F464078

General Info

Members Datasets Scaffolds Average Seq Length
563 328 521 264

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0851813|Ga0436365_0851813_194_1066
Length 290
Sequence MLHDMNSILSQPAGVTFGPRLEGRVAAVTGGAAGIGRAICLRLAAEGARVAVLDLDRSRAQQTVDAAGGGGFAAEVDVSDSAAVEAAVAAVENELGALDIFVNNAGASGAEHIMRISARLAAQREEAAVGAIKTPLDALVRLRDDEWRTLLGIHLDGTFYGTRSAVRSMVARGTGGAIVNMASICGIEGCTGHPHYSAAKAGIIGFTRAVAKELILQGIRVNAVAPGFIDTTTARGHLSDNRTEMVRRTPAGRLGTPEEVAATVAFLVSDDASYFVGATLSPNGGLVTAV

Samples

Sample ID Description Type Environment
1 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
2 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
3 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
4 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
5 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
6 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
7 2643221558 Rhizobium sp. Root149 Isolate Unclassified
8 2643221693 Rhizobium sp. Root491 Isolate Unclassified
9 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
10 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
11 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
12 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
13 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
14 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
15 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
16 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
17 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
18 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
19 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
20 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
21 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
22 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
23 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
24 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
25 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
26 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
27 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
28 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
29 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
30 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
31 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
32 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
33 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
34 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
35 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
36 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
37 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
38 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
39 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
40 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
41 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
42 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
43 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
46 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
188 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
217 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
319 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
320 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
323 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
328 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.36
Metatranscriptomes 0.36
Isolates 7.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.71
Bulb 0
Endosphere 4.26
Nodule 3.37
Rhizoplane 16.52
Rhizosphere 68.21
Stem 0
Stem Tuber 0
Unclassified 6.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10016614 3300002239 Bacteria 1135
2 JGI25151J46595_10018848 3300003187 Bacteria 2950
3 JGI25406J46586_10001925 3300003203 Bacteria 9789
4 rootH2_10205803 3300003320 Bacteria 1953
5 JGI25160J50197_1000459 3300003354 Bacteria 25342
6 Ga0058692_1001859 3300003856 Bacteria 7413
7 Ga0058692_1004350 3300003856 Bacteria 4209
8 Ga0070683_100247370 3300005329 Bacteria 1696
9 Ga0068869_100051337 3300005334 Bacteria 2992
10 Ga0070666_10007782 3300005335 Bacteria 6619
11 Ga0070682_100142357 3300005337 Bacteria 1636
12 Ga0070660_100272928 3300005339 Bacteria 1382
13 Ga0070689_100206921 3300005340 Bacteria 1604
14 Ga0070661_100130654 3300005344 Bacteria 1886
15 Ga0070692_10028129 3300005345 Bacteria 2793
16 Ga0070692_10053888 3300005345 Bacteria 2099
17 Ga0070668_100000586 3300005347 Bacteria 24429
18 Ga0070668_100006105 3300005347 Bacteria 8933
19 Ga0070668_100112750 3300005347 Bacteria 2165
20 Ga0070669_100485861 3300005353 Bacteria 1023
21 Ga0070671_100096403 3300005355 Bacteria 2480
22 Ga0070671_100176770 3300005355 Bacteria 1807
23 Ga0070674_100164653 3300005356 Bacteria 1685
24 Ga0070659_100165864 3300005366 Bacteria 1807
25 Ga0070667_100000100 3300005367 Bacteria 108128
26 Ga0070667_100000714 3300005367 Bacteria 31992
27 Ga0070709_10005748 3300005434 Bacteria 6726
28 Ga0070714_100183638 3300005435 Bacteria 1904
29 Ga0070714_100349458 3300005435 Unclassified 1388
30 Ga0070713_100087691 3300005436 Bacteria 2670
31 Ga0070713_100315488 3300005436 Bacteria 1442
32 Ga0070710_10014368 3300005437 Bacteria 3985
33 Ga0070710_10016218 3300005437 Bacteria 3786
34 Ga0070711_100010492 3300005439 Bacteria 5736
35 Ga0070711_100030464 3300005439 Bacteria 3572
36 Ga0070711_100127724 3300005439 Bacteria 1889
37 Ga0070694_100008823 3300005444 Bacteria 6176
38 Ga0070694_100168044 3300005444 Bacteria 1614
39 Ga0070708_100033942 3300005445 Bacteria 4435
40 Ga0070708_100051688 3300005445 Bacteria 3641
41 Ga0070706_100005596 3300005467 Bacteria 11956
42 Ga0070706_100022266 3300005467 Bacteria 5834
43 Ga0070707_100086155 3300005468 Bacteria 3037
44 Ga0070707_100537519 3300005468 Bacteria 1131
45 Ga0070698_100011143 3300005471 Bacteria 9551
46 Ga0070698_100152198 3300005471 Bacteria 2261
47 Ga0070698_100452038 3300005471 Bacteria 1220
48 Ga0070698_100597426 3300005471 Bacteria 1044
49 Ga0070699_100001932 3300005518 Bacteria 18701
50 Ga0070699_100080219 3300005518 Bacteria 2844
51 Ga0070684_100137362 3300005535 Bacteria 2209
52 Ga0070684_100153746 3300005535 Bacteria 2085
53 Ga0070697_100056849 3300005536 Bacteria 3183
54 Ga0068853_100038485 3300005539 Bacteria 4074
55 Ga0070672_100068411 3300005543 Bacteria 2816
56 Ga0070686_100273307 3300005544 Bacteria 1243
57 Ga0070693_100280014 3300005547 Bacteria 1116
58 Ga0070665_100044923 3300005548 Bacteria 4435
59 Ga0070665_100050192 3300005548 Bacteria 4186
60 Ga0070665_100185705 3300005548 Bacteria 2080
61 Ga0070704_100032095 3300005549 Bacteria 3539
62 Ga0068855_100131379 3300005563 Bacteria 2859
63 Ga0070664_100079854 3300005564 Bacteria 2817
64 Ga0070664_100653253 3300005564 Bacteria 977
65 Ga0068856_100087335 3300005614 Bacteria 3100
66 Ga0068856_100262991 3300005614 Bacteria 1741
67 Ga0070702_100132072 3300005615 Bacteria 1578
68 Ga0068852_100313909 3300005616 Bacteria 1520
69 Ga0068859_100260164 3300005617 Bacteria 1826
70 Ga0068861_100203198 3300005719 Bacteria 1664
71 Ga0068870_10024159 3300005840 Bacteria 3005
72 Ga0068863_100000075 3300005841 Bacteria 109825
73 Ga0068863_100172972 3300005841 Bacteria 2072
74 Ga0068860_100019066 3300005843 Bacteria 6661
75 Ga0068860_100220799 3300005843 Bacteria 1840
76 Ga0068862_100003205 3300005844 Bacteria 14175
77 Ga0081455_10012614 3300005937 Bacteria 8419
78 Ga0081455_10174259 3300005937 Bacteria 1635
79 Ga0081539_10000969 3300005985 Bacteria 53653
80 Ga0081539_10001899 3300005985 Bacteria 32393
81 Ga0070717_10007603 3300006028 Bacteria 8052
82 Ga0070717_10017450 3300006028 Bacteria 5586
83 Ga0070717_10018881 3300006028 Bacteria 5394
84 Ga0070717_10065196 3300006028 Bacteria 3027
85 Ga0070717_10072333 3300006028 Bacteria 2879
86 Ga0070717_10167569 3300006028 Bacteria 1909
87 Ga0070717_10440373 3300006028 Bacteria 1173
88 Ga0070717_10603253 3300006028 Bacteria 996
89 Ga0075363_100156503 3300006048 Bacteria 1288
90 Ga0070715_10034131 3300006163 Bacteria 2083
91 Ga0070715_10075787 3300006163 Bacteria 1514
92 Ga0070716_100025729 3300006173 Bacteria 3144
93 Ga0070712_100125671 3300006175 Bacteria 1937
94 Ga0070712_100226895 3300006175 Unclassified 1481
95 Ga0070712_100304572 3300006175 Bacteria 1291
96 Ga0075369_10192290 3300006186 Bacteria 940
97 Ga0075366_10231691 3300006195 Bacteria 1125
98 Ga0075370_10273184 3300006353 Bacteria 1003
99 Ga0068871_100395400 3300006358 Bacteria 1230
100 Ga0075431_100352612 3300006847 Bacteria 1479
101 Ga0075433_10172258 3300006852 Bacteria 1926
102 Ga0075434_100098474 3300006871 Bacteria 2929
103 Ga0075434_100247990 3300006871 Bacteria 1800
104 Ga0075434_100299371 3300006871 Bacteria 1629
105 Ga0097620_100260172 3300006931 Bacteria 1826
106 Ga0099826_10035288 3300006948 Bacteria 3559
107 Ga0075435_100053155 3300007076 Bacteria 3266
108 Ga0105245_10024784 3300009098 Bacteria 5271
109 Ga0105247_10031535 3300009101 Bacteria 3217
110 Ga0105243_10026247 3300009148 Bacteria 4458
111 Ga0105243_10096268 3300009148 Bacteria 2448
112 Ga0105243_10232122 3300009148 Bacteria 1637
113 Ga0105243_10547355 3300009148 Bacteria 1105
114 Ga0105242_10043115 3300009176 Bacteria 3648
115 Ga0105242_10325827 3300009176 Bacteria 1411
116 Ga0105242_10681704 3300009176 Bacteria 1003
117 Ga0105248_10140384 3300009177 Bacteria 2725
118 Ga0105248_10338475 3300009177 Bacteria 1694
119 Ga0105237_10098848 3300009545 Bacteria 2909
120 Ga0105249_10001446 3300009553 Bacteria 20789
121 Ga0105239_10204458 3300010375 Bacteria 2213
122 Ga0105246_10581008 3300011119 Bacteria 965
123 Ga0157371_10000268 3300013102 Bacteria 70868
124 Ga0157371_10046360 3300013102 Bacteria 3091
125 Ga0157370_10009085 3300013104 Bacteria 10660
126 Ga0157378_10018830 3300013297 Bacteria 6068
127 Ga0163162_10157609 3300013306 Bacteria 2391
128 Ga0163162_10593024 3300013306 Bacteria 1235
129 Ga0163162_10626195 3300013306 Bacteria 1201
130 Ga0157372_10883196 3300013307 Bacteria 1037
131 Ga0157375_10124685 3300013308 Bacteria 2689
132 Ga0163163_10788596 3300014325 Bacteria 1013
133 Ga0163163_11028408 3300014325 Bacteria 887
134 Ga0157380_10523913 3300014326 Bacteria 1157
135 Ga0157377_10387827 3300014745 Bacteria 948
136 Ga0157379_10004216 3300014968 Bacteria 12277
137 Ga0157379_10010734 3300014968 Bacteria 7983
138 Ga0157379_10018185 3300014968 Bacteria 6193
139 Ga0157376_10075956 3300014969 Bacteria 2869
140 Ga0157376_10180260 3300014969 Bacteria 1930
141 Ga0206350_11519635 3300020080 Bacteria 1058
142 Ga0213874_10016978 3300021377 Bacteria 1946
143 Ga0213874_10017898 3300021377 Bacteria 1908
144 Ga0213876_10057020 3300021384 Bacteria 2062
145 Ga0213876_10094508 3300021384 Bacteria 1584
146 Ga0213876_10116357 3300021384 Bacteria 1419
147 Ga0213875_10006448 3300021388 Bacteria 6156
148 Ga0213871_10041621 3300021441 Bacteria 1235
149 Ga0209025_1000227 3300025294 Bacteria 132244
150 Ga0207426_1000300 3300025302 Bacteria 96857
151 Ga0207426_1000748 3300025302 Bacteria 36575
152 Ga0207653_10022761 3300025885 Bacteria 1992
153 Ga0207692_10014943 3300025898 Bacteria 3404
154 Ga0207710_10122997 3300025900 Bacteria 1241
155 Ga0207688_10016830 3300025901 Bacteria 3969
156 Ga0207680_10000730 3300025903 Bacteria 15464
157 Ga0207680_10129226 3300025903 Bacteria 1663
158 Ga0207680_10251102 3300025903 Bacteria 1222
159 Ga0207647_10049250 3300025904 Bacteria 2614
160 Ga0207685_10020251 3300025905 Bacteria 2207
161 Ga0207699_10100182 3300025906 Bacteria 1837
162 Ga0207699_10101808 3300025906 Bacteria 1824
163 Ga0207645_10075461 3300025907 Bacteria 2158
164 Ga0207643_10001930 3300025908 Bacteria 11466
165 Ga0207684_10007915 3300025910 Bacteria 9499
166 Ga0207684_10020183 3300025910 Bacteria 5690
167 Ga0207654_10350682 3300025911 Bacteria 1016
168 Ga0207671_10155114 3300025914 Bacteria 1771
169 Ga0207693_10002392 3300025915 Bacteria 16289
170 Ga0207693_10005702 3300025915 Bacteria 10351
171 Ga0207693_10015494 3300025915 Bacteria 6116
172 Ga0207693_10101015 3300025915 Bacteria 2261
173 Ga0207663_10018429 3300025916 Bacteria 3912
174 Ga0207662_10000263 3300025918 Bacteria 24233
175 Ga0207657_10031844 3300025919 Bacteria 4770
176 Ga0207649_10323562 3300025920 Bacteria 1134
177 Ga0207646_10021030 3300025922 Bacteria 6035
178 Ga0207646_10067243 3300025922 Bacteria 3199
179 Ga0207646_10080672 3300025922 Bacteria 2909
180 Ga0207646_10379081 3300025922 Bacteria 1278
181 Ga0207681_10088114 3300025923 Bacteria 2210
182 Ga0207681_10269146 3300025923 Bacteria 1337
183 Ga0207700_10054849 3300025928 Bacteria 2993
184 Ga0207700_10106639 3300025928 Bacteria 2246
185 Ga0207700_10138232 3300025928 Bacteria 1998
186 Ga0207664_10044631 3300025929 Bacteria 3472
187 Ga0207664_10099759 3300025929 Bacteria 2397
188 Ga0207664_10161683 3300025929 Bacteria 1910
189 Ga0207664_10324562 3300025929 Unclassified 1359
190 Ga0207644_10064047 3300025931 Bacteria 2671
191 Ga0207644_10243446 3300025931 Bacteria 1433
192 Ga0207706_10520280 3300025933 Bacteria 1026
193 Ga0207686_10027667 3300025934 Bacteria 3322
194 Ga0207709_10011270 3300025935 Bacteria 4931
195 Ga0207709_10074524 3300025935 Bacteria 2166
196 Ga0207709_10114032 3300025935 Bacteria 1813
197 Ga0207665_10000520 3300025939 Bacteria 26052
198 Ga0207691_10017927 3300025940 Bacteria 6709
199 Ga0207711_10341197 3300025941 Bacteria 1386
200 Ga0207689_10008875 3300025942 Bacteria 8721
201 Ga0207689_10065300 3300025942 Bacteria 2993
202 Ga0207679_10047466 3300025945 Bacteria 3120
203 Ga0207679_10528081 3300025945 Bacteria 1056
204 Ga0207651_10232470 3300025960 Bacteria 1498
205 Ga0207712_10004438 3300025961 Bacteria 8861
206 Ga0207668_10000707 3300025972 Bacteria 20413
207 Ga0207668_10002606 3300025972 Bacteria 10545
208 Ga0207640_10392980 3300025981 Bacteria 1127
209 Ga0207658_10000079 3300025986 Bacteria 107980
210 Ga0207658_10012090 3300025986 Bacteria 5888
211 Ga0207677_10243252 3300026023 Bacteria 1457
212 Ga0207703_10053934 3300026035 Bacteria 3268
213 Ga0207703_10094651 3300026035 Bacteria 2519
214 Ga0207678_10001771 3300026067 Bacteria 19766
215 Ga0207708_10050239 3300026075 Bacteria 3175
216 Ga0207702_10052200 3300026078 Bacteria 3459
217 Ga0207702_10171932 3300026078 Bacteria 1987
218 Ga0207641_10000381 3300026088 Bacteria 52796
219 Ga0207648_10004835 3300026089 Bacteria 13739
220 Ga0207674_10641724 3300026116 Bacteria 1025
221 Ga0207675_100000619 3300026118 Bacteria 34751
222 Ga0207683_10020088 3300026121 Bacteria 5709
223 Ga0207683_10072818 3300026121 Bacteria 3039
224 Ga0209371_1000022 3300027312 Bacteria 536342
225 Ga0209371_1000729 3300027312 Bacteria 27629
226 Ga0209282_1000039 3300027666 Bacteria 128517
227 Ga0268266_10006494 3300028379 Bacteria 10704
228 Ga0268266_10038101 3300028379 Bacteria 4094
229 Ga0268266_10076394 3300028379 Bacteria 2911
230 Ga0268266_10190208 3300028379 Bacteria 1874
231 Ga0268265_10005132 3300028380 Bacteria 8967
232 Ga0268264_10017383 3300028381 Bacteria 5891
233 Ga0268264_10024577 3300028381 Bacteria 4919
234 Ga0268264_10228034 3300028381 Bacteria 1718
235 Ga0307515_10014013 3300028794 Bacteria 14919
236 Ga0268256_1000019 3300030500 Bacteria 587949
237 Ga0268256_1031119 3300030500 Bacteria 1284
238 Ga0316181_1085764 3300030744 Bacteria 2164
239 Ga0307509_10001655 3300031507 Bacteria 37324
240 Ga0307412_10009071 3300031911 Bacteria 5700
241 Ga0307409_100223647 3300031995 Bacteria 1701
242 Ga0307416_100376431 3300032002 Bacteria 1448
243 Ga0307415_100040645 3300032126 Bacteria 3082
244 Ga0307415_100819932 3300032126 Bacteria 851
245 Ga0373944_0100050 3300035089 Bacteria 978
246 Ga0373951_0029836 3300035091 Bacteria 1282
247 Ga0373923_0000585 3300035111 Bacteria 9008
248 Ga0373945_0001065 3300035116 Bacteria 8251
249 Ga0373953_0058902 3300035117 Bacteria 1567
250 Ga0373954_0181294 3300035118 Unclassified 1033
251 Ga0373943_0034426 3300035170 Bacteria 2416
252 Ga0373924_0000036 3300035410 Bacteria 33897
253 Ga0373935_0000076 3300035692 Bacteria 42294
254 Ga0373927_0314378 3300035695 Bacteria 1031
255 Ga0373947_0010040 3300035725 Bacteria 5435
256 Ga0373947_0321613 3300035725 Bacteria 1035
257 Ga0373937_0104707 3300036401 Bacteria 2629
258 Ga0373937_0114869 3300036401 Bacteria 2506
259 Ga0373925_0058017 3300037068 Bacteria 2901
260 Ga0395899_0027178 3300037312 Bacteria 4316
261 Ga0395899_0128079 3300037312 Bacteria 1815
262 Ga0395900_0037911 3300037418 Bacteria 4969
263 Ga0395898_0110997 3300037466 Bacteria 2628
264 Ga0395898_0126648 3300037466 Bacteria 2447
265 Ga0395898_0131499 3300037466 Bacteria 2397
266 Ga0395898_0382117 3300037466 Bacteria 1343
267 Ga0395898_0612936 3300037466 Bacteria 1031
268 Ga0395905_0013742 3300037471 Bacteria 7750
269 Ga0436364_0073474 3300037853 Bacteria 7776
270 Ga0436364_1071016 3300037853 Bacteria 1051
271 Ga0395901_0006847 3300038443 Bacteria 11512
272 Ga0395901_0019370 3300038443 Bacteria 6957
273 Ga0395901_0037884 3300038443 Bacteria 4986
274 Ga0395901_0086826 3300038443 Bacteria 3271
275 Ga0395901_0268273 3300038443 Bacteria 1776
276 Ga0395901_0284095 3300038443 Bacteria 1719
277 Ga0395901_0330235 3300038443 Bacteria 1577
278 Ga0436365_0120675 3300039437 Bacteria 2215
279 Ga0436365_0189733 3300039437 Bacteria 4408
280 Ga0436365_0851813 3300039437 Bacteria 1439
281 Ga0436365_1031261 3300039437 Bacteria 1553
282 Ga0436360_0691402 3300039438 Bacteria 2534
283 Ga0436363_0323951 3300039450 Bacteria 4151
284 Ga0436363_0682228 3300039450 Bacteria 776
285 Ga0436363_1129605 3300039450 Bacteria 3635
286 Ga0436363_1413410 3300039450 Bacteria 2074
287 Ga0439450_020075 3300042008 Bacteria 1422
288 Ga0439440_0013627 3300042993 Bacteria 1746
289 Ga0466969_0013797 3300044656 Bacteria 4254
290 Ga0466969_0065082 3300044656 Bacteria 1763
291 Ga0466969_0074835 3300044656 Bacteria 1624
292 Ga0466965_0252074 3300044683 Bacteria 947
293 Ga0466966_0031125 3300044684 Bacteria 3461
294 Ga0466966_0096577 3300044684 Bacteria 1830
295 Ga0466963_0001567 3300044694 Bacteria 12397
296 Ga0466963_0190111 3300044694 Bacteria 1434
297 Ga0466964_0182630 3300044706 Bacteria 996
298 Ga0466957_0218244 3300044842 Bacteria 1258
299 Ga0466960_0000003 3300044901 Bacteria 86010
300 Ga0466960_0004193 3300044901 Bacteria 5608
301 Ga0466960_0072833 3300044901 Bacteria 1713
302 Ga0466959_0007314 3300045049 Bacteria 7740
303 Ga0466959_0020619 3300045049 Bacteria 4857
304 Ga0466958_0098008 3300045836 Bacteria 1820
305 Ga0466967_0037745 3300045976 Bacteria 4137
306 Ga0466967_0077685 3300045976 Bacteria 2989
307 Ga0466967_0104141 3300045976 Bacteria 2597
308 Ga0495592_0133509 3300046454 Bacteria 1734
309 Ga0495638_0018491 3300046460 Bacteria 4627
310 Ga0495641_0133717 3300046461 Bacteria 1107
311 Ga0495651_0003493 3300046462 Bacteria 12048
312 Ga0495651_0041645 3300046462 Bacteria 3567
313 Ga0495651_0218311 3300046462 Bacteria 1322
314 Ga0495653_0040518 3300046463 Bacteria 3640
315 Ga0495650_0000053 3300046471 Bacteria 316684
316 Ga0495608_0034666 3300046511 Bacteria 3406
317 Ga0495608_0063026 3300046511 Bacteria 2434
318 Ga0495608_0089520 3300046511 Bacteria 1992
319 Ga0495618_0038988 3300046514 Bacteria 2987
320 Ga0495652_0132744 3300046529 Bacteria 1969
321 Ga0495652_0181271 3300046529 Bacteria 1616
322 Ga0495652_0418244 3300046529 Bacteria 945
323 Ga0495640_0080594 3300046533 Bacteria 2165
324 Ga0495586_0140300 3300046535 Bacteria 1356
325 Ga0495587_0172804 3300046536 Bacteria 1227
326 Ga0495587_0172851 3300046536 Bacteria 1227
327 Ga0495633_0028682 3300046558 Bacteria 2710
328 Ga0495667_0062079 3300046559 Bacteria 2449
329 Ga0495667_0070933 3300046559 Bacteria 2273
330 Ga0495667_0091068 3300046559 Bacteria 1975
331 Ga0495667_0141545 3300046559 Bacteria 1550
332 Ga0495635_0024270 3300046663 Bacteria 4227
333 Ga0495635_0066834 3300046663 Bacteria 2466
334 Ga0495588_0001283 3300046674 Bacteria 10760
335 Ga0495657_0008756 3300046675 Bacteria 7718
336 Ga0495657_0032852 3300046675 Bacteria 3617
337 Ga0495657_0050762 3300046675 Bacteria 2788
338 Ga0495599_0056169 3300046678 Unclassified 2464
339 Ga0495623_0121236 3300046679 Bacteria 1574
340 Ga0495600_0084087 3300046809 Bacteria 2077
341 Ga0495600_0160014 3300046809 Bacteria 1456
342 Ga0495581_0051748 3300047315 Bacteria 2372
343 Ga0495581_0177078 3300047315 Bacteria 1247
344 Ga0495604_0252207 3300047317 Bacteria 1202
345 Ga0495674_0356678 3300047319 Bacteria 1186
346 Ga0495680_0003123 3300047322 Bacteria 16496
347 Ga0495680_0013996 3300047322 Bacteria 6974
348 Ga0495680_0023768 3300047322 Bacteria 5093
349 Ga0495680_0147113 3300047322 Bacteria 1720
350 Ga0495684_0126768 3300047471 Bacteria 1920
351 Ga0495684_0389851 3300047471 Unclassified 980
352 Ga0495686_0009637 3300047472 Bacteria 6937
353 Ga0495686_0080026 3300047472 Bacteria 1998
354 Ga0495593_0034360 3300047673 Bacteria 2758
355 Ga0495593_0096608 3300047673 Bacteria 1518
356 Ga0495602_0070618 3300048088 Bacteria 2987
357 Ga0495602_0191093 3300048088 Bacteria 1570
358 Ga0496100_0019669 3300048903 Bacteria 4033
359 Ga0496100_0027128 3300048903 Bacteria 3518
360 Ga0496100_0371779 3300048903 Bacteria 1084
361 Ga0496100_0522164 3300048903 Bacteria 916
362 Ga0496101_0001543 3300048904 Bacteria 13798
363 Ga0496101_0003981 3300048904 Bacteria 9242
364 Ga0496101_0029167 3300048904 Bacteria 3859
365 Ga0496101_0164474 3300048904 Bacteria 1703
366 Ga0496101_0190314 3300048904 Bacteria 1583
367 Ga0496101_0222602 3300048904 Bacteria 1465
368 Ga0496101_0265188 3300048904 Bacteria 1340
369 Ga0496102_0019192 3300048905 Bacteria 6020
370 Ga0496102_0070352 3300048905 Bacteria 3213
371 Ga0496102_0414820 3300048905 Bacteria 1265
372 Ga0496102_0448444 3300048905 Bacteria 1210
373 Ga0496102_0661649 3300048905 Bacteria 967
374 Ga0496104_0004166 3300048907 Bacteria 12549
375 Ga0496104_0023668 3300048907 Bacteria 5648
376 Ga0496104_0038312 3300048907 Bacteria 4485
377 Ga0496104_0062403 3300048907 Bacteria 3533
378 Ga0496104_0074328 3300048907 Bacteria 3236
379 Ga0496104_0113270 3300048907 Bacteria 2601
380 Ga0496104_0123570 3300048907 Bacteria 2485
381 Ga0496104_0161918 3300048907 Unclassified 2146
382 Ga0496104_0646165 3300048907 Bacteria 967
383 Ga0496105_0004808 3300048908 Bacteria 10204
384 Ga0496105_0065649 3300048908 Bacteria 2995
385 Ga0496105_0071779 3300048908 Bacteria 2861
386 Ga0496105_0103823 3300048908 Bacteria 2347
387 Ga0496105_0130321 3300048908 Bacteria 2073
388 Ga0496106_0000884 3300048909 Bacteria 21849
389 Ga0496106_0006038 3300048909 Bacteria 8965
390 Ga0496106_0023141 3300048909 Bacteria 4615
391 Ga0496106_0043455 3300048909 Bacteria 3371
392 Ga0496106_0065379 3300048909 Bacteria 2769
393 Ga0496106_0187975 3300048909 Bacteria 1641
394 Ga0496106_0327885 3300048909 Bacteria 1229
395 Ga0496107_0003332 3300048910 Bacteria 10736
396 Ga0496107_0003365 3300048910 Bacteria 10686
397 Ga0496107_0005688 3300048910 Bacteria 8529
398 Ga0496107_0007932 3300048910 Bacteria 7328
399 Ga0496107_0165916 3300048910 Bacteria 1637
400 Ga0496107_0419344 3300048910 Bacteria 995
401 Ga0496108_0000551 3300048911 Bacteria 29323
402 Ga0496108_0018476 3300048911 Bacteria 5708
403 Ga0496108_0059166 3300048911 Bacteria 3222
404 Ga0496108_0155525 3300048911 Bacteria 1974
405 Ga0496108_0383237 3300048911 Bacteria 1228
406 Ga0496108_0749892 3300048911 Bacteria 844
407 Ga0496109_0025708 3300048912 Bacteria 5248
408 Ga0496109_0038936 3300048912 Bacteria 4301
409 Ga0496109_0039536 3300048912 Bacteria 4269
410 Ga0496109_0043473 3300048912 Bacteria 4072
411 Ga0496109_0051085 3300048912 Bacteria 3765
412 Ga0496109_0120904 3300048912 Bacteria 2440
413 Ga0496109_0431781 3300048912 Bacteria 1244
414 Ga0496109_0486662 3300048912 Bacteria 1165
415 Ga0496109_0605663 3300048912 Bacteria 1032
416 Ga0496110_0018313 3300048913 Bacteria 5872
417 Ga0496110_0039626 3300048913 Bacteria 4103
418 Ga0496110_0055005 3300048913 Bacteria 3502
419 Ga0496110_0190769 3300048913 Bacteria 1861
420 Ga0496110_0309149 3300048913 Bacteria 1440
421 Ga0496110_0647069 3300048913 Bacteria 957
422 Ga0496111_0092712 3300048914 Bacteria 2214
423 Ga0496111_0096328 3300048914 Bacteria 2172
424 Ga0496111_0134356 3300048914 Bacteria 1832
425 Ga0496111_0260508 3300048914 Bacteria 1287
426 Ga0496112_0000316 3300048915 Bacteria 31040
427 Ga0496112_0017270 3300048915 Bacteria 6775
428 Ga0496112_0036526 3300048915 Bacteria 4793
429 Ga0496112_0058783 3300048915 Bacteria 3787
430 Ga0496112_0064629 3300048915 Bacteria 3611
431 Ga0496112_0069693 3300048915 Bacteria 3473
432 Ga0496112_0701019 3300048915 Bacteria 940
433 Ga0496113_0004006 3300048916 Bacteria 8957
434 Ga0496113_0044932 3300048916 Bacteria 3274
435 Ga0496113_0066388 3300048916 Bacteria 2732
436 Ga0496113_0193006 3300048916 Bacteria 1617
437 Ga0496113_0241049 3300048916 Bacteria 1443
438 Ga0496114_0001966 3300048917 Bacteria 15617
439 Ga0496114_0008999 3300048917 Bacteria 7915
440 Ga0496114_0087101 3300048917 Bacteria 2647
441 Ga0496114_0136758 3300048917 Bacteria 2119
442 Ga0496114_0455997 3300048917 Bacteria 1132
443 Ga0496115_0002966 3300048918 Bacteria 12200
444 Ga0496115_0007363 3300048918 Bacteria 8099
445 Ga0496115_0027523 3300048918 Bacteria 4448
446 Ga0496115_0220426 3300048918 Bacteria 1565
447 Ga0496115_0574092 3300048918 Bacteria 899
448 Ga0496116_0048566 3300048919 Bacteria 2847
449 Ga0496117_0000036 3300048920 Bacteria 325635
450 Ga0496118_0008209 3300048921 Bacteria 10846
451 Ga0496119_0011541 3300048922 Bacteria 7297
452 Ga0496120_0000495 3300048923 Bacteria 61601
453 Ga0496121_0009582 3300048924 Bacteria 11094
454 Ga0496122_0000002 3300048925 Bacteria 905834
455 Ga0496123_0000002 3300048926 Bacteria 1811682
456 Ga0496124_0007696 3300048927 Bacteria 11395
457 Ga0496124_0013261 3300048927 Bacteria 8056
458 Ga0496124_0119824 3300048927 Bacteria 2105
459 Ga0501031_0034011 3300049568 Bacteria 3325
460 Ga0501031_0141080 3300049568 Bacteria 1575
461 Ga0501031_0177047 3300049568 Bacteria 1393
462 Ga0501032_0009948 3300049569 Bacteria 6866
463 Ga0501032_0142928 3300049569 Bacteria 1576
464 Ga0501033_0019503 3300049570 Bacteria 5126
465 Ga0501034_0041459 3300049571 Bacteria 4657
466 Ga0501036_0096771 3300049572 Bacteria 2495
467 Ga0501036_0259683 3300049572 Bacteria 1455
468 Ga0501037_0039122 3300049573 Bacteria 3492
469 Ga0501038_0002245 3300049574 Bacteria 17949
470 Ga0501039_0006422 3300049575 Bacteria 8932
471 Ga0501039_0036456 3300049575 Bacteria 3795
472 Ga0501039_0040725 3300049575 Bacteria 3586
473 Ga0501040_0121420 3300049576 Bacteria 1833
474 Ga0501043_0009765 3300049579 Bacteria 7523
475 Ga0501048_0056591 3300049582 Bacteria 2782
476 Ga0501048_0175233 3300049582 Bacteria 1520
477 Ga0501067_0020854 3300049583 Bacteria 3626
478 Ga0501068_0031041 3300049584 Bacteria 3173
479 Ga0501069_0006757 3300049585 Bacteria 6007
480 Ga0501070_0008200 3300049586 Bacteria 8835
481 Ga0501073_0001829 3300049589 Bacteria 15834
482 Ga0501074_0051170 3300049590 Bacteria 2981
483 Ga0501074_0111948 3300049590 Bacteria 1953
484 Ga0501075_0047661 3300049591 Bacteria 3220
485 Ga0501076_0145862 3300049592 Bacteria 1924
486 Ga0501079_0058776 3300049741 Bacteria 2967
487 Ga0501079_0162419 3300049741 Bacteria 1742
488 Ga0501080_0043678 3300049742 Bacteria 4173
489 Ga0501083_0021402 3300049744 Bacteria 4494
490 Ga0501083_0204344 3300049744 Bacteria 1288
491 Ga0501035_0038182 3300049822 Bacteria 4348
492 Ga0501044_0355977 3300049823 Bacteria 1382
493 nmdc:mga03683_5036_c1 3300050489 Bacteria 4429
494 nmdc:mga03n38_108468_c1 3300050490 Bacteria 1349
495 nmdc:mga00v17_2501_c1 3300050491 Bacteria 9410
496 nmdc:mga0k408_44868_c1 3300050493 Bacteria 2550
497 nmdc:mga06z11_275585_c1 3300050494 Bacteria 996
498 nmdc:mga06z11_9768_c1 3300050494 Bacteria 4055
499 nmdc:mga07m45_265882_c1 3300050496 Bacteria 998
500 nmdc:mga0qj67_131398_c1 3300050509 Bacteria 2028
501 nmdc:mga0n895_305603_c1 3300050512 Bacteria 1612
502 nmdc:mga0n895_98095_c1 3300050512 Bacteria 2937
503 nmdc:mga0rr50_107362_c1 3300050513 Bacteria 2204
504 nmdc:mga0a205_188080_c1 3300050515 Bacteria 1957
505 nmdc:mga0a205_94119_c1 3300050515 Bacteria 2894
506 nmdc:mga0sz30_746_c1 3300050516 Bacteria 11901
507 Ga0495601_0283393 3300053077 Bacteria 1080
508 Ga0495595_0014702 3300053084 Unclassified 3325
509 Ga0495619_0314085 3300053085 Bacteria 1085
510 Ga0500562_006399 3300053108 Bacteria 2970
511 Ga0500562_008199 3300053108 Bacteria 2637
512 Ga0500561_0000260 3300053137 Bacteria 9203
513 Ga0500586_017010 3300053145 Bacteria 2218
514 Ga0500616_0006120 3300053153 Bacteria 7963
515 Ga0500624_001065 3300053157 Bacteria 5317
516 Ga0500634_0031025 3300053161 Bacteria 2913
517 Ga0501084_0044535 3300054114 Bacteria 3715
518 Ga0501084_0673552 3300054114 Bacteria 873
519 Ga0587072_004769 3300059643 Bacteria 1992
520 Ga0501082_0066090 3300060353 Bacteria 3114
521 Ga0466962_0190780 3300061719 Bacteria 1000

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0673552 Ga0501084_0673552_12_620 198
2 3300021377 Ga0213874_10016978 Ga0213874_100169781 199
3 3300039450 Ga0436363_0323951 Ga0436363_0323951_359_1183 199
4 3300039450 Ga0436363_1413410 Ga0436363_1413410_80_904 199
5 3300042008 Ga0439450_020075 Ga0439450_020075_52_762 204
6 3300005345 Ga0070692_10053888 Ga0070692_100538882 206
7 3300005548 Ga0070665_100185705 Ga0070665_1001857053 206
8 3300028379 Ga0268266_10190208 Ga0268266_101902081 206
9 3300014325 Ga0163163_11028408 Ga0163163_110284081 210
10 3300003354 JGI25160J50197_1000459 JGI25160J50197_10004593 211
11 3300025302 Ga0207426_1000300 Ga0207426_100030046 211
12 3300037466 Ga0395898_0612936 Ga0395898_0612936_85_750 215
13 3300048905 Ga0496102_0448444 Ga0496102_0448444_24_767 215
14 3300039450 Ga0436363_0682228 Ga0436363_0682228_51_728 217
15 3300048904 Ga0496101_0265188 Ga0496101_0265188_483_1166 218
16 3300020080 Ga0206350_11519635 Ga0206350_115196352 219
17 3300014968 Ga0157379_10004216 Ga0157379_100042164 220
18 3300038443 Ga0395901_0086826 Ga0395901_0086826_1511_2194 220
19 3300044694 Ga0466963_0190111 Ga0466963_0190111_567_1259 220
20 3300044901 Ga0466960_0072833 Ga0466960_0072833_185_877 220
21 3300046471 Ga0495650_0000053 Ga0495650_0000053_166333_167016 220
22 3300048907 Ga0496104_0646165 Ga0496104_0646165_140_823 220
23 3300048912 Ga0496109_0605663 Ga0496109_0605663_291_974 220
24 3300048915 Ga0496112_0069693 Ga0496112_0069693_1839_2522 220
25 3300048916 Ga0496113_0044932 Ga0496113_0044932_466_1149 220
26 3300053153 Ga0500616_0006120 Ga0500616_0006120_6435_7118 220
27 3300044901 Ga0466960_0000003 Ga0466960_0000003_70924_71622 222
28 3300048915 Ga0496112_0064629 Ga0496112_0064629_158_970 222
29 3300048927 Ga0496124_0119824 Ga0496124_0119824_369_1070 223
30 3300014968 Ga0157379_10010734 Ga0157379_100107343 227
31 3300035170 Ga0373943_0034426 Ga0373943_0034426_1660_2400 227
32 3300006852 Ga0075433_10172258 Ga0075433_101722582 229
33 3300006871 Ga0075434_100247990 Ga0075434_1002479902 229
34 3300028381 Ga0268264_10228034 Ga0268264_102280343 229
35 3300044901 Ga0466960_0004193 Ga0466960_0004193_1678_2409 229
36 3300047315 Ga0495581_0051748 Ga0495581_0051748_1401_2171 230
37 3300047319 Ga0495674_0356678 Ga0495674_0356678_83_877 230
38 3300005334 Ga0068869_100051337 Ga0068869_1000513372 231
39 3300025942 Ga0207689_10065300 Ga0207689_100653003 231
40 3300036401 Ga0373937_0104707 Ga0373937_0104707_1299_2039 231
41 3300047472 Ga0495686_0009637 Ga0495686_0009637_3247_3996 231
42 3300047472 Ga0495686_0080026 Ga0495686_0080026_715_1455 231
43 3300005471 Ga0070698_100597426 Ga0070698_1005974262 232
44 3300006028 Ga0070717_10603253 Ga0070717_106032531 232
45 3300046559 Ga0495667_0141545 Ga0495667_0141545_732_1526 232
46 3300048911 Ga0496108_0383237 Ga0496108_0383237_370_1161 232
47 3300048913 Ga0496110_0055005 Ga0496110_0055005_1437_2228 232
48 3300048915 Ga0496112_0036526 Ga0496112_0036526_725_1516 232
49 3300005439 Ga0070711_100127724 Ga0070711_1001277242 233
50 3300006163 Ga0070715_10034131 Ga0070715_100341314 233
51 3300009148 Ga0105243_10547355 Ga0105243_105473552 233
52 3300013306 Ga0163162_10593024 Ga0163162_105930242 233
53 3300025905 Ga0207685_10020251 Ga0207685_100202514 233
54 3300025906 Ga0207699_10100182 Ga0207699_101001824 233
55 3300048909 Ga0496106_0065379 Ga0496106_0065379_1812_2528 233
56 3300048910 Ga0496107_0419344 Ga0496107_0419344_63_779 233
57 3300048912 Ga0496109_0051085 Ga0496109_0051085_1748_2464 233
58 3300048912 Ga0496109_0431781 Ga0496109_0431781_448_1164 233
59 3300048913 Ga0496110_0018313 Ga0496110_0018313_1123_1839 233
60 3300048914 Ga0496111_0092712 Ga0496111_0092712_852_1568 233
61 3300048914 Ga0496111_0134356 Ga0496111_0134356_260_976 233
62 3300048915 Ga0496112_0701019 Ga0496112_0701019_41_757 233
63 3300048917 Ga0496114_0087101 Ga0496114_0087101_650_1366 233
64 3300048918 Ga0496115_0027523 Ga0496115_0027523_1444_2160 233
65 3300049568 Ga0501031_0141080 Ga0501031_0141080_21_815 233
66 3300049572 Ga0501036_0259683 Ga0501036_0259683_633_1427 233
67 3300049575 Ga0501039_0040725 Ga0501039_0040725_1863_2657 233
68 3300003203 JGI25406J46586_10001925 JGI25406J46586_100019256 234
69 3300005985 Ga0081539_10000969 Ga0081539_1000096922 234
70 3300032126 Ga0307415_100819932 Ga0307415_1008199321 234
71 3300037466 Ga0395898_0131499 Ga0395898_0131499_433_1233 234
72 3300049568 Ga0501031_0177047 Ga0501031_0177047_539_1339 234
73 3300049569 Ga0501032_0142928 Ga0501032_0142928_710_1510 234
74 3300049575 Ga0501039_0036456 Ga0501039_0036456_2468_3268 234
75 3300049576 Ga0501040_0121420 Ga0501040_0121420_719_1519 234
76 3300049582 Ga0501048_0175233 Ga0501048_0175233_574_1374 234
77 3300049590 Ga0501074_0111948 Ga0501074_0111948_1046_1846 234
78 3300049591 Ga0501075_0047661 Ga0501075_0047661_1888_2688 234
79 3300049592 Ga0501076_0145862 Ga0501076_0145862_581_1381 234
80 3300049744 Ga0501083_0204344 Ga0501083_0204344_464_1264 234
81 3300054114 Ga0501084_0044535 Ga0501084_0044535_651_1451 234
82 iso_pu_bacteria 2721755763 2723877702 234
83 3300005548 Ga0070665_100050192 Ga0070665_1000501923 235
84 3300005563 Ga0068855_100131379 Ga0068855_1001313792 235
85 3300005564 Ga0070664_100653253 Ga0070664_1006532532 235
86 3300005614 Ga0068856_100087335 Ga0068856_1000873352 235
87 3300005937 Ga0081455_10012614 Ga0081455_100126145 235
88 3300009176 Ga0105242_10325827 Ga0105242_103258272 235
89 3300009177 Ga0105248_10338475 Ga0105248_103384752 235
90 3300013102 Ga0157371_10046360 Ga0157371_100463602 235
91 3300013306 Ga0163162_10626195 Ga0163162_106261952 235
92 3300025945 Ga0207679_10528081 Ga0207679_105280812 235
93 3300026078 Ga0207702_10052200 Ga0207702_100522004 235
94 3300037466 Ga0395898_0126648 Ga0395898_0126648_217_1023 235
95 3300038443 Ga0395901_0330235 Ga0395901_0330235_212_1018 235
96 3300047322 Ga0495680_0147113 Ga0495680_0147113_785_1600 235
97 3300048912 Ga0496109_0486662 Ga0496109_0486662_129_929 235
98 3300048915 Ga0496112_0017270 Ga0496112_0017270_5782_6588 235
99 3300050494 nmdc:mga06z11_9768_c1 nmdc:mga06z11_9768_c1_3226_4014 235
100 3300035089 Ga0373944_0100050 Ga0373944_0100050_177_947 236
101 3300035111 Ga0373923_0000585 Ga0373923_0000585_2290_3060 236
102 3300035116 Ga0373945_0001065 Ga0373945_0001065_6833_7603 236
103 3300035410 Ga0373924_0000036 Ga0373924_0000036_28514_29284 236
104 3300035692 Ga0373935_0000076 Ga0373935_0000076_5301_6071 236
105 3300035725 Ga0373947_0010040 Ga0373947_0010040_3706_4476 236
106 3300037068 Ga0373925_0058017 Ga0373925_0058017_228_998 236
107 3300046511 Ga0495608_0063026 Ga0495608_0063026_55_825 236
108 3300046535 Ga0495586_0140300 Ga0495586_0140300_554_1324 236
109 3300047471 Ga0495684_0126768 Ga0495684_0126768_703_1473 236
110 3300047673 Ga0495593_0034360 Ga0495593_0034360_871_1641 236
111 3300048908 Ga0496105_0130321 Ga0496105_0130321_660_1430 236
112 3300048915 Ga0496112_0000316 Ga0496112_0000316_7546_8316 236
113 3300048916 Ga0496113_0004006 Ga0496113_0004006_6678_7448 236
114 iso_pu_bacteria 2643221558 2643810982 236
115 3300005347 Ga0070668_100006105 Ga0070668_1000061053 237
116 3300005355 Ga0070671_100096403 Ga0070671_1000964032 237
117 3300005367 Ga0070667_100000714 Ga0070667_10000071425 237
118 3300005435 Ga0070714_100183638 Ga0070714_1001836382 237
119 3300005444 Ga0070694_100168044 Ga0070694_1001680442 237
120 3300005468 Ga0070707_100537519 Ga0070707_1005375192 237
121 3300005548 Ga0070665_100044923 Ga0070665_1000449236 237
122 3300005841 Ga0068863_100172972 Ga0068863_1001729723 237
123 3300005844 Ga0068862_100003205 Ga0068862_10000320510 237
124 3300006175 Ga0070712_100125671 Ga0070712_1001256713 237
125 3300006871 Ga0075434_100098474 Ga0075434_1000984745 237
126 3300007076 Ga0075435_100053155 Ga0075435_1000531554 237
127 3300009148 Ga0105243_10026247 Ga0105243_100262473 237
128 3300009176 Ga0105242_10681704 Ga0105242_106817042 237
129 3300009553 Ga0105249_10001446 Ga0105249_1000144610 237
130 3300014968 Ga0157379_10018185 Ga0157379_100181853 237
131 3300014969 Ga0157376_10075956 Ga0157376_100759561 237
132 3300021441 Ga0213871_10041621 Ga0213871_100416212 237
133 3300025903 Ga0207680_10129226 Ga0207680_101292262 237
134 3300025922 Ga0207646_10379081 Ga0207646_103790812 237
135 3300025929 Ga0207664_10044631 Ga0207664_100446312 237
136 3300025935 Ga0207709_10011270 Ga0207709_100112704 237
137 3300025961 Ga0207712_10004438 Ga0207712_100044389 237
138 3300025972 Ga0207668_10002606 Ga0207668_1000260610 237
139 3300025986 Ga0207658_10012090 Ga0207658_100120906 237
140 3300026035 Ga0207703_10094651 Ga0207703_100946513 237
141 3300026121 Ga0207683_10072818 Ga0207683_100728182 237
142 3300028379 Ga0268266_10076394 Ga0268266_100763943 237
143 3300028380 Ga0268265_10005132 Ga0268265_100051326 237
144 3300028381 Ga0268264_10017383 Ga0268264_100173837 237
145 3300031507 Ga0307509_10001655 Ga0307509_1000165528 237
146 3300031995 Ga0307409_100223647 Ga0307409_1002236472 237
147 3300037312 Ga0395899_0027178 Ga0395899_0027178_2695_3471 237
148 3300037312 Ga0395899_0128079 Ga0395899_0128079_971_1780 237
149 3300037418 Ga0395900_0037911 Ga0395900_0037911_2586_3362 237
150 3300037466 Ga0395898_0110997 Ga0395898_0110997_959_1735 237
151 3300037471 Ga0395905_0013742 Ga0395905_0013742_5299_6075 237
152 3300038443 Ga0395901_0019370 Ga0395901_0019370_1731_2507 237
153 3300038443 Ga0395901_0268273 Ga0395901_0268273_302_1111 237
154 3300039437 Ga0436365_1031261 Ga0436365_1031261_475_1284 237
155 3300044656 Ga0466969_0065082 Ga0466969_0065082_754_1491 237
156 3300046454 Ga0495592_0133509 Ga0495592_0133509_541_1350 237
157 3300046462 Ga0495651_0041645 Ga0495651_0041645_1981_2790 237
158 3300046462 Ga0495651_0218311 Ga0495651_0218311_56_865 237
159 3300046536 Ga0495587_0172804 Ga0495587_0172804_10_819 237
160 3300046559 Ga0495667_0070933 Ga0495667_0070933_1418_2227 237
161 3300046663 Ga0495635_0066834 Ga0495635_0066834_155_964 237
162 3300046675 Ga0495657_0050762 Ga0495657_0050762_78_887 237
163 3300046809 Ga0495600_0084087 Ga0495600_0084087_283_1092 237
164 3300047322 Ga0495680_0013996 Ga0495680_0013996_4049_4858 237
165 3300048903 Ga0496100_0019669 Ga0496100_0019669_2933_3742 237
166 3300048903 Ga0496100_0522164 Ga0496100_0522164_61_870 237
167 3300048904 Ga0496101_0003981 Ga0496101_0003981_6809_7618 237
168 3300048907 Ga0496104_0113270 Ga0496104_0113270_1166_1984 237
169 3300048908 Ga0496105_0071779 Ga0496105_0071779_1502_2320 237
170 3300048909 Ga0496106_0187975 Ga0496106_0187975_418_1227 237
171 3300048909 Ga0496106_0327885 Ga0496106_0327885_59_877 237
172 3300048910 Ga0496107_0003332 Ga0496107_0003332_1535_2344 237
173 3300048910 Ga0496107_0007932 Ga0496107_0007932_2333_3142 237
174 3300048910 Ga0496107_0165916 Ga0496107_0165916_61_879 237
175 3300048913 Ga0496110_0647069 Ga0496110_0647069_51_869 237
176 3300048917 Ga0496114_0001966 Ga0496114_0001966_11930_12739 237
177 3300048918 Ga0496115_0574092 Ga0496115_0574092_49_858 237
178 3300048922 Ga0496119_0011541 Ga0496119_0011541_3878_4696 237
179 3300048924 Ga0496121_0009582 Ga0496121_0009582_5891_6709 237
180 3300050512 nmdc:mga0n895_98095_c1 nmdc:mga0n895_98095_c1_239_1048 237
181 3300050513 nmdc:mga0rr50_107362_c1 nmdc:mga0rr50_107362_c1_510_1319 237
182 3300050515 nmdc:mga0a205_94119_c1 nmdc:mga0a205_94119_c1_1937_2746 237
183 3300053085 Ga0495619_0314085 Ga0495619_0314085_73_882 237
184 3300005329 Ga0070683_100247370 Ga0070683_1002473702 238
185 3300005337 Ga0070682_100142357 Ga0070682_1001423572 238
186 3300005339 Ga0070660_100272928 Ga0070660_1002729281 238
187 3300005340 Ga0070689_100206921 Ga0070689_1002069212 238
188 3300005344 Ga0070661_100130654 Ga0070661_1001306542 238
189 3300005345 Ga0070692_10028129 Ga0070692_100281293 238
190 3300005347 Ga0070668_100112750 Ga0070668_1001127503 238
191 3300005353 Ga0070669_100485861 Ga0070669_1004858611 238
192 3300005355 Ga0070671_100176770 Ga0070671_1001767702 238
193 3300005356 Ga0070674_100164653 Ga0070674_1001646532 238
194 3300005366 Ga0070659_100165864 Ga0070659_1001658643 238
195 3300005434 Ga0070709_10005748 Ga0070709_100057485 238
196 3300005435 Ga0070714_100349458 Ga0070714_1003494582 238
197 3300005436 Ga0070713_100087691 Ga0070713_1000876912 238
198 3300005436 Ga0070713_100315488 Ga0070713_1003154881 238
199 3300005437 Ga0070710_10014368 Ga0070710_100143682 238
200 3300005437 Ga0070710_10016218 Ga0070710_100162182 238
201 3300005439 Ga0070711_100010492 Ga0070711_1000104924 238
202 3300005439 Ga0070711_100030464 Ga0070711_1000304644 238
203 3300005444 Ga0070694_100008823 Ga0070694_1000088234 238
204 3300005445 Ga0070708_100033942 Ga0070708_1000339423 238
205 3300005445 Ga0070708_100051688 Ga0070708_1000516883 238
206 3300005467 Ga0070706_100005596 Ga0070706_10000559610 238
207 3300005467 Ga0070706_100022266 Ga0070706_1000222662 238
208 3300005468 Ga0070707_100086155 Ga0070707_1000861553 238
209 3300005471 Ga0070698_100011143 Ga0070698_1000111433 238
210 3300005471 Ga0070698_100152198 Ga0070698_1001521982 238
211 3300005471 Ga0070698_100452038 Ga0070698_1004520381 238
212 3300005518 Ga0070699_100001932 Ga0070699_1000019325 238
213 3300005518 Ga0070699_100080219 Ga0070699_1000802192 238
214 3300005535 Ga0070684_100137362 Ga0070684_1001373622 238
215 3300005535 Ga0070684_100153746 Ga0070684_1001537462 238
216 3300005536 Ga0070697_100056849 Ga0070697_1000568491 238
217 3300005539 Ga0068853_100038485 Ga0068853_1000384854 238
218 3300005543 Ga0070672_100068411 Ga0070672_1000684113 238
219 3300005544 Ga0070686_100273307 Ga0070686_1002733072 238
220 3300005547 Ga0070693_100280014 Ga0070693_1002800141 238
221 3300005549 Ga0070704_100032095 Ga0070704_1000320953 238
222 3300005615 Ga0070702_100132072 Ga0070702_1001320722 238
223 3300005616 Ga0068852_100313909 Ga0068852_1003139091 238
224 3300005617 Ga0068859_100260164 Ga0068859_1002601641 238
225 3300005719 Ga0068861_100203198 Ga0068861_1002031982 238
226 3300005840 Ga0068870_10024159 Ga0068870_100241592 238
227 3300005843 Ga0068860_100220799 Ga0068860_1002207992 238
228 3300005937 Ga0081455_10174259 Ga0081455_101742592 238
229 3300006028 Ga0070717_10007603 Ga0070717_100076038 238
230 3300006028 Ga0070717_10017450 Ga0070717_100174505 238
231 3300006028 Ga0070717_10018881 Ga0070717_100188816 238
232 3300006028 Ga0070717_10072333 Ga0070717_100723332 238
233 3300006028 Ga0070717_10167569 Ga0070717_101675692 238
234 3300006028 Ga0070717_10440373 Ga0070717_104403732 238
235 3300006163 Ga0070715_10075787 Ga0070715_100757871 238
236 3300006173 Ga0070716_100025729 Ga0070716_1000257292 238
237 3300006175 Ga0070712_100226895 Ga0070712_1002268952 238
238 3300006358 Ga0068871_100395400 Ga0068871_1003954002 238
239 3300006847 Ga0075431_100352612 Ga0075431_1003526122 238
240 3300006871 Ga0075434_100299371 Ga0075434_1002993713 238
241 3300006931 Ga0097620_100260172 Ga0097620_1002601723 238
242 3300009101 Ga0105247_10031535 Ga0105247_100315352 238
243 3300009176 Ga0105242_10043115 Ga0105242_100431152 238
244 3300009177 Ga0105248_10140384 Ga0105248_101403842 238
245 3300009545 Ga0105237_10098848 Ga0105237_100988482 238
246 3300010375 Ga0105239_10204458 Ga0105239_102044583 238
247 3300011119 Ga0105246_10581008 Ga0105246_105810081 238
248 3300013306 Ga0163162_10157609 Ga0163162_101576093 238
249 3300014325 Ga0163163_10788596 Ga0163163_107885961 238
250 3300014326 Ga0157380_10523913 Ga0157380_105239132 238
251 3300014969 Ga0157376_10180260 Ga0157376_101802602 238
252 3300021377 Ga0213874_10017898 Ga0213874_100178982 238
253 3300021384 Ga0213876_10057020 Ga0213876_100570202 238
254 3300021384 Ga0213876_10094508 Ga0213876_100945082 238
255 3300021384 Ga0213876_10116357 Ga0213876_101163571 238
256 3300021388 Ga0213875_10006448 Ga0213875_100064487 238
257 3300025885 Ga0207653_10022761 Ga0207653_100227613 238
258 3300025898 Ga0207692_10014943 Ga0207692_100149432 238
259 3300025900 Ga0207710_10122997 Ga0207710_101229971 238
260 3300025901 Ga0207688_10016830 Ga0207688_100168304 238
261 3300025903 Ga0207680_10251102 Ga0207680_102511021 238
262 3300025904 Ga0207647_10049250 Ga0207647_100492503 238
263 3300025906 Ga0207699_10101808 Ga0207699_101018082 238
264 3300025907 Ga0207645_10075461 Ga0207645_100754613 238
265 3300025908 Ga0207643_10001930 Ga0207643_100019303 238
266 3300025910 Ga0207684_10007915 Ga0207684_100079154 238
267 3300025910 Ga0207684_10020183 Ga0207684_100201835 238
268 3300025911 Ga0207654_10350682 Ga0207654_103506822 238
269 3300025914 Ga0207671_10155114 Ga0207671_101551143 238
270 3300025915 Ga0207693_10002392 Ga0207693_1000239210 238
271 3300025915 Ga0207693_10005702 Ga0207693_100057026 238
272 3300025915 Ga0207693_10015494 Ga0207693_100154944 238
273 3300025916 Ga0207663_10018429 Ga0207663_100184294 238
274 3300025918 Ga0207662_10000263 Ga0207662_1000026319 238
275 3300025919 Ga0207657_10031844 Ga0207657_100318441 238
276 3300025920 Ga0207649_10323562 Ga0207649_103235621 238
277 3300025922 Ga0207646_10021030 Ga0207646_100210306 238
278 3300025922 Ga0207646_10067243 Ga0207646_100672432 238
279 3300025922 Ga0207646_10080672 Ga0207646_100806723 238
280 3300025923 Ga0207681_10269146 Ga0207681_102691462 238
281 3300025928 Ga0207700_10054849 Ga0207700_100548492 238
282 3300025928 Ga0207700_10106639 Ga0207700_101066392 238
283 3300025928 Ga0207700_10138232 Ga0207700_101382322 238
284 3300025929 Ga0207664_10099759 Ga0207664_100997592 238
285 3300025929 Ga0207664_10161683 Ga0207664_101616832 238
286 3300025929 Ga0207664_10324562 Ga0207664_103245622 238
287 3300025931 Ga0207644_10064047 Ga0207644_100640472 238
288 3300025931 Ga0207644_10243446 Ga0207644_102434463 238
289 3300025933 Ga0207706_10520280 Ga0207706_105202801 238
290 3300025934 Ga0207686_10027667 Ga0207686_100276672 238
291 3300025939 Ga0207665_10000520 Ga0207665_1000052011 238
292 3300025940 Ga0207691_10017927 Ga0207691_100179274 238
293 3300025941 Ga0207711_10341197 Ga0207711_103411972 238
294 3300025942 Ga0207689_10008875 Ga0207689_100088751 238
295 3300025960 Ga0207651_10232470 Ga0207651_102324703 238
296 3300025981 Ga0207640_10392980 Ga0207640_103929801 238
297 3300026035 Ga0207703_10053934 Ga0207703_100539342 238
298 3300026067 Ga0207678_10001771 Ga0207678_100017714 238
299 3300026075 Ga0207708_10050239 Ga0207708_100502394 238
300 3300026078 Ga0207702_10171932 Ga0207702_101719322 238
301 3300026089 Ga0207648_10004835 Ga0207648_1000483511 238
302 3300026116 Ga0207674_10641724 Ga0207674_106417241 238
303 3300026118 Ga0207675_100000619 Ga0207675_10000061916 238
304 3300026121 Ga0207683_10020088 Ga0207683_100200887 238
305 3300028794 Ga0307515_10014013 Ga0307515_100140132 238
306 3300032002 Ga0307416_100376431 Ga0307416_1003764312 238
307 3300032126 Ga0307415_100040645 Ga0307415_1000406453 238
308 3300035091 Ga0373951_0029836 Ga0373951_0029836_69_923 238
309 3300035117 Ga0373953_0058902 Ga0373953_0058902_572_1384 238
310 3300035118 Ga0373954_0181294 Ga0373954_0181294_55_867 238
311 3300035695 Ga0373927_0314378 Ga0373927_0314378_183_995 238
312 3300035725 Ga0373947_0321613 Ga0373947_0321613_86_898 238
313 3300036401 Ga0373937_0114869 Ga0373937_0114869_1482_2294 238
314 3300037466 Ga0395898_0382117 Ga0395898_0382117_402_1214 238
315 3300037853 Ga0436364_0073474 Ga0436364_0073474_2910_3734 238
316 3300037853 Ga0436364_1071016 Ga0436364_1071016_131_961 238
317 3300038443 Ga0395901_0006847 Ga0395901_0006847_3255_4067 238
318 3300038443 Ga0395901_0037884 Ga0395901_0037884_224_1036 238
319 3300038443 Ga0395901_0284095 Ga0395901_0284095_150_962 238
320 3300039437 Ga0436365_0120675 Ga0436365_0120675_1161_1985 238
321 3300039437 Ga0436365_0189733 Ga0436365_0189733_541_1365 238
322 3300039450 Ga0436363_1129605 Ga0436363_1129605_520_1332 238
323 3300042993 Ga0439440_0013627 Ga0439440_0013627_121_933 238
324 3300044656 Ga0466969_0074835 Ga0466969_0074835_61_876 238
325 3300044684 Ga0466966_0096577 Ga0466966_0096577_595_1407 238
326 3300044694 Ga0466963_0001567 Ga0466963_0001567_1376_2200 238
327 3300044706 Ga0466964_0182630 Ga0466964_0182630_172_984 238
328 3300045976 Ga0466967_0077685 Ga0466967_0077685_680_1492 238
329 3300045976 Ga0466967_0104141 Ga0466967_0104141_1676_2530 238
330 3300046460 Ga0495638_0018491 Ga0495638_0018491_58_870 238
331 3300046461 Ga0495641_0133717 Ga0495641_0133717_237_1049 238
332 3300046462 Ga0495651_0003493 Ga0495651_0003493_809_1627 238
333 3300046463 Ga0495653_0040518 Ga0495653_0040518_1779_2591 238
334 3300046511 Ga0495608_0034666 Ga0495608_0034666_2316_3128 238
335 3300046511 Ga0495608_0089520 Ga0495608_0089520_434_1246 238
336 3300046514 Ga0495618_0038988 Ga0495618_0038988_250_1062 238
337 3300046529 Ga0495652_0132744 Ga0495652_0132744_1090_1902 238
338 3300046529 Ga0495652_0181271 Ga0495652_0181271_38_856 238
339 3300046529 Ga0495652_0418244 Ga0495652_0418244_72_884 238
340 3300046533 Ga0495640_0080594 Ga0495640_0080594_958_1770 238
341 3300046536 Ga0495587_0172851 Ga0495587_0172851_296_1114 238
342 3300046559 Ga0495667_0062079 Ga0495667_0062079_202_1020 238
343 3300046559 Ga0495667_0091068 Ga0495667_0091068_211_1023 238
344 3300046663 Ga0495635_0024270 Ga0495635_0024270_3076_3888 238
345 3300046675 Ga0495657_0008756 Ga0495657_0008756_6294_7112 238
346 3300046675 Ga0495657_0032852 Ga0495657_0032852_1117_1929 238
347 3300046678 Ga0495599_0056169 Ga0495599_0056169_1539_2351 238
348 3300046679 Ga0495623_0121236 Ga0495623_0121236_675_1487 238
349 3300046809 Ga0495600_0160014 Ga0495600_0160014_345_1157 238
350 3300047315 Ga0495581_0177078 Ga0495581_0177078_216_1028 238
351 3300047317 Ga0495604_0252207 Ga0495604_0252207_345_1157 238
352 3300047322 Ga0495680_0003123 Ga0495680_0003123_8846_9664 238
353 3300047322 Ga0495680_0023768 Ga0495680_0023768_1489_2301 238
354 3300047471 Ga0495684_0389851 Ga0495684_0389851_72_884 238
355 3300047673 Ga0495593_0096608 Ga0495593_0096608_11_823 238
356 3300048088 Ga0495602_0070618 Ga0495602_0070618_367_1179 238
357 3300048088 Ga0495602_0191093 Ga0495602_0191093_60_878 238
358 3300048903 Ga0496100_0027128 Ga0496100_0027128_169_981 238
359 3300048904 Ga0496101_0001543 Ga0496101_0001543_6694_7506 238
360 3300048904 Ga0496101_0029167 Ga0496101_0029167_1747_2562 238
361 3300048904 Ga0496101_0190314 Ga0496101_0190314_499_1353 238
362 3300048904 Ga0496101_0222602 Ga0496101_0222602_67_879 238
363 3300048905 Ga0496102_0019192 Ga0496102_0019192_5175_5990 238
364 3300048905 Ga0496102_0414820 Ga0496102_0414820_344_1162 238
365 3300048905 Ga0496102_0661649 Ga0496102_0661649_72_926 238
366 3300048907 Ga0496104_0023668 Ga0496104_0023668_2147_2959 238
367 3300048907 Ga0496104_0038312 Ga0496104_0038312_1360_2214 238
368 3300048907 Ga0496104_0123570 Ga0496104_0123570_853_1665 238
369 3300048907 Ga0496104_0161918 Ga0496104_0161918_556_1368 238
370 3300048908 Ga0496105_0004808 Ga0496105_0004808_2774_3586 238
371 3300048908 Ga0496105_0065649 Ga0496105_0065649_2166_2978 238
372 3300048909 Ga0496106_0000884 Ga0496106_0000884_3484_4296 238
373 3300048909 Ga0496106_0006038 Ga0496106_0006038_3130_3945 238
374 3300048909 Ga0496106_0043455 Ga0496106_0043455_1256_2110 238
375 3300048910 Ga0496107_0003365 Ga0496107_0003365_5712_6524 238
376 3300048910 Ga0496107_0005688 Ga0496107_0005688_335_1150 238
377 3300048911 Ga0496108_0018476 Ga0496108_0018476_4430_5242 238
378 3300048911 Ga0496108_0059166 Ga0496108_0059166_1080_1895 238
379 3300048911 Ga0496108_0155525 Ga0496108_0155525_883_1737 238
380 3300048912 Ga0496109_0025708 Ga0496109_0025708_1575_2390 238
381 3300048912 Ga0496109_0039536 Ga0496109_0039536_2115_2969 238
382 3300048912 Ga0496109_0043473 Ga0496109_0043473_2759_3571 238
383 3300048912 Ga0496109_0120904 Ga0496109_0120904_205_1017 238
384 3300048913 Ga0496110_0190769 Ga0496110_0190769_220_1026 238
385 3300048913 Ga0496110_0309149 Ga0496110_0309149_284_1096 238
386 3300048914 Ga0496111_0096328 Ga0496111_0096328_1345_2151 238
387 3300048914 Ga0496111_0260508 Ga0496111_0260508_192_1004 238
388 3300048915 Ga0496112_0058783 Ga0496112_0058783_2158_2970 238
389 3300048916 Ga0496113_0066388 Ga0496113_0066388_1695_2549 238
390 3300048916 Ga0496113_0193006 Ga0496113_0193006_599_1411 238
391 3300048917 Ga0496114_0008999 Ga0496114_0008999_6906_7718 238
392 3300048917 Ga0496114_0136758 Ga0496114_0136758_299_1114 238
393 3300048917 Ga0496114_0455997 Ga0496114_0455997_110_964 238
394 3300048918 Ga0496115_0002966 Ga0496115_0002966_5038_5850 238
395 3300048918 Ga0496115_0007363 Ga0496115_0007363_689_1504 238
396 3300048918 Ga0496115_0220426 Ga0496115_0220426_560_1414 238
397 3300049568 Ga0501031_0034011 Ga0501031_0034011_2108_2917 238
398 3300049569 Ga0501032_0009948 Ga0501032_0009948_5000_5809 238
399 3300049570 Ga0501033_0019503 Ga0501033_0019503_1633_2442 238
400 3300049571 Ga0501034_0041459 Ga0501034_0041459_1052_1861 238
401 3300049572 Ga0501036_0096771 Ga0501036_0096771_1052_1861 238
402 3300049573 Ga0501037_0039122 Ga0501037_0039122_2325_3134 238
403 3300049574 Ga0501038_0002245 Ga0501038_0002245_16724_17533 238
404 3300049575 Ga0501039_0006422 Ga0501039_0006422_4087_4896 238
405 3300049579 Ga0501043_0009765 Ga0501043_0009765_5001_5810 238
406 3300049582 Ga0501048_0056591 Ga0501048_0056591_1625_2434 238
407 3300049583 Ga0501067_0020854 Ga0501067_0020854_894_1703 238
408 3300049584 Ga0501068_0031041 Ga0501068_0031041_2064_2873 238
409 3300049585 Ga0501069_0006757 Ga0501069_0006757_1164_1973 238
410 3300049586 Ga0501070_0008200 Ga0501070_0008200_415_1224 238
411 3300049589 Ga0501073_0001829 Ga0501073_0001829_11275_12084 238
412 3300049590 Ga0501074_0051170 Ga0501074_0051170_1705_2514 238
413 3300049741 Ga0501079_0058776 Ga0501079_0058776_28_840 238
414 3300049741 Ga0501079_0162419 Ga0501079_0162419_493_1302 238
415 3300049742 Ga0501080_0043678 Ga0501080_0043678_173_982 238
416 3300049744 Ga0501083_0021402 Ga0501083_0021402_421_1230 238
417 3300049822 Ga0501035_0038182 Ga0501035_0038182_341_1150 238
418 3300049823 Ga0501044_0355977 Ga0501044_0355977_440_1249 238
419 3300050509 nmdc:mga0qj67_131398_c1 nmdc:mga0qj67_131398_c1_850_1662 238
420 3300053084 Ga0495595_0014702 Ga0495595_0014702_2431_3243 238
421 3300053108 Ga0500562_008199 Ga0500562_008199_748_1521 238
422 3300053145 Ga0500586_017010 Ga0500586_017010_670_1443 238
423 3300060353 Ga0501082_0066090 Ga0501082_0066090_397_1206 238
424 3300003856 Ga0058692_1004350 Ga0058692_10043505 239
425 3300005564 Ga0070664_100079854 Ga0070664_1000798542 239
426 3300005614 Ga0068856_100262991 Ga0068856_1002629912 239
427 3300005985 Ga0081539_10001899 Ga0081539_1000189914 239
428 3300009148 Ga0105243_10232122 Ga0105243_102321222 239
429 3300013307 Ga0157372_10883196 Ga0157372_108831961 239
430 3300025302 Ga0207426_1000748 Ga0207426_10007482 239
431 3300025935 Ga0207709_10114032 Ga0207709_101140322 239
432 3300025945 Ga0207679_10047466 Ga0207679_100474662 239
433 3300026023 Ga0207677_10243252 Ga0207677_102432522 239
434 3300027312 Ga0209371_1000729 Ga0209371_100072932 239
435 3300028379 Ga0268266_10038101 Ga0268266_100381012 239
436 3300030500 Ga0268256_1031119 Ga0268256_10311192 239
437 3300044656 Ga0466969_0013797 Ga0466969_0013797_365_1177 239
438 3300044683 Ga0466965_0252074 Ga0466965_0252074_52_903 239
439 3300044684 Ga0466966_0031125 Ga0466966_0031125_559_1371 239
440 3300044842 Ga0466957_0218244 Ga0466957_0218244_232_1044 239
441 3300045049 Ga0466959_0007314 Ga0466959_0007314_4701_5513 239
442 3300045049 Ga0466959_0020619 Ga0466959_0020619_2834_3685 239
443 3300045836 Ga0466958_0098008 Ga0466958_0098008_316_1128 239
444 3300045976 Ga0466967_0037745 Ga0466967_0037745_1805_2617 239
445 3300046558 Ga0495633_0028682 Ga0495633_0028682_435_1202 239
446 3300048905 Ga0496102_0070352 Ga0496102_0070352_37_870 239
447 3300048907 Ga0496104_0004166 Ga0496104_0004166_8115_8948 239
448 3300048909 Ga0496106_0023141 Ga0496106_0023141_1939_2772 239
449 3300048911 Ga0496108_0000551 Ga0496108_0000551_13554_14387 239
450 3300048911 Ga0496108_0749892 Ga0496108_0749892_25_783 239
451 3300048912 Ga0496109_0038936 Ga0496109_0038936_1591_2424 239
452 3300048913 Ga0496110_0039626 Ga0496110_0039626_3156_3989 239
453 3300048916 Ga0496113_0241049 Ga0496113_0241049_551_1363 239
454 3300050512 nmdc:mga0n895_305603_c1 nmdc:mga0n895_305603_c1_436_1182 239
455 3300050515 nmdc:mga0a205_188080_c1 nmdc:mga0a205_188080_c1_1024_1770 239
456 3300053077 Ga0495601_0283393 Ga0495601_0283393_227_1048 239
457 3300053157 Ga0500624_001065 Ga0500624_001065_4524_5291 239
458 3300053161 Ga0500634_0031025 Ga0500634_0031025_1940_2707 239
459 3300061719 Ga0466962_0190780 Ga0466962_0190780_36_848 239
460 iso_pu_bacteria 2537561587 2537873676 239
461 iso_pu_bacteria 2554235003 2554246035 239
462 iso_pu_bacteria 2558860242 2559296199 239
463 iso_pu_bacteria 2599185210 2599604651 239
464 iso_pu_bacteria 2600255279 2601612928 239
465 iso_pu_bacteria 2600255308 2601748474 239
466 iso_pu_bacteria 2643221693 2644522975 239
467 iso_pu_bacteria 2808606387 2808988420 239
468 iso_pu_bacteria 2838675328 2838679711 239
469 iso_pu_bacteria 2838714209 2838717519 239
470 iso_pu_bacteria 2838719591 2838724280 239
471 iso_pu_bacteria 2838724970 2838729403 239
472 iso_pu_bacteria 2841846520 2841850831 239
473 iso_pu_bacteria 2841859092 2841861734 239
474 iso_pu_bacteria 2842124991 2842129636 239
475 iso_pu_bacteria 2842130223 2842134780 239
476 iso_pu_bacteria 2842152218 2842156702 239
477 iso_pu_bacteria 2842170452 2842172960 239
478 iso_pu_bacteria 2842175837 2842180320 239
479 iso_pu_bacteria 2842187318 2842192020 239
480 iso_pu_bacteria 2842211629 2842216336 239
481 iso_pu_bacteria 2842224351 2842229056 239
482 iso_pu_bacteria 2842515876 2842518000 239
483 iso_pu_bacteria 2899792073 2899792822 239
484 iso_pu_bacteria 2899845264 2899848542 239
485 iso_pu_bacteria 2919114240 2919119271 239
486 iso_pu_bacteria 2926754445 2926759301 239
487 iso_pu_bacteria 2926760298 2926763148 239
488 iso_pu_bacteria 2933006813 2933011308 239
489 iso_pu_bacteria 2933011516 2933013629 239
490 iso_pu_bacteria 2933594066 2933596931 239
491 iso_pu_bacteria 2979089926 2979091830 239
492 iso_pu_bacteria 2979095461 2979097345 239
493 iso_pu_bacteria 2979100975 2979104335 239
494 iso_pu_bacteria 2984509177 2984511084 239
495 iso_pu_bacteria 2984518228 2984522553 239
496 iso_pu_bacteria 2984537506 2984541857 239
497 iso_pu_bacteria 2984601300 2984604212 239
498 iso_pu_bacteria 650716007 650842596 239
499 3300039437 Ga0436365_0851813 Ga0436365_0851813_194_1066 240
500 3300003187 JGI25151J46595_10018848 JGI25151J46595_100188482 241
501 3300003320 rootH2_10205803 rootH2_102058032 241
502 3300003856 Ga0058692_1001859 Ga0058692_10018595 241
503 3300006048 Ga0075363_100156503 Ga0075363_1001565031 241
504 3300006186 Ga0075369_10192290 Ga0075369_101922901 241
505 3300006195 Ga0075366_10231691 Ga0075366_102316911 241
506 3300006353 Ga0075370_10273184 Ga0075370_102731842 241
507 3300006948 Ga0099826_10035288 Ga0099826_100352882 241
508 3300013102 Ga0157371_10000268 Ga0157371_1000026838 241
509 3300013104 Ga0157370_10009085 Ga0157370_100090853 241
510 3300025294 Ga0209025_1000227 Ga0209025_1000227106 241
511 3300027312 Ga0209371_1000022 Ga0209371_1000022508 241
512 3300027666 Ga0209282_1000039 Ga0209282_100003959 241
513 3300028379 Ga0268266_10006494 Ga0268266_1000649410 241
514 3300030500 Ga0268256_1000019 Ga0268256_100001912 241
515 3300030744 Ga0316181_1085764 Ga0316181_10857642 241
516 3300046674 Ga0495588_0001283 Ga0495588_0001283_9241_10020 241
517 3300048919 Ga0496116_0048566 Ga0496116_0048566_232_1011 241
518 3300048920 Ga0496117_0000036 Ga0496117_0000036_43006_43785 241
519 3300048921 Ga0496118_0008209 Ga0496118_0008209_6036_6815 241
520 3300048923 Ga0496120_0000495 Ga0496120_0000495_128_907 241
521 3300048925 Ga0496122_0000002 Ga0496122_0000002_847755_848534 241
522 3300048926 Ga0496123_0000002 Ga0496123_0000002_847755_848534 241
523 3300048926 Ga0496123_0000002 Ga0496123_0000002_963149_963928 241
524 3300048927 Ga0496124_0007696 Ga0496124_0007696_6837_7616 241
525 3300048927 Ga0496124_0013261 Ga0496124_0013261_1997_2776 241
526 3300050489 nmdc:mga03683_5036_c1 nmdc:mga03683_5036_c1_2517_3296 241
527 3300050490 nmdc:mga03n38_108468_c1 nmdc:mga03n38_108468_c1_101_880 241
528 3300050491 nmdc:mga00v17_2501_c1 nmdc:mga00v17_2501_c1_470_1249 241
529 3300050493 nmdc:mga0k408_44868_c1 nmdc:mga0k408_44868_c1_678_1457 241
530 3300050494 nmdc:mga06z11_275585_c1 nmdc:mga06z11_275585_c1_164_943 241
531 3300050496 nmdc:mga07m45_265882_c1 nmdc:mga07m45_265882_c1_194_973 241
532 3300050516 nmdc:mga0sz30_746_c1 nmdc:mga0sz30_746_c1_1822_2601 241
533 3300053137 Ga0500561_0000260 Ga0500561_0000260_7920_8699 241
534 3300059643 Ga0587072_004769 Ga0587072_004769_100_879 241
535 3300009098 Ga0105245_10024784 Ga0105245_100247844 242
536 3300009148 Ga0105243_10096268 Ga0105243_100962682 242
537 3300013297 Ga0157378_10018830 Ga0157378_100188306 242
538 3300013308 Ga0157375_10124685 Ga0157375_101246852 242
539 3300014745 Ga0157377_10387827 Ga0157377_103878272 242
540 3300025935 Ga0207709_10074524 Ga0207709_100745244 242
541 3300031911 Ga0307412_10009071 Ga0307412_100090712 243
542 3300048903 Ga0496100_0371779 Ga0496100_0371779_130_879 245
543 3300048904 Ga0496101_0164474 Ga0496101_0164474_897_1646 245
544 3300048907 Ga0496104_0062403 Ga0496104_0062403_1603_2352 245
545 3300048907 Ga0496104_0074328 Ga0496104_0074328_1286_2035 245
546 3300048908 Ga0496105_0103823 Ga0496105_0103823_1087_1836 245
547 3300039438 Ga0436360_0691402 Ga0436360_0691402_473_1246 247
548 3300006028 Ga0070717_10065196 Ga0070717_100651962 248
549 3300006175 Ga0070712_100304572 Ga0070712_1003045722 248
550 3300025915 Ga0207693_10101015 Ga0207693_101010152 248
551 3300053108 Ga0500562_006399 Ga0500562_006399_1300_2091 248
552 3300002239 JGI24034J26672_10016614 JGI24034J26672_100166142 253
553 3300005335 Ga0070666_10007782 Ga0070666_100077826 253
554 3300005347 Ga0070668_100000586 Ga0070668_10000058612 253
555 3300005367 Ga0070667_100000100 Ga0070667_10000010053 253
556 3300005841 Ga0068863_100000075 Ga0068863_10000007561 253
557 3300005843 Ga0068860_100019066 Ga0068860_1000190664 253
558 3300025903 Ga0207680_10000730 Ga0207680_1000073014 253
559 3300025923 Ga0207681_10088114 Ga0207681_100881142 253
560 3300025972 Ga0207668_10000707 Ga0207668_100007078 253
561 3300025986 Ga0207658_10000079 Ga0207658_1000007953 253
562 3300026088 Ga0207641_10000381 Ga0207641_1000038140 253
563 3300028381 Ga0268264_10024577 Ga0268264_100245774 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

24

242

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

126

287

0.93

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

26

120

0.85

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

30

127

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6t7m-assembly1.cif.gz_C crystal structure of salmonella typhimurium fabg at 2.65 a resolution 0.9735 4 250
1q7c-assembly1.cif.gz_A the structure of betaketoacyl-[acp] reductase y151f mutant in complex with nadph fragment 0.9728 4 250
4dqx-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9727 2 251
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.9725 2 253
1q7b-assembly1.cif.gz_D the structure of betaketoacyl-[acp] reductase from e. coli in complex with nadp+ 0.9721 4 250
ID Description Score Start End Superfamily
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9725 2 253 3.40.50.720
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9664 2 249 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9658 83 250 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9657 1 253 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.964 3 253 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A229T7P3-F1-model_v4 Short-chain dehydrogenase 0.9851 3 253 GO:0016491
AF-A0A3A9T5U6-F1-model_v4 deleted 0.9818 2 253
AF-A0A847XKT4-F1-model_v4 SDR family oxidoreductase 0.9807 3 253 GO:0016491
AF-A0A6L4AD96-F1-model_v4 SDR family oxidoreductase 0.9803 3 252 GO:0016616
AF-A0A395KB85-F1-model_v4 deleted 0.9781 1 253

Feature Viewer

pLDDT pTM Quality
96.57 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map