Ga0068863_100172972 | Ga0068863_1001729723 | 237 |
| 123 | 3300005844 | Ga0068862_100003205 | Ga0068862_10000320510 | 237 |
| 124 | 3300006175 | Ga0070712_100125671 | Ga0070712_1001256713 | 237 |
| 125 | 3300006871 | Ga0075434_100098474 | Ga0075434_1000984745 | 237 |
| 126 | 3300007076 | Ga0075435_100053155 | Ga0075435_1000531554 | 237 |
| 127 | 3300009148 | Ga0105243_10026247 | Ga0105243_100262473 | 237 |
| 128 | 3300009176 | Ga0105242_10681704 | Ga0105242_106817042 | 237 |
| 129 | 3300009553 | Ga0105249_10001446 | Ga0105249_1000144610 | 237 |
| 130 | 3300014968 | Ga0157379_10018185 | Ga0157379_100181853 | 237 |
| 131 | 3300014969 | Ga0157376_10075956 | Ga0157376_100759561 | 237 |
| 132 | 3300021441 | Ga0213871_10041621 | Ga0213871_100416212 | 237 |
| 133 | 3300025903 | Ga0207680_10129226 | Ga0207680_101292262 | 237 |
| 134 | 3300025922 | Ga0207646_10379081 | Ga0207646_103790812 | 237 |
| 135 | 3300025929 | Ga0207664_10044631 | Ga0207664_100446312 | 237 |
| 136 | 3300025935 | Ga0207709_10011270 | Ga0207709_100112704 | 237 |
| 137 | 3300025961 | Ga0207712_10004438 | Ga0207712_100044389 | 237 |
| 138 | 3300025972 | Ga0207668_10002606 | Ga0207668_1000260610 | 237 |
| 139 | 3300025986 | Ga0207658_10012090 | Ga0207658_100120906 | 237 |
| 140 | 3300026035 | Ga0207703_10094651 | Ga0207703_100946513 | 237 |
| 141 | 3300026121 | Ga0207683_10072818 | Ga0207683_100728182 | 237 |
| 142 | 3300028379 | Ga0268266_10076394 | Ga0268266_100763943 | 237 |
| 143 | 3300028380 | Ga0268265_10005132 | Ga0268265_100051326 | 237 |
| 144 | 3300028381 | Ga0268264_10017383 | Ga0268264_100173837 | 237 |
| 145 | 3300031507 | Ga0307509_10001655 | Ga0307509_1000165528 | 237 |
| 146 | 3300031995 | Ga0307409_100223647 | Ga0307409_1002236472 | 237 |
| 147 | 3300037312 | Ga0395899_0027178 | Ga0395899_0027178_2695_3471 | 237 |
| 148 | 3300037312 | Ga0395899_0128079 | Ga0395899_0128079_971_1780 | 237 |
| 149 | 3300037418 | Ga0395900_0037911 | Ga0395900_0037911_2586_3362 | 237 |
| 150 | 3300037466 | Ga0395898_0110997 | Ga0395898_0110997_959_1735 | 237 |
| 151 | 3300037471 | Ga0395905_0013742 | Ga0395905_0013742_5299_6075 | 237 |
| 152 | 3300038443 | Ga0395901_0019370 | Ga0395901_0019370_1731_2507 | 237 |
| 153 | 3300038443 | Ga0395901_0268273 | Ga0395901_0268273_302_1111 | 237 |
| 154 | 3300039437 | Ga0436365_1031261 | Ga0436365_1031261_475_1284 | 237 |
| 155 | 3300044656 | Ga0466969_0065082 | Ga0466969_0065082_754_1491 | 237 |
| 156 | 3300046454 | Ga0495592_0133509 | Ga0495592_0133509_541_1350 | 237 |
| 157 | 3300046462 | Ga0495651_0041645 | Ga0495651_0041645_1981_2790 | 237 |
| 158 | 3300046462 | Ga0495651_0218311 | Ga0495651_0218311_56_865 | 237 |
| 159 | 3300046536 | Ga0495587_0172804 | Ga0495587_0172804_10_819 | 237 |
| 160 | 3300046559 | Ga0495667_0070933 | Ga0495667_0070933_1418_2227 | 237 |
| 161 | 3300046663 | Ga0495635_0066834 | Ga0495635_0066834_155_964 | 237 |
| 162 | 3300046675 | Ga0495657_0050762 | Ga0495657_0050762_78_887 | 237 |
| 163 | 3300046809 | Ga0495600_0084087 | Ga0495600_0084087_283_1092 | 237 |
| 164 | 3300047322 | Ga0495680_0013996 | Ga0495680_0013996_4049_4858 | 237 |
| 165 | 3300048903 | Ga0496100_0019669 | Ga0496100_0019669_2933_3742 | 237 |
| 166 | 3300048903 | Ga0496100_0522164 | Ga0496100_0522164_61_870 | 237 |
| 167 | 3300048904 | Ga0496101_0003981 | Ga0496101_0003981_6809_7618 | 237 |
| 168 | 3300048907 | Ga0496104_0113270 | Ga0496104_0113270_1166_1984 | 237 |
| 169 | 3300048908 | Ga0496105_0071779 | Ga0496105_0071779_1502_2320 | 237 |
| 170 | 3300048909 | Ga0496106_0187975 | Ga0496106_0187975_418_1227 | 237 |
| 171 | 3300048909 | Ga0496106_0327885 | Ga0496106_0327885_59_877 | 237 |
| 172 | 3300048910 | Ga0496107_0003332 | Ga0496107_0003332_1535_2344 | 237 |
| 173 | 3300048910 | Ga0496107_0007932 | Ga0496107_0007932_2333_3142 | 237 |
| 174 | 3300048910 | Ga0496107_0165916 | Ga0496107_0165916_61_879 | 237 |
| 175 | 3300048913 | Ga0496110_0647069 | Ga0496110_0647069_51_869 | 237 |
| 176 | 3300048917 | Ga0496114_0001966 | Ga0496114_0001966_11930_12739 | 237 |
| 177 | 3300048918 | Ga0496115_0574092 | Ga0496115_0574092_49_858 | 237 |
| 178 | 3300048922 | Ga0496119_0011541 | Ga0496119_0011541_3878_4696 | 237 |
| 179 | 3300048924 | Ga0496121_0009582 | Ga0496121_0009582_5891_6709 | 237 |
| 180 | 3300050512 | nmdc:mga0n895_98095_c1 | nmdc:mga0n895_98095_c1_239_1048 | 237 |
| 181 | 3300050513 | nmdc:mga0rr50_107362_c1 | nmdc:mga0rr50_107362_c1_510_1319 | 237 |
| 182 | 3300050515 | nmdc:mga0a205_94119_c1 | nmdc:mga0a205_94119_c1_1937_2746 | 237 |
| 183 | 3300053085 | Ga0495619_0314085 | Ga0495619_0314085_73_882 | 237 |
| 184 | 3300005329 | Ga0070683_100247370 | Ga0070683_1002473702 | 238 |
| 185 | 3300005337 | Ga0070682_100142357 | Ga0070682_1001423572 | 238 |
| 186 | 3300005339 | Ga0070660_100272928 | Ga0070660_1002729281 | 238 |
| 187 | 3300005340 | Ga0070689_100206921 | Ga0070689_1002069212 | 238 |
| 188 | 3300005344 | Ga0070661_100130654 | Ga0070661_1001306542 | 238 |
| 189 | 3300005345 | Ga0070692_10028129 | Ga0070692_100281293 | 238 |
| 190 | 3300005347 | Ga0070668_100112750 | Ga0070668_1001127503 | 238 |
| 191 | 3300005353 | Ga0070669_100485861 | Ga0070669_1004858611 | 238 |
| 192 | 3300005355 | Ga0070671_100176770 | Ga0070671_1001767702 | 238 |
| 193 | 3300005356 | Ga0070674_100164653 | Ga0070674_1001646532 | 238 |
| 194 | 3300005366 | Ga0070659_100165864 | Ga0070659_1001658643 | 238 |
| 195 | 3300005434 | Ga0070709_10005748 | Ga0070709_100057485 | 238 |
| 196 | 3300005435 | Ga0070714_100349458 | Ga0070714_1003494582 | 238 |
| 197 | 3300005436 | Ga0070713_100087691 | Ga0070713_1000876912 | 238 |
| 198 | 3300005436 | Ga0070713_100315488 | Ga0070713_1003154881 | 238 |
| 199 | 3300005437 | Ga0070710_10014368 | Ga0070710_100143682 | 238 |
| 200 | 3300005437 | Ga0070710_10016218 | Ga0070710_100162182 | 238 |
| 201 | 3300005439 | Ga0070711_100010492 | Ga0070711_1000104924 | 238 |
| 202 | 3300005439 | Ga0070711_100030464 | Ga0070711_1000304644 | 238 |
| 203 | 3300005444 | Ga0070694_100008823 | Ga0070694_1000088234 | 238 |
| 204 | 3300005445 | Ga0070708_100033942 | Ga0070708_1000339423 | 238 |
| 205 | 3300005445 | Ga0070708_100051688 | Ga0070708_1000516883 | 238 |
| 206 | 3300005467 | Ga0070706_100005596 | Ga0070706_10000559610 | 238 |
| 207 | 3300005467 | Ga0070706_100022266 | Ga0070706_1000222662 | 238 |
| 208 | 3300005468 | Ga0070707_100086155 | Ga0070707_1000861553 | 238 |
| 209 | 3300005471 | Ga0070698_100011143 | Ga0070698_1000111433 | 238 |
| 210 | 3300005471 | Ga0070698_100152198 | Ga0070698_1001521982 | 238 |
| 211 | 3300005471 | Ga0070698_100452038 | Ga0070698_1004520381 | 238 |
| 212 | 3300005518 | Ga0070699_100001932 | Ga0070699_1000019325 | 238 |
| 213 | 3300005518 | Ga0070699_100080219 | Ga0070699_1000802192 | 238 |
| 214 | 3300005535 | Ga0070684_100137362 | Ga0070684_1001373622 | 238 |
| 215 | 3300005535 | Ga0070684_100153746 | Ga0070684_1001537462 | 238 |
| 216 | 3300005536 | Ga0070697_100056849 | Ga0070697_1000568491 | 238 |
| 217 | 3300005539 | Ga0068853_100038485 | Ga0068853_1000384854 | 238 |
| 218 | 3300005543 | Ga0070672_100068411 | Ga0070672_1000684113 | 238 |
| 219 | 3300005544 | Ga0070686_100273307 | Ga0070686_1002733072 | 238 |
| 220 | 3300005547 | Ga0070693_100280014 | Ga0070693_1002800141 | 238 |
| 221 | 3300005549 | Ga0070704_100032095 | Ga0070704_1000320953 | 238 |
| 222 | 3300005615 | Ga0070702_100132072 | Ga0070702_1001320722 | 238 |
| 223 | 3300005616 | Ga0068852_100313909 | Ga0068852_1003139091 | 238 |
| 224 | 3300005617 | Ga0068859_100260164 | Ga0068859_1002601641 | 238 |
| 225 | 3300005719 | Ga0068861_100203198 | Ga0068861_1002031982 | 238 |
| 226 | 3300005840 | Ga0068870_10024159 | Ga0068870_100241592 | 238 |
| 227 | 3300005843 | Ga0068860_100220799 | Ga0068860_1002207992 | 238 |
| 228 | 3300005937 | Ga0081455_10174259 | Ga0081455_101742592 | 238 |
| 229 | 3300006028 | Ga0070717_10007603 | Ga0070717_100076038 | 238 |
| 230 | 3300006028 | Ga0070717_10017450 | Ga0070717_100174505 | 238 |
| 231 | 3300006028 | Ga0070717_10018881 | Ga0070717_100188816 | 238 |
| 232 | 3300006028 | Ga0070717_10072333 | Ga0070717_100723332 | 238 |
| 233 | 3300006028 | Ga0070717_10167569 | Ga0070717_101675692 | 238 |
| 234 | 3300006028 | Ga0070717_10440373 | Ga0070717_104403732 | 238 |
| 235 | 3300006163 | Ga0070715_10075787 | Ga0070715_100757871 | 238 |
| 236 | 3300006173 | Ga0070716_100025729 | Ga0070716_1000257292 | 238 |
| 237 | 3300006175 | Ga0070712_100226895 | Ga0070712_1002268952 | 238 |
| 238 | 3300006358 | Ga0068871_100395400 | Ga0068871_1003954002 | 238 |
| 239 | 3300006847 | Ga0075431_100352612 | Ga0075431_1003526122 | 238 |
| 240 | 3300006871 | Ga0075434_100299371 | Ga0075434_1002993713 | 238 |
| 241 | 3300006931 | Ga0097620_100260172 | Ga0097620_1002601723 | 238 |
| 242 | 3300009101 | Ga0105247_10031535 | Ga0105247_100315352 | 238 |
| 243 | 3300009176 | Ga0105242_10043115 | Ga0105242_100431152 | 238 |
| 244 | 3300009177 | Ga0105248_10140384 | Ga0105248_101403842 | 238 |
| 245 | 3300009545 | Ga0105237_10098848 | Ga0105237_100988482 | 238 |
| 246 | 3300010375 | Ga0105239_10204458 | Ga0105239_102044583 | 238 |
| 247 | 3300011119 | Ga0105246_10581008 | Ga0105246_105810081 | 238 |
| 248 | 3300013306 | Ga0163162_10157609 | Ga0163162_101576093 | 238 |
| 249 | 3300014325 | Ga0163163_10788596 | Ga0163163_107885961 | 238 |
| 250 | 3300014326 | Ga0157380_10523913 | Ga0157380_105239132 | 238 |
| 251 | 3300014969 | Ga0157376_10180260 | Ga0157376_101802602 | 238 |
| 252 | 3300021377 | Ga0213874_10017898 | Ga0213874_100178982 | 238 |
| 253 | 3300021384 | Ga0213876_10057020 | Ga0213876_100570202 | 238 |
| 254 | 3300021384 | Ga0213876_10094508 | Ga0213876_100945082 | 238 |
| 255 | 3300021384 | Ga0213876_10116357 | Ga0213876_101163571 | 238 |
| 256 | 3300021388 | Ga0213875_10006448 | Ga0213875_100064487 | 238 |
| 257 | 3300025885 | Ga0207653_10022761 | Ga0207653_100227613 | 238 |
| 258 | 3300025898 | Ga0207692_10014943 | Ga0207692_100149432 | 238 |
| 259 | 3300025900 | Ga0207710_10122997 | Ga0207710_101229971 | 238 |
| 260 | 3300025901 | Ga0207688_10016830 | Ga0207688_100168304 | 238 |
| 261 | 3300025903 | Ga0207680_10251102 | Ga0207680_102511021 | 238 |
| 262 | 3300025904 | Ga0207647_10049250 | Ga0207647_100492503 | 238 |
| 263 | 3300025906 | Ga0207699_10101808 | Ga0207699_101018082 | 238 |
| 264 | 3300025907 | Ga0207645_10075461 | Ga0207645_100754613 | 238 |
| 265 | 3300025908 | Ga0207643_10001930 | Ga0207643_100019303 | 238 |
| 266 | 3300025910 | Ga0207684_10007915 | Ga0207684_100079154 | 238 |
| 267 | 3300025910 | Ga0207684_10020183 | Ga0207684_100201835 | 238 |
| 268 | 3300025911 | Ga0207654_10350682 | Ga0207654_103506822 | 238 |
| 269 | 3300025914 | Ga0207671_10155114 | Ga0207671_101551143 | 238 |
| 270 | 3300025915 | Ga0207693_10002392 | Ga0207693_1000239210 | 238 |
| 271 | 3300025915 | Ga0207693_10005702 | Ga0207693_100057026 | 238 |
| 272 | 3300025915 | Ga0207693_10015494 | Ga0207693_100154944 | 238 |
| 273 | 3300025916 | Ga0207663_10018429 | Ga0207663_100184294 | 238 |
| 274 | 3300025918 | Ga0207662_10000263 | Ga0207662_1000026319 | 238 |
| 275 | 3300025919 | Ga0207657_10031844 | Ga0207657_100318441 | 238 |
| 276 | 3300025920 | Ga0207649_10323562 | Ga0207649_103235621 | 238 |
| 277 | 3300025922 | Ga0207646_10021030 | Ga0207646_100210306 | 238 |
| 278 | 3300025922 | Ga0207646_10067243 | Ga0207646_100672432 | 238 |
| 279 | 3300025922 | Ga0207646_10080672 | Ga0207646_100806723 | 238 |
| 280 | 3300025923 | Ga0207681_10269146 | Ga0207681_102691462 | 238 |
| 281 | 3300025928 | Ga0207700_10054849 | Ga0207700_100548492 | 238 |
| 282 | 3300025928 | Ga0207700_10106639 | Ga0207700_101066392 | 238 |
| 283 | 3300025928 | Ga0207700_10138232 | Ga0207700_101382322 | 238 |
| 284 | 3300025929 | Ga0207664_10099759 | Ga0207664_100997592 | 238 |
| 285 | 3300025929 | Ga0207664_10161683 | Ga0207664_101616832 | 238 |
| 286 | 3300025929 | Ga0207664_10324562 | Ga0207664_103245622 | 238 |
| 287 | 3300025931 | Ga0207644_10064047 | Ga0207644_100640472 | 238 |
| 288 | 3300025931 | Ga0207644_10243446 | Ga0207644_102434463 | 238 |
| 289 | 3300025933 | Ga0207706_10520280 | Ga0207706_105202801 | 238 |
| 290 | 3300025934 | Ga0207686_10027667 | Ga0207686_100276672 | 238 |
| 291 | 3300025939 | Ga0207665_10000520 | Ga0207665_1000052011 | 238 |
| 292 | 3300025940 | Ga0207691_10017927 | Ga0207691_100179274 | 238 |
| 293 | 3300025941 | Ga0207711_10341197 | Ga0207711_103411972 | 238 |
| 294 | 3300025942 | Ga0207689_10008875 | Ga0207689_100088751 | 238 |
| 295 | 3300025960 | Ga0207651_10232470 | Ga0207651_102324703 | 238 |
| 296 | 3300025981 | Ga0207640_10392980 | Ga0207640_103929801 | 238 |
| 297 | 3300026035 | Ga0207703_10053934 | Ga0207703_100539342 | 238 |
| 298 | 3300026067 | Ga0207678_10001771 | Ga0207678_100017714 | 238 |
| 299 | 3300026075 | Ga0207708_10050239 | Ga0207708_100502394 | 238 |
| 300 | 3300026078 | Ga0207702_10171932 | Ga0207702_101719322 | 238 |
| 301 | 3300026089 | Ga0207648_10004835 | Ga0207648_1000483511 | 238 |
| 302 | 3300026116 | Ga0207674_10641724 | Ga0207674_106417241 | 238 |
| 303 | 3300026118 | Ga0207675_100000619 | Ga0207675_10000061916 | 238 |
| 304 | 3300026121 | Ga0207683_10020088 | Ga0207683_100200887 | 238 |
| 305 | 3300028794 | Ga0307515_10014013 | Ga0307515_100140132 | 238 |
| 306 | 3300032002 | Ga0307416_100376431 | Ga0307416_1003764312 | 238 |
| 307 | 3300032126 | Ga0307415_100040645 | Ga0307415_1000406453 | 238 |
| 308 | 3300035091 | Ga0373951_0029836 | Ga0373951_0029836_69_923 | 238 |
| 309 | 3300035117 | Ga0373953_0058902 | Ga0373953_0058902_572_1384 | 238 |
| 310 | 3300035118 | Ga0373954_0181294 | Ga0373954_0181294_55_867 | 238 |
| 311 | 3300035695 | Ga0373927_0314378 | Ga0373927_0314378_183_995 | 238 |
| 312 | 3300035725 | Ga0373947_0321613 | Ga0373947_0321613_86_898 | 238 |
| 313 | 3300036401 | Ga0373937_0114869 | Ga0373937_0114869_1482_2294 | 238 |
| 314 | 3300037466 | Ga0395898_0382117 | Ga0395898_0382117_402_1214 | 238 |
| 315 | 3300037853 | Ga0436364_0073474 | Ga0436364_0073474_2910_3734 | 238 |
| 316 | 3300037853 | Ga0436364_1071016 | Ga0436364_1071016_131_961 | 238 |
| 317 | 3300038443 | Ga0395901_0006847 | Ga0395901_0006847_3255_4067 | 238 |
| 318 | 3300038443 | Ga0395901_0037884 | Ga0395901_0037884_224_1036 | 238 |
| 319 | 3300038443 | Ga0395901_0284095 | Ga0395901_0284095_150_962 | 238 |
| 320 | 3300039437 | Ga0436365_0120675 | Ga0436365_0120675_1161_1985 | 238 |
| 321 | 3300039437 | Ga0436365_0189733 | Ga0436365_0189733_541_1365 | 238 |
| 322 | 3300039450 | Ga0436363_1129605 | Ga0436363_1129605_520_1332 | 238 |
| 323 | 3300042993 | Ga0439440_0013627 | Ga0439440_0013627_121_933 | 238 |
| 324 | 3300044656 | Ga0466969_0074835 | Ga0466969_0074835_61_876 | 238 |
| 325 | 3300044684 | Ga0466966_0096577 | Ga0466966_0096577_595_1407 | 238 |
| 326 | 3300044694 | Ga0466963_0001567 | Ga0466963_0001567_1376_2200 | 238 |
| 327 | 3300044706 | Ga0466964_0182630 | Ga0466964_0182630_172_984 | 238 |
| 328 | 3300045976 | Ga0466967_0077685 | Ga0466967_0077685_680_1492 | 238 |
| 329 | 3300045976 | Ga0466967_0104141 | Ga0466967_0104141_1676_2530 | 238 |
| 330 | 3300046460 | Ga0495638_0018491 | Ga0495638_0018491_58_870 | 238 |
| 331 | 3300046461 | Ga0495641_0133717 | Ga0495641_0133717_237_1049 | 238 |
| 332 | 3300046462 | Ga0495651_0003493 | Ga0495651_0003493_809_1627 | 238 |
| 333 | 3300046463 | Ga0495653_0040518 | Ga0495653_0040518_1779_2591 | 238 |
| 334 | 3300046511 | Ga0495608_0034666 | Ga0495608_0034666_2316_3128 | 238 |
| 335 | 3300046511 | Ga0495608_0089520 | Ga0495608_0089520_434_1246 | 238 |
| 336 | 3300046514 | Ga0495618_0038988 | Ga0495618_0038988_250_1062 | 238 |
| 337 | 3300046529 | Ga0495652_0132744 | Ga0495652_0132744_1090_1902 | 238 |
| 338 | 3300046529 | Ga0495652_0181271 | Ga0495652_0181271_38_856 | 238 |
| 339 | 3300046529 | Ga0495652_0418244 | Ga0495652_0418244_72_884 | 238 |
| 340 | 3300046533 | Ga0495640_0080594 | Ga0495640_0080594_958_1770 | 238 |
| 341 | 3300046536 | Ga0495587_0172851 | Ga0495587_0172851_296_1114 | 238 |
| 342 | 3300046559 | Ga0495667_0062079 | Ga0495667_0062079_202_1020 | 238 |
| 343 | 3300046559 | Ga0495667_0091068 | Ga0495667_0091068_211_1023 | 238 |
| 344 | 3300046663 | Ga0495635_0024270 | Ga0495635_0024270_3076_3888 | 238 |
| 345 | 3300046675 | Ga0495657_0008756 | Ga0495657_0008756_6294_7112 | 238 |
| 346 | 3300046675 | Ga0495657_0032852 | Ga0495657_0032852_1117_1929 | 238 |
| 347 | 3300046678 | Ga0495599_0056169 | Ga0495599_0056169_1539_2351 | 238 |
| 348 | 3300046679 | Ga0495623_0121236 | Ga0495623_0121236_675_1487 | 238 |
| 349 | 3300046809 | Ga0495600_0160014 | Ga0495600_0160014_345_1157 | 238 |
| 350 | 3300047315 | Ga0495581_0177078 | Ga0495581_0177078_216_1028 | 238 |
| 351 | 3300047317 | Ga0495604_0252207 | Ga0495604_0252207_345_1157 | 238 |
| 352 | 3300047322 | Ga0495680_0003123 | Ga0495680_0003123_8846_9664 | 238 |
| 353 | 3300047322 | Ga0495680_0023768 | Ga0495680_0023768_1489_2301 | 238 |
| 354 | 3300047471 | Ga0495684_0389851 | Ga0495684_0389851_72_884 | 238 |
| 355 | 3300047673 | Ga0495593_0096608 | Ga0495593_0096608_11_823 | 238 |
| 356 | 3300048088 | Ga0495602_0070618 | Ga0495602_0070618_367_1179 | 238 |
| 357 | 3300048088 | Ga0495602_0191093 | Ga0495602_0191093_60_878 | 238 |
| 358 | 3300048903 | Ga0496100_0027128 | Ga0496100_0027128_169_981 | 238 |
| 359 | 3300048904 | Ga0496101_0001543 | Ga0496101_0001543_6694_7506 | 238 |
| 360 | 3300048904 | Ga0496101_0029167 | Ga0496101_0029167_1747_2562 | 238 |
| 361 | 3300048904 | Ga0496101_0190314 | Ga0496101_0190314_499_1353 | 238 |
| 362 | 3300048904 | Ga0496101_0222602 | Ga0496101_0222602_67_879 | 238 |
| 363 | 3300048905 | Ga0496102_0019192 | Ga0496102_0019192_5175_5990 | 238 |
| 364 | 3300048905 | Ga0496102_0414820 | Ga0496102_0414820_344_1162 | 238 |
| 365 | 3300048905 | Ga0496102_0661649 | Ga0496102_0661649_72_926 | 238 |
| 366 | 3300048907 | Ga0496104_0023668 | Ga0496104_0023668_2147_2959 | 238 |
| 367 | 3300048907 | Ga0496104_0038312 | Ga0496104_0038312_1360_2214 | 238 |
| 368 | 3300048907 | Ga0496104_0123570 | Ga0496104_0123570_853_1665 | 238 |
| 369 | 3300048907 | Ga0496104_0161918 | Ga0496104_0161918_556_1368 | 238 |
| 370 | 3300048908 | Ga0496105_0004808 | Ga0496105_0004808_2774_3586 | 238 |
| 371 | 3300048908 | Ga0496105_0065649 | Ga0496105_0065649_2166_2978 | 238 |
| 372 | 3300048909 | Ga0496106_0000884 | Ga0496106_0000884_3484_4296 | 238 |
| 373 | 3300048909 | Ga0496106_0006038 | Ga0496106_0006038_3130_3945 | 238 |
| 374 | 3300048909 | Ga0496106_0043455 | Ga0496106_0043455_1256_2110 | 238 |
| 375 | 3300048910 | Ga0496107_0003365 | Ga0496107_0003365_5712_6524 | 238 |
| 376 | 3300048910 | Ga0496107_0005688 | Ga0496107_0005688_335_1150 | 238 |
| 377 | 3300048911 | Ga0496108_0018476 | Ga0496108_0018476_4430_5242 | 238 |
| 378 | 3300048911 | Ga0496108_0059166 | Ga0496108_0059166_1080_1895 | 238 |
| 379 | 3300048911 | Ga0496108_0155525 | Ga0496108_0155525_883_1737 | 238 |
| 380 | 3300048912 | Ga0496109_0025708 | Ga0496109_0025708_1575_2390 | 238 |
| 381 | 3300048912 | Ga0496109_0039536 | Ga0496109_0039536_2115_2969 | 238 |
| 382 | 3300048912 | Ga0496109_0043473 | Ga0496109_0043473_2759_3571 | 238 |
| 383 | 3300048912 | Ga0496109_0120904 | Ga0496109_0120904_205_1017 | 238 |
| 384 | 3300048913 | Ga0496110_0190769 | Ga0496110_0190769_220_1026 | 238 |
| 385 | 3300048913 | Ga0496110_0309149 | Ga0496110_0309149_284_1096 | 238 |
| 386 | 3300048914 | Ga0496111_0096328 | Ga0496111_0096328_1345_2151 | 238 |
| 387 | 3300048914 | Ga0496111_0260508 | Ga0496111_0260508_192_1004 | 238 |
| 388 | 3300048915 | Ga0496112_0058783 | Ga0496112_0058783_2158_2970 | 238 |
| 389 | 3300048916 | Ga0496113_0066388 | Ga0496113_0066388_1695_2549 | 238 |
| 390 | 3300048916 | Ga0496113_0193006 | Ga0496113_0193006_599_1411 | 238 |
| 391 | 3300048917 | Ga0496114_0008999 | Ga0496114_0008999_6906_7718 | 238 |
| 392 | 3300048917 | Ga0496114_0136758 | Ga0496114_0136758_299_1114 | 238 |
| 393 | 3300048917 | Ga0496114_0455997 | Ga0496114_0455997_110_964 | 238 |
| 394 | 3300048918 | Ga0496115_0002966 | Ga0496115_0002966_5038_5850 | 238 |
| 395 | 3300048918 | Ga0496115_0007363 | Ga0496115_0007363_689_1504 | 238 |
| 396 | 3300048918 | Ga0496115_0220426 | Ga0496115_0220426_560_1414 | 238 |
| 397 | 3300049568 | Ga0501031_0034011 | Ga0501031_0034011_2108_2917 | 238 |
| 398 | 3300049569 | Ga0501032_0009948 | Ga0501032_0009948_5000_5809 | 238 |
| 399 | 3300049570 | Ga0501033_0019503 | Ga0501033_0019503_1633_2442 | 238 |
| 400 | 3300049571 | Ga0501034_0041459 | Ga0501034_0041459_1052_1861 | 238 |
| 401 | 3300049572 | Ga0501036_0096771 | Ga0501036_0096771_1052_1861 | 238 |
| 402 | 3300049573 | Ga0501037_0039122 | Ga0501037_0039122_2325_3134 | 238 |
| 403 | 3300049574 | Ga0501038_0002245 | Ga0501038_0002245_16724_17533 | 238 |
| 404 | 3300049575 | Ga0501039_0006422 | Ga0501039_0006422_4087_4896 | 238 |
| 405 | 3300049579 | Ga0501043_0009765 | Ga0501043_0009765_5001_5810 | 238 |
| 406 | 3300049582 | Ga0501048_0056591 | Ga0501048_0056591_1625_2434 | 238 |
| 407 | 3300049583 | Ga0501067_0020854 | Ga0501067_0020854_894_1703 | 238 |
| 408 | 3300049584 | Ga0501068_0031041 | Ga0501068_0031041_2064_2873 | 238 |
| 409 | 3300049585 | Ga0501069_0006757 | Ga0501069_0006757_1164_1973 | 238 |
| 410 | 3300049586 | Ga0501070_0008200 | Ga0501070_0008200_415_1224 | 238 |
| 411 | 3300049589 | Ga0501073_0001829 | Ga0501073_0001829_11275_12084 | 238 |
| 412 | 3300049590 | Ga0501074_0051170 | Ga0501074_0051170_1705_2514 | 238 |
| 413 | 3300049741 | Ga0501079_0058776 | Ga0501079_0058776_28_840 | 238 |
| 414 | 3300049741 | Ga0501079_0162419 | Ga0501079_0162419_493_1302 | 238 |
| 415 | 3300049742 | Ga0501080_0043678 | Ga0501080_0043678_173_982 | 238 |
| 416 | 3300049744 | Ga0501083_0021402 | Ga0501083_0021402_421_1230 | 238 |
| 417 | 3300049822 | Ga0501035_0038182 | Ga0501035_0038182_341_1150 | 238 |
| 418 | 3300049823 | Ga0501044_0355977 | Ga0501044_0355977_440_1249 | 238 |
| 419 | 3300050509 | nmdc:mga0qj67_131398_c1 | nmdc:mga0qj67_131398_c1_850_1662 | 238 |
| 420 | 3300053084 | Ga0495595_0014702 | Ga0495595_0014702_2431_3243 | 238 |
| 421 | 3300053108 | Ga0500562_008199 | Ga0500562_008199_748_1521 | 238 |
| 422 | 3300053145 | Ga0500586_017010 | Ga0500586_017010_670_1443 | 238 |
| 423 | 3300060353 | Ga0501082_0066090 | Ga0501082_0066090_397_1206 | 238 |
| 424 | 3300003856 | Ga0058692_1004350 | Ga0058692_10043505 | 239 |
| 425 | 3300005564 | Ga0070664_100079854 | Ga0070664_1000798542 | 239 |
| 426 | 3300005614 | Ga0068856_100262991 | Ga0068856_1002629912 | 239 |
| 427 | 3300005985 | Ga0081539_10001899 | Ga0081539_1000189914 | 239 |
| 428 | 3300009148 | Ga0105243_10232122 | Ga0105243_102321222 | 239 |
| 429 | 3300013307 | Ga0157372_10883196 | Ga0157372_108831961 | 239 |
| 430 | 3300025302 | Ga0207426_1000748 | Ga0207426_10007482 | 239 |
| 431 | 3300025935 | Ga0207709_10114032 | Ga0207709_101140322 | 239 |
| 432 | 3300025945 | Ga0207679_10047466 | Ga0207679_100474662 | 239 |
| 433 | 3300026023 | Ga0207677_10243252 | Ga0207677_102432522 | 239 |
| 434 | 3300027312 | Ga0209371_1000729 | Ga0209371_100072932 | 239 |
| 435 | 3300028379 | Ga0268266_10038101 | Ga0268266_100381012 | 239 |
| 436 | 3300030500 | Ga0268256_1031119 | Ga0268256_10311192 | 239 |
| 437 | 3300044656 | Ga0466969_0013797 | Ga0466969_0013797_365_1177 | 239 |
| 438 | 3300044683 | Ga0466965_0252074 | Ga0466965_0252074_52_903 | 239 |
| 439 | 3300044684 | Ga0466966_0031125 | Ga0466966_0031125_559_1371 | 239 |
| 440 | 3300044842 | Ga0466957_0218244 | Ga0466957_0218244_232_1044 | 239 |
| 441 | 3300045049 | Ga0466959_0007314 | Ga0466959_0007314_4701_5513 | 239 |
| 442 | 3300045049 | Ga0466959_0020619 | Ga0466959_0020619_2834_3685 | 239 |
| 443 | 3300045836 | Ga0466958_0098008 | Ga0466958_0098008_316_1128 | 239 |
| 444 | 3300045976 | Ga0466967_0037745 | Ga0466967_0037745_1805_2617 | 239 |
| 445 | 3300046558 | Ga0495633_0028682 | Ga0495633_0028682_435_1202 | 239 |
| 446 | 3300048905 | Ga0496102_0070352 | Ga0496102_0070352_37_870 | 239 |
| 447 | 3300048907 | Ga0496104_0004166 | Ga0496104_0004166_8115_8948 | 239 |
| 448 | 3300048909 | Ga0496106_0023141 | Ga0496106_0023141_1939_2772 | 239 |
| 449 | 3300048911 | Ga0496108_0000551 | Ga0496108_0000551_13554_14387 | 239 |
| 450 | 3300048911 | Ga0496108_0749892 | Ga0496108_0749892_25_783 | 239 |
| 451 | 3300048912 | Ga0496109_0038936 | Ga0496109_0038936_1591_2424 | 239 |
| 452 | 3300048913 | Ga0496110_0039626 | Ga0496110_0039626_3156_3989 | 239 |
| 453 | 3300048916 | Ga0496113_0241049 | Ga0496113_0241049_551_1363 | 239 |
| 454 | 3300050512 | nmdc:mga0n895_305603_c1 | nmdc:mga0n895_305603_c1_436_1182 | 239 |
| 455 | 3300050515 | nmdc:mga0a205_188080_c1 | nmdc:mga0a205_188080_c1_1024_1770 | 239 |
| 456 | 3300053077 | Ga0495601_0283393 | Ga0495601_0283393_227_1048 | 239 |
| 457 | 3300053157 | Ga0500624_001065 | Ga0500624_001065_4524_5291 | 239 |
| 458 | 3300053161 | Ga0500634_0031025 | Ga0500634_0031025_1940_2707 | 239 |
| 459 | 3300061719 | Ga0466962_0190780 | Ga0466962_0190780_36_848 | 239 |
| 460 | iso_pu_bacteria | 2537561587 | 2537873676 | 239 |
| 461 | iso_pu_bacteria | 2554235003 | 2554246035 | 239 |
| 462 | iso_pu_bacteria | 2558860242 | 2559296199 | 239 |
| 463 | iso_pu_bacteria | 2599185210 | 2599604651 | 239 |
| 464 | iso_pu_bacteria | 2600255279 | 2601612928 | 239 |
| 465 | iso_pu_bacteria | 2600255308 | 2601748474 | 239 |
| 466 | iso_pu_bacteria | 2643221693 | 2644522975 | 239 |
| 467 | iso_pu_bacteria | 2808606387 | 2808988420 | 239 |
| 468 | iso_pu_bacteria | 2838675328 | 2838679711 | 239 |
| 469 | iso_pu_bacteria | 2838714209 | 2838717519 | 239 |
| 470 | iso_pu_bacteria | 2838719591 | 2838724280 | 239 |
| 471 | iso_pu_bacteria | 2838724970 | 2838729403 | 239 |
| 472 | iso_pu_bacteria | 2841846520 | 2841850831 | 239 |
| 473 | iso_pu_bacteria | 2841859092 | 2841861734 | 239 |
| 474 | iso_pu_bacteria | 2842124991 | 2842129636 | 239 |
| 475 | iso_pu_bacteria | 2842130223 | 2842134780 | 239 |
| 476 | iso_pu_bacteria | 2842152218 | 2842156702 | 239 |
| 477 | iso_pu_bacteria | 2842170452 | 2842172960 | 239 |
| 478 | iso_pu_bacteria | 2842175837 | 2842180320 | 239 |
| 479 | iso_pu_bacteria | 2842187318 | 2842192020 | 239 |
| 480 | iso_pu_bacteria | 2842211629 | 2842216336 | 239 |
| 481 | iso_pu_bacteria | 2842224351 | 2842229056 | 239 |
| 482 | iso_pu_bacteria | 2842515876 | 2842518000 | 239 |
| 483 | iso_pu_bacteria | 2899792073 | 2899792822 | 239 |
| 484 | iso_pu_bacteria | 2899845264 | 2899848542 | 239 |
| 485 | iso_pu_bacteria | 2919114240 | 2919119271 | 239 |
| 486 | iso_pu_bacteria | 2926754445 | 2926759301 | 239 |
| 487 | iso_pu_bacteria | 2926760298 | 2926763148 | 239 |
| 488 | iso_pu_bacteria | 2933006813 | 2933011308 | 239 |
| 489 | iso_pu_bacteria | 2933011516 | 2933013629 | 239 |
| 490 | iso_pu_bacteria | 2933594066 | 2933596931 | 239 |
| 491 | iso_pu_bacteria | 2979089926 | 2979091830 | 239 |
| 492 | iso_pu_bacteria | 2979095461 | 2979097345 | 239 |
| 493 | iso_pu_bacteria | 2979100975 | 2979104335 | 239 |
| 494 | iso_pu_bacteria | 2984509177 | 2984511084 | 239 |
| 495 | iso_pu_bacteria | 2984518228 | 2984522553 | 239 |
| 496 | iso_pu_bacteria | 2984537506 | 2984541857 | 239 |
| 497 | iso_pu_bacteria | 2984601300 | 2984604212 | 239 |
| 498 | iso_pu_bacteria | 650716007 | 650842596 | 239 |
| 499 | 3300039437 | Ga0436365_0851813 | Ga0436365_0851813_194_1066 | 240 |
| 500 | 3300003187 | JGI25151J46595_10018848 | JGI25151J46595_100188482 | 241 |
| 501 | 3300003320 | rootH2_10205803 | rootH2_102058032 | 241 |
| 502 | 3300003856 | Ga0058692_1001859 | Ga0058692_10018595 | 241 |
| 503 | 3300006048 | Ga0075363_100156503 | Ga0075363_1001565031 | 241 |
| 504 | 3300006186 | Ga0075369_10192290 | Ga0075369_101922901 | 241 |
| 505 | 3300006195 | Ga0075366_10231691 | Ga0075366_102316911 | 241 |
| 506 | 3300006353 | Ga0075370_10273184 | Ga0075370_102731842 | 241 |
| 507 | 3300006948 | Ga0099826_10035288 | Ga0099826_100352882 | 241 |
| 508 | 3300013102 | Ga0157371_10000268 | Ga0157371_1000026838 | 241 |
| 509 | 3300013104 | Ga0157370_10009085 | Ga0157370_100090853 | 241 |
| 510 | 3300025294 | Ga0209025_1000227 | Ga0209025_1000227106 | 241 |
| 511 | 3300027312 | Ga0209371_1000022 | Ga0209371_1000022508 | 241 |
| 512 | 3300027666 | Ga0209282_1000039 | Ga0209282_100003959 | 241 |
| 513 | 3300028379 | Ga0268266_10006494 | Ga0268266_1000649410 | 241 |
| 514 | 3300030500 | Ga0268256_1000019 | Ga0268256_100001912 | 241 |
| 515 | 3300030744 | Ga0316181_1085764 | Ga0316181_10857642 | 241 |
| 516 | 3300046674 | Ga0495588_0001283 | Ga0495588_0001283_9241_10020 | 241 |
| 517 | 3300048919 | Ga0496116_0048566 | Ga0496116_0048566_232_1011 | 241 |
| 518 | 3300048920 | Ga0496117_0000036 | Ga0496117_0000036_43006_43785 | 241 |
| 519 | 3300048921 | Ga0496118_0008209 | Ga0496118_0008209_6036_6815 | 241 |
| 520 | 3300048923 | Ga0496120_0000495 | Ga0496120_0000495_128_907 | 241 |
| 521 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_847755_848534 | 241 |
| 522 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_847755_848534 | 241 |
| 523 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_963149_963928 | 241 |
| 524 | 3300048927 | Ga0496124_0007696 | Ga0496124_0007696_6837_7616 | 241 |
| 525 | 3300048927 | Ga0496124_0013261 | Ga0496124_0013261_1997_2776 | 241 |
| 526 | 3300050489 | nmdc:mga03683_5036_c1 | nmdc:mga03683_5036_c1_2517_3296 | 241 |
| 527 | 3300050490 | nmdc:mga03n38_108468_c1 | nmdc:mga03n38_108468_c1_101_880 | 241 |
| 528 | 3300050491 | nmdc:mga00v17_2501_c1 | nmdc:mga00v17_2501_c1_470_1249 | 241 |
| 529 | 3300050493 | nmdc:mga0k408_44868_c1 | nmdc:mga0k408_44868_c1_678_1457 | 241 |
| 530 | 3300050494 | nmdc:mga06z11_275585_c1 | nmdc:mga06z11_275585_c1_164_943 | 241 |
| 531 | 3300050496 | nmdc:mga07m45_265882_c1 | nmdc:mga07m45_265882_c1_194_973 | 241 |
| 532 | 3300050516 | nmdc:mga0sz30_746_c1 | nmdc:mga0sz30_746_c1_1822_2601 | 241 |
| 533 | 3300053137 | Ga0500561_0000260 | Ga0500561_0000260_7920_8699 | 241 |
| 534 | 3300059643 | Ga0587072_004769 | Ga0587072_004769_100_879 | 241 |
| 535 | 3300009098 | Ga0105245_10024784 | Ga0105245_100247844 | 242 |
| 536 | 3300009148 | Ga0105243_10096268 | Ga0105243_100962682 | 242 |
| 537 | 3300013297 | Ga0157378_10018830 | Ga0157378_100188306 | 242 |
| 538 | 3300013308 | Ga0157375_10124685 | Ga0157375_101246852 | 242 |
| 539 | 3300014745 | Ga0157377_10387827 | Ga0157377_103878272 | 242 |
| 540 | 3300025935 | Ga0207709_10074524 | Ga0207709_100745244 | 242 |
| 541 | 3300031911 | Ga0307412_10009071 | Ga0307412_100090712 | 243 |
| 542 | 3300048903 | Ga0496100_0371779 | Ga0496100_0371779_130_879 | 245 |
| 543 | 3300048904 | Ga0496101_0164474 | Ga0496101_0164474_897_1646 | 245 |
| 544 | 3300048907 | Ga0496104_0062403 | Ga0496104_0062403_1603_2352 | 245 |
| 545 | 3300048907 | Ga0496104_0074328 | Ga0496104_0074328_1286_2035 | 245 |
| 546 | 3300048908 | Ga0496105_0103823 | Ga0496105_0103823_1087_1836 | 245 |
| 547 | 3300039438 | Ga0436360_0691402 | Ga0436360_0691402_473_1246 | 247 |
| 548 | 3300006028 | Ga0070717_10065196 | Ga0070717_100651962 | 248 |
| 549 | 3300006175 | Ga0070712_100304572 | Ga0070712_1003045722 | 248 |
| 550 | 3300025915 | Ga0207693_10101015 | Ga0207693_101010152 | 248 |
| 551 | 3300053108 | Ga0500562_006399 | Ga0500562_006399_1300_2091 | 248 |
| 552 | 3300002239 | JGI24034J26672_10016614 | JGI24034J26672_100166142 | 253 |
| 553 | 3300005335 | Ga0070666_10007782 | Ga0070666_100077826 | 253 |
| 554 | 3300005347 | Ga0070668_100000586 | Ga0070668_10000058612 | 253 |
| 555 | 3300005367 | Ga0070667_100000100 | Ga0070667_10000010053 | 253 |
| 556 | 3300005841 | Ga0068863_100000075 | Ga0068863_10000007561 | 253 |
| 557 | 3300005843 | Ga0068860_100019066 | Ga0068860_1000190664 | 253 |
| 558 | 3300025903 | Ga0207680_10000730 | Ga0207680_1000073014 | 253 |
| 559 | 3300025923 | Ga0207681_10088114 | Ga0207681_100881142 | 253 |
| 560 | 3300025972 | Ga0207668_10000707 | Ga0207668_100007078 | 253 |
| 561 | 3300025986 | Ga0207658_10000079 | Ga0207658_1000007953 | 253 |
| 562 | 3300026088 | Ga0207641_10000381 | Ga0207641_1000038140 | 253 |
| 563 | 3300028381 | Ga0268264_10024577 | Ga0268264_100245774 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6t7m-assembly1.cif.gz_C | crystal structure of salmonella typhimurium fabg at 2.65 a resolution | 0.9735 | 4 | 250 |
| 1q7c-assembly1.cif.gz_A | the structure of betaketoacyl-[acp] reductase y151f mutant in complex with nadph fragment | 0.9728 | 4 | 250 |
| 4dqx-assembly1.cif.gz_D | crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 | 0.9727 | 2 | 251 |
| 4npc-assembly1.cif.gz_A | crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis | 0.9725 | 2 | 253 |
| 1q7b-assembly1.cif.gz_D | the structure of betaketoacyl-[acp] reductase from e. coli in complex with nadp+ | 0.9721 | 4 | 250 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4npcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9725 | 2 | 253 | 3.40.50.720 |
| af_P9WGR9_1_247_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9664 | 2 | 249 | 3.40.50.720 |
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9658 | 83 | 250 | 3.40.50.720 |
| 5itvD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9657 | 1 | 253 | 3.40.50.720 |
| 4ni5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.964 | 3 | 253 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A229T7P3-F1-model_v4 | Short-chain dehydrogenase | 0.9851 | 3 | 253 |
GO:0016491
|
| AF-A0A3A9T5U6-F1-model_v4 | deleted | 0.9818 | 2 | 253 |
|
| AF-A0A847XKT4-F1-model_v4 | SDR family oxidoreductase | 0.9807 | 3 | 253 |
GO:0016491
|
| AF-A0A6L4AD96-F1-model_v4 | SDR family oxidoreductase | 0.9803 | 3 | 252 |
GO:0016616
|
| AF-A0A395KB85-F1-model_v4 | deleted | 0.9781 | 1 | 253 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar