F464077

General Info

Members Datasets Scaffolds Average Seq Length
563 300 1126 110

Family's Representative Sequence

Representative Sequence 3300039145|Ga0237816_01327|Ga0237816_01327_461_850
Length 120
Sequence LPKLPRSVSRISDDQEAQVKGEDRKAAISAYKERKVEAGIYSIRCAASGETWVGRAPDLSTIQNRIWFTLRQGINSHGSPDAFTFEILEQLEDEDSAYIRDRALNDRLMHWTETLGAVRI

Samples

Sample ID Description Type Environment
1 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
174 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
181 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
182 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
183 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
184 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
187 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
188 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
189 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
221 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
222 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
271 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
272 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
273 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
274 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
275 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
276 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
277 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
278 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
279 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
280 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
281 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
282 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
283 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
284 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
285 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
286 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
287 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
288 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
289 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
290 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
291 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
292 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
293 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
294 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
295 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
296 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
297 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
298 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
299 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
300 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.2
Metatranscriptomes 0
Isolates 4.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.43
Nodule 2.49
Rhizoplane 5.15
Rhizosphere 72.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0237816_01327 3300039145 Bacteria 2000
2 JGI25153J46596_10006220 3300003215 Bacteria 6109
3 rootH2_10076462 3300003320 Bacteria 1078
4 rootH2_10187583 3300003320 Bacteria 2149
5 rootL2_10171359 3300003322 Bacteria 2352
6 rootH1_10105058 3300003323 Bacteria 2564
7 Ga0070658_10845054 3300005327 Bacteria 796
8 Ga0070676_10078907 3300005328 Bacteria 1992
9 Ga0070676_10641880 3300005328 Bacteria 770
10 Ga0070683_101555482 3300005329 Bacteria 636
11 Ga0070683_101934904 3300005329 Bacteria 567
12 Ga0070690_100208315 3300005330 Bacteria 1364
13 Ga0070677_10805954 3300005333 Bacteria 537
14 Ga0068869_100135574 3300005334 Bacteria 1896
15 Ga0068869_100365373 3300005334 Bacteria 1179
16 Ga0068869_100793074 3300005334 Bacteria 814
17 Ga0068869_100820140 3300005334 Bacteria 801
18 Ga0070666_10074510 3300005335 Bacteria 2314
19 Ga0070666_10154933 3300005335 Bacteria 1600
20 Ga0070682_100895182 3300005337 Bacteria 729
21 Ga0068868_100034940 3300005338 Bacteria 3883
22 Ga0068868_100093127 3300005338 Bacteria 2429
23 Ga0068868_100365533 3300005338 Bacteria 1239
24 Ga0068868_101679971 3300005338 Bacteria 598
25 Ga0070660_100138287 3300005339 Bacteria 1953
26 Ga0070660_100588011 3300005339 Bacteria 930
27 Ga0070689_100305336 3300005340 Bacteria 1325
28 Ga0070689_101409050 3300005340 Bacteria 630
29 Ga0070691_10651969 3300005341 Bacteria 627
30 Ga0070687_101364553 3300005343 Bacteria 529
31 Ga0070661_100764415 3300005344 Bacteria 791
32 Ga0070692_10125354 3300005345 Bacteria 1437
33 Ga0070668_100049295 3300005347 Bacteria 3240
34 Ga0070668_100056779 3300005347 Bacteria 3024
35 Ga0070668_100082410 3300005347 Bacteria 2523
36 Ga0070668_100155433 3300005347 Bacteria 1853
37 Ga0070668_100616616 3300005347 Bacteria 950
38 Ga0070668_100804743 3300005347 Bacteria 835
39 Ga0070669_100147540 3300005353 Bacteria 1818
40 Ga0070669_100506647 3300005353 Bacteria 1002
41 Ga0070669_100518456 3300005353 Bacteria 991
42 Ga0070675_100257112 3300005354 Bacteria 1530
43 Ga0070675_100614248 3300005354 Bacteria 987
44 Ga0070675_101128401 3300005354 Bacteria 721
45 Ga0070671_100034627 3300005355 Bacteria 4181
46 Ga0070671_101307225 3300005355 Bacteria 640
47 Ga0070674_100192577 3300005356 Bacteria 1569
48 Ga0070674_100206353 3300005356 Bacteria 1520
49 Ga0070674_101527105 3300005356 Bacteria 601
50 Ga0070673_100379717 3300005364 Bacteria 1260
51 Ga0070673_100383988 3300005364 Bacteria 1253
52 Ga0070688_100684568 3300005365 Bacteria 793
53 Ga0070659_100078344 3300005366 Bacteria 2636
54 Ga0070659_101006070 3300005366 Bacteria 732
55 Ga0070667_100258824 3300005367 Bacteria 1558
56 Ga0070667_100534468 3300005367 Bacteria 1077
57 Ga0070667_101608993 3300005367 Bacteria 611
58 Ga0070703_10561708 3300005406 Bacteria 522
59 Ga0070701_10131032 3300005438 Bacteria 1424
60 Ga0070705_100122496 3300005440 Bacteria 1681
61 Ga0070700_100119485 3300005441 Bacteria 1764
62 Ga0070700_100217925 3300005441 Bacteria 1350
63 Ga0070700_100669206 3300005441 Bacteria 822
64 Ga0070700_101883445 3300005441 Bacteria 517
65 Ga0070663_100076823 3300005455 Bacteria 2443
66 Ga0070663_100212139 3300005455 Bacteria 1516
67 Ga0070663_100254269 3300005455 Bacteria 1391
68 Ga0070663_100286406 3300005455 Bacteria 1314
69 Ga0070678_100238450 3300005456 Bacteria 1519
70 Ga0070678_100380119 3300005456 Bacteria 1222
71 Ga0070678_101307756 3300005456 Bacteria 675
72 Ga0070662_100042396 3300005457 Bacteria 3250
73 Ga0070662_100501281 3300005457 Bacteria 1013
74 Ga0070662_101412548 3300005457 Bacteria 600
75 Ga0068867_100267023 3300005459 Bacteria 1397
76 Ga0068867_102213982 3300005459 Bacteria 522
77 Ga0070685_10069598 3300005466 Bacteria 2082
78 Ga0070685_10249150 3300005466 Bacteria 1176
79 Ga0068853_100203032 3300005539 Bacteria 1804
80 Ga0068853_101663815 3300005539 Bacteria 619
81 Ga0070672_100320405 3300005543 Bacteria 1318
82 Ga0070672_100332538 3300005543 Bacteria 1293
83 Ga0070686_100529796 3300005544 Bacteria 918
84 Ga0070695_101696491 3300005545 Bacteria 529
85 Ga0070665_100073837 3300005548 Bacteria 3416
86 Ga0070665_100076469 3300005548 Bacteria 3354
87 Ga0070665_100120099 3300005548 Bacteria 2630
88 Ga0070665_100143695 3300005548 Bacteria 2389
89 Ga0070665_100633162 3300005548 Bacteria 1083
90 Ga0070665_101395471 3300005548 Bacteria 710
91 Ga0070665_101571978 3300005548 Bacteria 666
92 Ga0070664_101068301 3300005564 Bacteria 760
93 Ga0070664_101412757 3300005564 Bacteria 658
94 Ga0070664_101439229 3300005564 Bacteria 652
95 Ga0070664_102229272 3300005564 Bacteria 520
96 Ga0070664_102236769 3300005564 Bacteria 519
97 Ga0068857_100291575 3300005577 Bacteria 1502
98 Ga0068854_101223571 3300005578 Bacteria 674
99 Ga0068856_100156528 3300005614 Bacteria 2289
100 Ga0070702_100075478 3300005615 Bacteria 2004
101 Ga0070702_100144161 3300005615 Bacteria 1521
102 Ga0070702_100640276 3300005615 Bacteria 803
103 Ga0068852_100739147 3300005616 Bacteria 996
104 Ga0068852_101833964 3300005616 Bacteria 629
105 Ga0068859_100219781 3300005617 Bacteria 1987
106 Ga0068859_100225203 3300005617 Bacteria 1963
107 Ga0068864_100027355 3300005618 Bacteria 4816
108 Ga0068864_101339523 3300005618 Bacteria 717
109 Ga0068866_10035700 3300005718 Bacteria 2430
110 Ga0068866_10077597 3300005718 Bacteria 1774
111 Ga0068866_10638006 3300005718 Bacteria 724
112 Ga0068861_100041512 3300005719 Bacteria 3446
113 Ga0068861_100151485 3300005719 Bacteria 1903
114 Ga0068861_100203964 3300005719 Bacteria 1661
115 Ga0068870_10237436 3300005840 Bacteria 1124
116 Ga0068870_10357663 3300005840 Bacteria 939
117 Ga0068870_10999003 3300005840 Bacteria 597
118 Ga0068863_100408132 3300005841 Bacteria 1329
119 Ga0068863_100718395 3300005841 Bacteria 994
120 Ga0068863_102138161 3300005841 Bacteria 570
121 Ga0068858_100183444 3300005842 Bacteria 1976
122 Ga0068858_100210599 3300005842 Bacteria 1839
123 Ga0068858_100441970 3300005842 Bacteria 1253
124 Ga0068858_101026119 3300005842 Bacteria 809
125 Ga0068860_100183715 3300005843 Bacteria 2021
126 Ga0068860_100639253 3300005843 Bacteria 1071
127 Ga0068860_101362533 3300005843 Bacteria 730
128 Ga0068860_101728341 3300005843 Bacteria 647
129 Ga0068862_100142234 3300005844 Bacteria 2130
130 Ga0068862_100211515 3300005844 Bacteria 1752
131 Ga0068862_100398195 3300005844 Bacteria 1287
132 Ga0068862_100441919 3300005844 Bacteria 1224
133 Ga0068862_100587565 3300005844 Bacteria 1067
134 Ga0081455_10023976 3300005937 Bacteria 5662
135 Ga0081455_10070815 3300005937 Bacteria 2894
136 Ga0081455_10307696 3300005937 Bacteria 1134
137 Ga0081540_1083973 3300005983 Bacteria 1423
138 Ga0081539_10190980 3300005985 Bacteria 953
139 Ga0075365_10099469 3300006038 Bacteria 1990
140 Ga0075365_10134926 3300006038 Bacteria 1710
141 Ga0075365_10170418 3300006038 Bacteria 1519
142 Ga0075365_10217924 3300006038 Bacteria 1339
143 Ga0075368_10024847 3300006042 Bacteria 2297
144 Ga0075368_10039888 3300006042 Bacteria 1842
145 Ga0075368_10433105 3300006042 Bacteria 581
146 Ga0075363_100007132 3300006048 Bacteria 5116
147 Ga0075363_100089902 3300006048 Bacteria 1689
148 Ga0075363_100311469 3300006048 Bacteria 915
149 Ga0075363_100495817 3300006048 Bacteria 725
150 Ga0075364_10115484 3300006051 Bacteria 1794
151 Ga0075364_10138153 3300006051 Bacteria 1638
152 Ga0075364_10489725 3300006051 Bacteria 841
153 Ga0070716_100102467 3300006173 Bacteria 1758
154 Ga0075362_10024624 3300006177 Bacteria 2554
155 Ga0075362_10055672 3300006177 Bacteria 1779
156 Ga0075362_10326592 3300006177 Bacteria 765
157 Ga0075362_10359708 3300006177 Bacteria 729
158 Ga0075367_10005374 3300006178 Bacteria 6353
159 Ga0075367_10177797 3300006178 Bacteria 1326
160 Ga0075367_10192547 3300006178 Bacteria 1272
161 Ga0075367_10896182 3300006178 Bacteria 565
162 Ga0075367_11127054 3300006178 Bacteria 502
163 Ga0075369_10012450 3300006186 Bacteria 3361
164 Ga0075369_10050027 3300006186 Bacteria 1806
165 Ga0075369_10258939 3300006186 Bacteria 809
166 Ga0075369_10503599 3300006186 Bacteria 576
167 Ga0075427_10022933 3300006194 Bacteria 998
168 Ga0075366_10300094 3300006195 Bacteria 983
169 Ga0075366_10497510 3300006195 Bacteria 754
170 Ga0075366_10523516 3300006195 Bacteria 734
171 Ga0097621_100108321 3300006237 Bacteria 2345
172 Ga0097621_100495686 3300006237 Bacteria 1106
173 Ga0097621_102087286 3300006237 Bacteria 542
174 Ga0075370_10415754 3300006353 Bacteria 808
175 Ga0075370_10477342 3300006353 Bacteria 751
176 Ga0068871_102240663 3300006358 Bacteria 521
177 Ga0075428_100259965 3300006844 Bacteria 1869
178 Ga0075434_100497086 3300006871 Bacteria 1240
179 Ga0068865_100090150 3300006881 Bacteria 2222
180 Ga0068865_100268450 3300006881 Bacteria 1354
181 Ga0075436_100282056 3300006914 Bacteria 1188
182 Ga0097620_100219786 3300006931 Bacteria 1987
183 Ga0097620_100225217 3300006931 Bacteria 1963
184 Ga0075435_100309426 3300007076 Bacteria 1352
185 Ga0099795_10076762 3300007788 Bacteria 1271
186 Ga0105244_10346738 3300009036 Bacteria 685
187 Ga0105250_10167738 3300009092 Bacteria 918
188 Ga0105240_12268195 3300009093 Bacteria 562
189 Ga0111539_10113772 3300009094 Bacteria 3174
190 Ga0111539_11538031 3300009094 Bacteria 772
191 Ga0111539_12121272 3300009094 Bacteria 652
192 Ga0105245_10049800 3300009098 Bacteria 3752
193 Ga0105245_11002491 3300009098 Bacteria 880
194 Ga0105245_11373087 3300009098 Bacteria 756
195 Ga0105247_10679794 3300009101 Bacteria 772
196 Ga0105247_10878549 3300009101 Bacteria 690
197 Ga0114129_12101334 3300009147 Bacteria 681
198 Ga0105243_10080075 3300009148 Bacteria 2663
199 Ga0105243_10140056 3300009148 Bacteria 2063
200 Ga0105243_10620038 3300009148 Bacteria 1044
201 Ga0105243_12364122 3300009148 Bacteria 569
202 Ga0105241_10049621 3300009174 Bacteria 3197
203 Ga0105241_10611859 3300009174 Bacteria 985
204 Ga0105242_11700211 3300009176 Bacteria 667
205 Ga0105248_10167436 3300009177 Bacteria 2477
206 Ga0105248_10170226 3300009177 Bacteria 2455
207 Ga0105248_11004595 3300009177 Bacteria 942
208 Ga0105237_10032495 3300009545 Bacteria 5283
209 Ga0105237_10425081 3300009545 Bacteria 1334
210 Ga0105237_11551322 3300009545 Bacteria 669
211 Ga0105238_10228344 3300009551 Bacteria 1838
212 Ga0105238_10769003 3300009551 Bacteria 978
213 Ga0105238_11016755 3300009551 Bacteria 850
214 Ga0105249_10030241 3300009553 Bacteria 4895
215 Ga0105249_11027720 3300009553 Bacteria 893
216 Ga0105239_10160880 3300010375 Bacteria 2508
217 Ga0105239_11567926 3300010375 Bacteria 761
218 Ga0105246_10142789 3300011119 Bacteria 1802
219 Ga0105246_10675830 3300011119 Bacteria 902
220 Ga0157373_11065647 3300013100 Bacteria 605
221 Ga0157374_10950369 3300013296 Bacteria 878
222 Ga0157374_11024785 3300013296 Bacteria 845
223 Ga0157374_11851258 3300013296 Bacteria 629
224 Ga0157374_12575430 3300013296 Bacteria 536
225 Ga0157378_10004545 3300013297 Bacteria 12168
226 Ga0157378_10233208 3300013297 Bacteria 1755
227 Ga0157378_10660365 3300013297 Bacteria 1062
228 Ga0157378_10721066 3300013297 Bacteria 1018
229 Ga0163162_10457410 3300013306 Bacteria 1408
230 Ga0163162_10919147 3300013306 Bacteria 987
231 Ga0163162_12284346 3300013306 Bacteria 621
232 Ga0157372_12111609 3300013307 Bacteria 647
233 Ga0157375_10104149 3300013308 Bacteria 2926
234 Ga0157375_10395082 3300013308 Bacteria 1550
235 Ga0157375_12161314 3300013308 Bacteria 663
236 Ga0163163_10814730 3300014325 Bacteria 997
237 Ga0163163_10982817 3300014325 Bacteria 907
238 Ga0163163_11576640 3300014325 Bacteria 718
239 Ga0157380_10336956 3300014326 Bacteria 1405
240 Ga0157380_10529161 3300014326 Bacteria 1151
241 Ga0157380_10535725 3300014326 Bacteria 1145
242 Ga0157380_10793920 3300014326 Bacteria 963
243 Ga0182008_10201138 3300014497 Bacteria 1014
244 Ga0157377_10101217 3300014745 Bacteria 1717
245 Ga0157377_10276667 3300014745 Bacteria 1098
246 Ga0157377_10617037 3300014745 Bacteria 776
247 Ga0157379_10232311 3300014968 Bacteria 1672
248 Ga0157379_10342299 3300014968 Bacteria 1368
249 Ga0157379_11554028 3300014968 Bacteria 645
250 Ga0157379_11699838 3300014968 Bacteria 618
251 Ga0157379_11977266 3300014968 Bacteria 576
252 Ga0157376_10227587 3300014969 Bacteria 1730
253 Ga0157376_10614819 3300014969 Bacteria 1083
254 Ga0157376_10827080 3300014969 Bacteria 940
255 Ga0157376_11112565 3300014969 Bacteria 816
256 Ga0163161_10598598 3300017792 Bacteria 909
257 Ga0163161_11837115 3300017792 Bacteria 539
258 Ga0209758_1018975 3300025297 Bacteria 3341
259 Ga0207697_10371515 3300025315 Bacteria 635
260 Ga0207697_10498195 3300025315 Bacteria 538
261 Ga0207682_10273446 3300025893 Bacteria 789
262 Ga0207642_10306472 3300025899 Bacteria 923
263 Ga0207642_10369977 3300025899 Bacteria 850
264 Ga0207642_10742063 3300025899 Bacteria 621
265 Ga0207710_10063624 3300025900 Bacteria 1679
266 Ga0207688_10036312 3300025901 Bacteria 2731
267 Ga0207688_10057082 3300025901 Bacteria 2194
268 Ga0207688_10082060 3300025901 Bacteria 1842
269 Ga0207680_10216007 3300025903 Bacteria 1313
270 Ga0207647_10122680 3300025904 Bacteria 1531
271 Ga0207645_10056137 3300025907 Bacteria 2514
272 Ga0207643_10097287 3300025908 Bacteria 1722
273 Ga0207643_10136266 3300025908 Bacteria 1464
274 Ga0207671_10309486 3300025914 Bacteria 1249
275 Ga0207662_10245505 3300025918 Bacteria 1173
276 Ga0207662_10834838 3300025918 Bacteria 651
277 Ga0207657_10211861 3300025919 Bacteria 1555
278 Ga0207681_10246337 3300025923 Bacteria 1393
279 Ga0207681_10583736 3300025923 Bacteria 922
280 Ga0207681_11732732 3300025923 Bacteria 522
281 Ga0207694_10367349 3300025924 Bacteria 1193
282 Ga0207694_11176763 3300025924 Bacteria 649
283 Ga0207650_11317396 3300025925 Bacteria 615
284 Ga0207659_10529534 3300025926 Bacteria 1000
285 Ga0207659_10832224 3300025926 Bacteria 793
286 Ga0207687_10281807 3300025927 Bacteria 1332
287 Ga0207687_11493034 3300025927 Bacteria 581
288 Ga0207644_10345706 3300025931 Bacteria 1207
289 Ga0207690_10086573 3300025932 Bacteria 2202
290 Ga0207706_10111564 3300025933 Bacteria 2406
291 Ga0207706_10946995 3300025933 Bacteria 726
292 Ga0207686_10273501 3300025934 Bacteria 1244
293 Ga0207709_10038064 3300025935 Bacteria 2862
294 Ga0207709_10100101 3300025935 Bacteria 1914
295 Ga0207709_11383277 3300025935 Bacteria 583
296 Ga0207669_10032370 3300025937 Bacteria 2935
297 Ga0207669_10085653 3300025937 Bacteria 2035
298 Ga0207669_10183596 3300025937 Bacteria 1502
299 Ga0207704_10069344 3300025938 Bacteria 2227
300 Ga0207704_10108031 3300025938 Bacteria 1873
301 Ga0207665_10106639 3300025939 Bacteria 1964
302 Ga0207691_10004633 3300025940 Bacteria 13309
303 Ga0207691_10243243 3300025940 Bacteria 1555
304 Ga0207691_10296390 3300025940 Bacteria 1390
305 Ga0207691_10303591 3300025940 Bacteria 1371
306 Ga0207711_10373285 3300025941 Bacteria 1323
307 Ga0207689_10139480 3300025942 Bacteria 1997
308 Ga0207689_10268514 3300025942 Bacteria 1412
309 Ga0207689_10373701 3300025942 Bacteria 1186
310 Ga0207689_10656442 3300025942 Bacteria 884
311 Ga0207679_11064185 3300025945 Bacteria 742
312 Ga0207679_11407891 3300025945 Bacteria 640
313 Ga0207651_10111057 3300025960 Bacteria 2058
314 Ga0207651_10187103 3300025960 Bacteria 1648
315 Ga0207712_10475675 3300025961 Bacteria 1064
316 Ga0207712_11250661 3300025961 Bacteria 663
317 Ga0207712_11259323 3300025961 Bacteria 661
318 Ga0207668_10022219 3300025972 Bacteria 4057
319 Ga0207668_10031660 3300025972 Bacteria 3486
320 Ga0207668_10154582 3300025972 Bacteria 1780
321 Ga0207668_10302972 3300025972 Bacteria 1319
322 Ga0207668_10316039 3300025972 Bacteria 1294
323 Ga0207668_10512654 3300025972 Bacteria 1033
324 Ga0207668_10605921 3300025972 Bacteria 954
325 Ga0207658_10189345 3300025986 Bacteria 1709
326 Ga0207658_10506090 3300025986 Bacteria 1076
327 Ga0207703_10054486 3300026035 Bacteria 3252
328 Ga0207703_10118276 3300026035 Bacteria 2271
329 Ga0207703_10746935 3300026035 Bacteria 932
330 Ga0207703_10983575 3300026035 Bacteria 809
331 Ga0207639_10319507 3300026041 Bacteria 1378
332 Ga0207678_10098865 3300026067 Bacteria 2493
333 Ga0207678_10119454 3300026067 Bacteria 2249
334 Ga0207678_10424333 3300026067 Bacteria 1153
335 Ga0207678_10669934 3300026067 Bacteria 912
336 Ga0207708_10071006 3300026075 Bacteria 2666
337 Ga0207708_10195064 3300026075 Bacteria 1614
338 Ga0207708_10839509 3300026075 Bacteria 793
339 Ga0207702_10556557 3300026078 Bacteria 1122
340 Ga0207641_10437892 3300026088 Bacteria 1261
341 Ga0207641_10846840 3300026088 Bacteria 906
342 Ga0207676_10050451 3300026095 Bacteria 3244
343 Ga0207676_10308799 3300026095 Bacteria 1447
344 Ga0207674_10284884 3300026116 Bacteria 1601
345 Ga0207675_100049860 3300026118 Bacteria 3906
346 Ga0207675_100155591 3300026118 Bacteria 2178
347 Ga0207675_100438953 3300026118 Bacteria 1292
348 Ga0207683_10037509 3300026121 Bacteria 4221
349 Ga0207683_10153567 3300026121 Bacteria 2078
350 Ga0207683_10445566 3300026121 Bacteria 1193
351 Ga0207698_10448578 3300026142 Bacteria 1245
352 Ga0207698_10587089 3300026142 Bacteria 1097
353 Ga0209813_10017500 3300027866 Bacteria 1968
354 Ga0209813_10454568 3300027866 Bacteria 524
355 Ga0207428_10070646 3300027907 Bacteria 2744
356 Ga0268266_10002325 3300028379 Bacteria 20596
357 Ga0268266_10015568 3300028379 Bacteria 6521
358 Ga0268266_10029506 3300028379 Bacteria 4662
359 Ga0268266_10042901 3300028379 Bacteria 3864
360 Ga0268265_10218664 3300028380 Bacteria 1665
361 Ga0268265_10310122 3300028380 Bacteria 1424
362 Ga0268265_10459939 3300028380 Bacteria 1190
363 Ga0268265_11249628 3300028380 Bacteria 741
364 Ga0268265_11488113 3300028380 Bacteria 680
365 Ga0268264_10057035 3300028381 Bacteria 3266
366 Ga0307517_10000071 3300028786 Bacteria 138548
367 Ga0307517_10300092 3300028786 Bacteria 901
368 Ga0307517_10588506 3300028786 Bacteria 550
369 Ga0307515_10038013 3300028794 Bacteria 7717
370 Ga0307515_10244046 3300028794 Bacteria 1561
371 Ga0307515_10339970 3300028794 Bacteria 1154
372 Ga0307509_10060139 3300031507 Bacteria 4017
373 Ga0307408_100521531 3300031548 Bacteria 1044
374 Ga0307408_102408189 3300031548 Bacteria 511
375 Ga0307508_10429490 3300031616 Bacteria 913
376 Ga0307516_10053741 3300031730 Bacteria 3938
377 Ga0307413_10079759 3300031824 Bacteria 2094
378 Ga0307406_10384448 3300031901 Bacteria 1108
379 Ga0307409_100210273 3300031995 Bacteria 1748
380 Ga0307409_101553692 3300031995 Bacteria 689
381 Ga0307416_100473845 3300032002 Bacteria 1310
382 Ga0307416_101301519 3300032002 Bacteria 833
383 Ga0307416_102563296 3300032002 Bacteria 608
384 Ga0307411_10304767 3300032005 Bacteria 1279
385 Ga0307411_11591878 3300032005 Bacteria 602
386 Ga0307510_10103331 3300033180 Bacteria 2627
387 Ga0307510_10247384 3300033180 Bacteria 1273
388 Ga0373950_0125368 3300034818 Bacteria 571
389 Ga0373952_0008873 3300035092 Bacteria 1914
390 Ga0373935_0631023 3300035692 Bacteria 785
391 Ga0373927_0074430 3300035695 Bacteria 2199
392 Ga0373947_0309305 3300035725 Bacteria 1055
393 Ga0373925_1719115 3300037068 Bacteria 512
394 Ga0395905_0149150 3300037471 Bacteria 2200
395 Ga0237819_01546 3300038705 Bacteria 5826
396 Ga0451787_419078 3300041441 Bacteria 678
397 Ga0451789_0134142 3300041443 Bacteria 565
398 Ga0451797_0474604 3300041453 Bacteria 568
399 Ga0451797_1048751 3300041453 Bacteria 663
400 Ga0451800_0981496 3300041459 Bacteria 879
401 Ga0451807_0365807 3300041486 Bacteria 600
402 Ga0451837_1681460 3300041494 Bacteria 510
403 Ga0451851_0469228 3300041507 Bacteria 1241
404 Ga0451855_0974468 3300041511 Bacteria 693
405 Ga0439458_0023161 3300042157 Bacteria 1447
406 Ga0495617_012972 3300046452 Bacteria 2841
407 Ga0495603_0041515 3300046455 Bacteria 2750
408 Ga0495603_0295046 3300046455 Bacteria 931
409 Ga0495629_0206681 3300046459 Bacteria 1357
410 Ga0495638_0027463 3300046460 Bacteria 3684
411 Ga0495641_0028034 3300046461 Bacteria 2729
412 Ga0495582_0199733 3300046473 Bacteria 1142
413 Ga0495605_0085923 3300046474 Bacteria 1464
414 Ga0495639_0031883 3300046475 Bacteria 2349
415 Ga0495639_0476159 3300046475 Bacteria 636
416 Ga0495662_0227315 3300046476 Bacteria 920
417 Ga0495584_0367442 3300046491 Bacteria 731
418 Ga0495585_0077070 3300046492 Bacteria 1810
419 Ga0495585_0155704 3300046492 Bacteria 1189
420 Ga0495596_0087438 3300046500 Bacteria 1210
421 Ga0495616_0468246 3300046513 Bacteria 508
422 Ga0495620_0158866 3300046515 Bacteria 879
423 Ga0495630_0204504 3300046517 Bacteria 1507
424 Ga0495631_0101515 3300046518 Bacteria 1238
425 Ga0495632_0064065 3300046519 Bacteria 1778
426 Ga0495632_0211362 3300046519 Bacteria 880
427 Ga0495632_0506746 3300046519 Bacteria 520
428 Ga0495632_0534075 3300046519 Bacteria 504
429 Ga0495637_0268245 3300046520 Bacteria 611
430 Ga0495643_0225663 3300046522 Bacteria 886
431 Ga0495644_0170635 3300046523 Bacteria 835
432 Ga0495663_0127835 3300046525 Bacteria 855
433 Ga0495598_0023879 3300046537 Bacteria 1651
434 Ga0495622_0047325 3300046557 Bacteria 1999
435 Ga0495622_0239676 3300046557 Bacteria 800
436 Ga0495656_0099729 3300046615 Bacteria 1341
437 Ga0495656_0168163 3300046615 Bacteria 1070
438 Ga0495656_0642097 3300046615 Bacteria 569
439 Ga0495668_0131742 3300046616 Bacteria 1368
440 Ga0495668_0571134 3300046616 Bacteria 624
441 Ga0495668_0725297 3300046616 Bacteria 550
442 Ga0495625_0121018 3300046660 Bacteria 1781
443 Ga0495625_0287906 3300046660 Bacteria 1055
444 Ga0495659_0051336 3300046664 Bacteria 1501
445 Ga0495661_0474188 3300046665 Bacteria 600
446 Ga0495624_0198541 3300046690 Bacteria 1219
447 Ga0495670_0038109 3300046691 Bacteria 2396
448 Ga0495670_0256379 3300046691 Bacteria 933
449 Ga0495671_0605845 3300046692 Bacteria 521
450 Ga0495649_0398113 3300046694 Bacteria 691
451 Ga0495589_0105090 3300046794 Bacteria 1365
452 Ga0495600_0599272 3300046809 Bacteria 670
453 Ga0495660_0082399 3300046810 Bacteria 1685
454 Ga0495581_0080736 3300047315 Bacteria 1883
455 Ga0495680_0731530 3300047322 Bacteria 651
456 Ga0495681_0126478 3300047470 Bacteria 1092
457 Ga0495681_0226941 3300047470 Bacteria 747
458 Ga0495686_0217080 3300047472 Bacteria 1090
459 Ga0495686_0488851 3300047472 Bacteria 649
460 Ga0495615_0011127 3300048090 Bacteria 1820
461 Ga0495626_0289126 3300048091 Bacteria 650
462 Ga0496100_0126286 3300048903 Bacteria 1796
463 Ga0496100_0463079 3300048903 Bacteria 973
464 Ga0496101_0105388 3300048904 Bacteria 2116
465 Ga0496101_0229340 3300048904 Bacteria 1443
466 Ga0496101_0526069 3300048904 Bacteria 935
467 Ga0496102_0373947 3300048905 Bacteria 1341
468 Ga0496102_0584693 3300048905 Bacteria 1039
469 Ga0496102_0913573 3300048905 Bacteria 799
470 Ga0496102_1108283 3300048905 Bacteria 711
471 Ga0496103_0417088 3300048906 Bacteria 862
472 Ga0496105_0208212 3300048908 Bacteria 1595
473 Ga0496106_0820096 3300048909 Bacteria 737
474 Ga0496107_0776066 3300048910 Bacteria 702
475 Ga0496108_0174548 3300048911 Bacteria 1860
476 Ga0496108_0703381 3300048911 Bacteria 876
477 Ga0496109_0323175 3300048912 Bacteria 1456
478 Ga0496109_0383432 3300048912 Bacteria 1328
479 Ga0496112_0662165 3300048915 Bacteria 973
480 Ga0496113_0151652 3300048916 Bacteria 1829
481 Ga0496113_0238770 3300048916 Bacteria 1450
482 Ga0496114_0848226 3300048917 Bacteria 794
483 Ga0496115_0079668 3300048918 Bacteria 2666
484 Ga0496115_1470802 3300048918 Bacteria 500
485 Ga0496121_0072729 3300048924 Bacteria 2759
486 Ga0496121_0167260 3300048924 Bacteria 1601
487 Ga0496121_0799149 3300048924 Bacteria 555
488 Ga0496125_0188449 3300048928 Bacteria 1365
489 Ga0496126_0007662 3300048929 Bacteria 11784
490 Ga0496126_0073768 3300048929 Bacteria 3032
491 Ga0496126_0715763 3300048929 Bacteria 776
492 Ga0496126_0768260 3300048929 Bacteria 742
493 Ga0501034_0390533 3300049571 Bacteria 1315
494 Ga0501036_0127951 3300049572 Bacteria 2145
495 Ga0501067_0126735 3300049583 Bacteria 1420
496 Ga0501069_0245255 3300049585 Bacteria 1044
497 Ga0501209_268810 3300049656 Bacteria 534
498 nmdc:mga03683_254548_c1 3300050489 Bacteria 816
499 nmdc:mga03683_316578_c1 3300050489 Bacteria 734
500 nmdc:mga03n38_22066_c1 3300050490 Bacteria 2571
501 nmdc:mga03n38_3153_c1 3300050490 Bacteria 5250
502 nmdc:mga00v17_162776_c1 3300050491 Bacteria 1437
503 nmdc:mga00v17_191836_c1 3300050491 Bacteria 1320
504 nmdc:mga00v17_340562_c1 3300050491 Bacteria 975
505 nmdc:mga0yw44_137494_c1 3300050492 Bacteria 1586
506 nmdc:mga0yw44_427141_c1 3300050492 Bacteria 897
507 nmdc:mga0k408_169047_c1 3300050493 Bacteria 1303
508 nmdc:mga0k408_66725_c1 3300050493 Bacteria 2096
509 nmdc:mga06z11_214425_c1 3300050494 Bacteria 1123
510 nmdc:mga06z11_214866_c1 3300050494 Bacteria 1122
511 nmdc:mga06z11_570398_c1 3300050494 Bacteria 688
512 nmdc:mga06z11_6323_c1 3300050494 Bacteria 4809
513 nmdc:mga06z11_747983_c1 3300050494 Bacteria 596
514 nmdc:mga04h51_20772_c1 3300050495 Bacteria 1966
515 nmdc:mga04h51_337199_c1 3300050495 Bacteria 621
516 nmdc:mga04h51_403421_c1 3300050495 Bacteria 573
517 nmdc:mga07m45_127513_c1 3300050496 Bacteria 1472
518 nmdc:mga07m45_72953_c1 3300050496 Bacteria 1954
519 nmdc:mga05p37_2164094_c1 3300050507 Bacteria 518
520 nmdc:mga08y16_45215_c1 3300050511 Bacteria 4613
521 nmdc:mga0n895_577740_c1 3300050512 Bacteria 1128
522 nmdc:mga0rr50_1274130_c1 3300050513 Bacteria 624
523 nmdc:mga0sz30_212031_c1 3300050516 Bacteria 861
524 nmdc:mga0sz30_298409_c1 3300050516 Bacteria 718
525 nmdc:mga0sz30_310310_c1 3300050516 Bacteria 704
526 nmdc:mga0sz30_389429_c1 3300050516 Bacteria 624
527 Ga0500610_0385291 3300053079 Bacteria 577
528 Ga0495655_0007274 3300053083 Bacteria 2051
529 Ga0500641_0004813 3300053096 Bacteria 4780
530 Ga0500595_026932 3300053119 Bacteria 1975
531 Ga0500658_0211567 3300053134 Bacteria 888
532 Ga0500588_0107072 3300053146 Bacteria 971
533 Ga0500588_0139945 3300053146 Bacteria 869
534 Ga0500638_127923 3300053162 Bacteria 1155
535 Ga0500637_0056107 3300053178 Bacteria 2251
536 Ga0500645_020227 3300053730 Bacteria 2064
537 2509077649 2508501114 Bacteria 7082538
538 2513637159 2513237094 Bacteria 8789602
539 2514012230 2513237161 Bacteria 8871253
540 2793065532 2791355196 Bacteria 7323613
541 2824676826 2824671348 Bacteria 8369588
542 2824693304 2824687955 Bacteria 8360029
543 2824776091 2824773399 Bacteria 8360218
544 2841945466 2841941048 Bacteria 8688029
545 2841955919 2841949485 Bacteria 8680857
546 2841973990 2841966195 Bacteria 8673214
547 2842041212 2842038055 Bacteria 8002051
548 2842045843 2842045827 Bacteria 8006841
549 2844320462 2844315083 Bacteria 8138177
550 2874608844 2874604998 Bacteria 7834745
551 2874625808 2874620515 Bacteria 8290088
552 2874632855 2874628541 Bacteria 8630250
553 2876812259 2876808645 Bacteria 8824342
554 2879110734 2879110137 Bacteria 8907982
555 2881367861 2881364244 Bacteria 7710352
556 2904673831 2904666416 Bacteria 8226587
557 2906607000 2906602504 Bacteria 8295279
558 3002144285 3002141150 Bacteria 5254435
559 3005511571 3005506211 Bacteria 6943378
560 8006985221 8006984368 Bacteria 9651211
561 8007000908 8006994254 Bacteria 8309700
562 8056675926 8056673599 Bacteria 7871253
563 8056971866 8056967851 Bacteria 9038162
564 Ga0237816_01327
565 JGI25153J46596_10006220
566 rootH2_10076462
567 rootH2_10187583
568 rootL2_10171359
569 rootH1_10105058
570 Ga0070658_10845054
571 Ga0070676_10078907
572 Ga0070676_10641880
573 Ga0070683_101555482
574 Ga0070683_101934904
575 Ga0070690_100208315
576 Ga0070677_10805954
577 Ga0068869_100135574
578 Ga0068869_100365373
579 Ga0068869_100793074
580 Ga0068869_100820140
581 Ga0070666_10074510
582 Ga0070666_10154933
583 Ga0070682_100895182
584 Ga0068868_100034940
585 Ga0068868_100093127
586 Ga0068868_100365533
587 Ga0068868_101679971
588 Ga0070660_100138287
589 Ga0070660_100588011
590 Ga0070689_100305336
591 Ga0070689_101409050
592 Ga0070691_10651969
593 Ga0070687_101364553
594 Ga0070661_100764415
595 Ga0070692_10125354
596 Ga0070668_100049295
597 Ga0070668_100056779
598 Ga0070668_100082410
599 Ga0070668_100155433
600 Ga0070668_100616616
601 Ga0070668_100804743
602 Ga0070669_100147540
603 Ga0070669_100506647
604 Ga0070669_100518456
605 Ga0070675_100257112
606 Ga0070675_100614248
607 Ga0070675_101128401
608 Ga0070671_100034627
609 Ga0070671_101307225
610 Ga0070674_100192577
611 Ga0070674_100206353
612 Ga0070674_101527105
613 Ga0070673_100379717
614 Ga0070673_100383988
615 Ga0070688_100684568
616 Ga0070659_100078344
617 Ga0070659_101006070
618 Ga0070667_100258824
619 Ga0070667_100534468
620 Ga0070667_101608993
621 Ga0070703_10561708
622 Ga0070701_10131032
623 Ga0070705_100122496
624 Ga0070700_100119485
625 Ga0070700_100217925
626 Ga0070700_100669206
627 Ga0070700_101883445
628 Ga0070663_100076823
629 Ga0070663_100212139
630 Ga0070663_100254269
631 Ga0070663_100286406
632 Ga0070678_100238450
633 Ga0070678_100380119
634 Ga0070678_101307756
635 Ga0070662_100042396
636 Ga0070662_100501281
637 Ga0070662_101412548
638 Ga0068867_100267023
639 Ga0068867_102213982
640 Ga0070685_10069598
641 Ga0070685_10249150
642 Ga0068853_100203032
643 Ga0068853_101663815
644 Ga0070672_100320405
645 Ga0070672_100332538
646 Ga0070686_100529796
647 Ga0070695_101696491
648 Ga0070665_100073837
649 Ga0070665_100076469
650 Ga0070665_100120099
651 Ga0070665_100143695
652 Ga0070665_100633162
653 Ga0070665_101395471
654 Ga0070665_101571978
655 Ga0070664_101068301
656 Ga0070664_101412757
657 Ga0070664_101439229
658 Ga0070664_102229272
659 Ga0070664_102236769
660 Ga0068857_100291575
661 Ga0068854_101223571
662 Ga0068856_100156528
663 Ga0070702_100075478
664 Ga0070702_100144161
665 Ga0070702_100640276
666 Ga0068852_100739147
667 Ga0068852_101833964
668 Ga0068859_100219781
669 Ga0068859_100225203
670 Ga0068864_100027355
671 Ga0068864_101339523
672 Ga0068866_10035700
673 Ga0068866_10077597
674 Ga0068866_10638006
675 Ga0068861_100041512
676 Ga0068861_100151485
677 Ga0068861_100203964
678 Ga0068870_10237436
679 Ga0068870_10357663
680 Ga0068870_10999003
681 Ga0068863_100408132
682 Ga0068863_100718395
683 Ga0068863_102138161
684 Ga0068858_100183444
685 Ga0068858_100210599
686 Ga0068858_100441970
687 Ga0068858_101026119
688 Ga0068860_100183715
689 Ga0068860_100639253
690 Ga0068860_101362533
691 Ga0068860_101728341
692 Ga0068862_100142234
693 Ga0068862_100211515
694 Ga0068862_100398195
695 Ga0068862_100441919
696 Ga0068862_100587565
697 Ga0081455_10023976
698 Ga0081455_10070815
699 Ga0081455_10307696
700 Ga0081540_1083973
701 Ga0081539_10190980
702 Ga0075365_10099469
703 Ga0075365_10134926
704 Ga0075365_10170418
705 Ga0075365_10217924
706 Ga0075368_10024847
707 Ga0075368_10039888
708 Ga0075368_10433105
709 Ga0075363_100007132
710 Ga0075363_100089902
711 Ga0075363_100311469
712 Ga0075363_100495817
713 Ga0075364_10115484
714 Ga0075364_10138153
715 Ga0075364_10489725
716 Ga0070716_100102467
717 Ga0075362_10024624
718 Ga0075362_10055672
719 Ga0075362_10326592
720 Ga0075362_10359708
721 Ga0075367_10005374
722 Ga0075367_10177797
723 Ga0075367_10192547
724 Ga0075367_10896182
725 Ga0075367_11127054
726 Ga0075369_10012450
727 Ga0075369_10050027
728 Ga0075369_10258939
729 Ga0075369_10503599
730 Ga0075427_10022933
731 Ga0075366_10300094
732 Ga0075366_10497510
733 Ga0075366_10523516
734 Ga0097621_100108321
735 Ga0097621_100495686
736 Ga0097621_102087286
737 Ga0075370_10415754
738 Ga0075370_10477342
739 Ga0068871_102240663
740 Ga0075428_100259965
741 Ga0075434_100497086
742 Ga0068865_100090150
743 Ga0068865_100268450
744 Ga0075436_100282056
745 Ga0097620_100219786
746 Ga0097620_100225217
747 Ga0075435_100309426
748 Ga0099795_10076762
749 Ga0105244_10346738
750 Ga0105250_10167738
751 Ga0105240_12268195
752 Ga0111539_10113772
753 Ga0111539_11538031
754 Ga0111539_12121272
755 Ga0105245_10049800
756 Ga0105245_11002491
757 Ga0105245_11373087
758 Ga0105247_10679794
759 Ga0105247_10878549
760 Ga0114129_12101334
761 Ga0105243_10080075
762 Ga0105243_10140056
763 Ga0105243_10620038
764 Ga0105243_12364122
765 Ga0105241_10049621
766 Ga0105241_10611859
767 Ga0105242_11700211
768 Ga0105248_10167436
769 Ga0105248_10170226
770 Ga0105248_11004595
771 Ga0105237_10032495
772 Ga0105237_10425081
773 Ga0105237_11551322
774 Ga0105238_10228344
775 Ga0105238_10769003
776 Ga0105238_11016755
777 Ga0105249_10030241
778 Ga0105249_11027720
779 Ga0105239_10160880
780 Ga0105239_11567926
781 Ga0105246_10142789
782 Ga0105246_10675830
783 Ga0157373_11065647
784 Ga0157374_10950369
785 Ga0157374_11024785
786 Ga0157374_11851258
787 Ga0157374_12575430
788 Ga0157378_10004545
789 Ga0157378_10233208
790 Ga0157378_10660365
791 Ga0157378_10721066
792 Ga0163162_10457410
793 Ga0163162_10919147
794 Ga0163162_12284346
795 Ga0157372_12111609
796 Ga0157375_10104149
797 Ga0157375_10395082
798 Ga0157375_12161314
799 Ga0163163_10814730
800 Ga0163163_10982817
801 Ga0163163_11576640
802 Ga0157380_10336956
803 Ga0157380_10529161
804 Ga0157380_10535725
805 Ga0157380_10793920
806 Ga0182008_10201138
807 Ga0157377_10101217
808 Ga0157377_10276667
809 Ga0157377_10617037
810 Ga0157379_10232311
811 Ga0157379_10342299
812 Ga0157379_11554028
813 Ga0157379_11699838
814 Ga0157379_11977266
815 Ga0157376_10227587
816 Ga0157376_10614819
817 Ga0157376_10827080
818 Ga0157376_11112565
819 Ga0163161_10598598
820 Ga0163161_11837115
821 Ga0209758_1018975
822 Ga0207697_10371515
823 Ga0207697_10498195
824 Ga0207682_10273446
825 Ga0207642_10306472
826 Ga0207642_10369977
827 Ga0207642_10742063
828 Ga0207710_10063624
829 Ga0207688_10036312
830 Ga0207688_10057082
831 Ga0207688_10082060
832 Ga0207680_10216007
833 Ga0207647_10122680
834 Ga0207645_10056137
835 Ga0207643_10097287
836 Ga0207643_10136266
837 Ga0207671_10309486
838 Ga0207662_10245505
839 Ga0207662_10834838
840 Ga0207657_10211861
841 Ga0207681_10246337
842 Ga0207681_10583736
843 Ga0207681_11732732
844 Ga0207694_10367349
845 Ga0207694_11176763
846 Ga0207650_11317396
847 Ga0207659_10529534
848 Ga0207659_10832224
849 Ga0207687_10281807
850 Ga0207687_11493034
851 Ga0207644_10345706
852 Ga0207690_10086573
853 Ga0207706_10111564
854 Ga0207706_10946995
855 Ga0207686_10273501
856 Ga0207709_10038064
857 Ga0207709_10100101
858 Ga0207709_11383277
859 Ga0207669_10032370
860 Ga0207669_10085653
861 Ga0207669_10183596
862 Ga0207704_10069344
863 Ga0207704_10108031
864 Ga0207665_10106639
865 Ga0207691_10004633
866 Ga0207691_10243243
867 Ga0207691_10296390
868 Ga0207691_10303591
869 Ga0207711_10373285
870 Ga0207689_10139480
871 Ga0207689_10268514
872 Ga0207689_10373701
873 Ga0207689_10656442
874 Ga0207679_11064185
875 Ga0207679_11407891
876 Ga0207651_10111057
877 Ga0207651_10187103
878 Ga0207712_10475675
879 Ga0207712_11250661
880 Ga0207712_11259323
881 Ga0207668_10022219
882 Ga0207668_10031660
883 Ga0207668_10154582
884 Ga0207668_10302972
885 Ga0207668_10316039
886 Ga0207668_10512654
887 Ga0207668_10605921
888 Ga0207658_10189345
889 Ga0207658_10506090
890 Ga0207703_10054486
891 Ga0207703_10118276
892 Ga0207703_10746935
893 Ga0207703_10983575
894 Ga0207639_10319507
895 Ga0207678_10098865
896 Ga0207678_10119454
897 Ga0207678_10424333
898 Ga0207678_10669934
899 Ga0207708_10071006
900 Ga0207708_10195064
901 Ga0207708_10839509
902 Ga0207702_10556557
903 Ga0207641_10437892
904 Ga0207641_10846840
905 Ga0207676_10050451
906 Ga0207676_10308799
907 Ga0207674_10284884
908 Ga0207675_100049860
909 Ga0207675_100155591
910 Ga0207675_100438953
911 Ga0207683_10037509
912 Ga0207683_10153567
913 Ga0207683_10445566
914 Ga0207698_10448578
915 Ga0207698_10587089
916 Ga0209813_10017500
917 Ga0209813_10454568
918 Ga0207428_10070646
919 Ga0268266_10002325
920 Ga0268266_10015568
921 Ga0268266_10029506
922 Ga0268266_10042901
923 Ga0268265_10218664
924 Ga0268265_10310122
925 Ga0268265_10459939
926 Ga0268265_11249628
927 Ga0268265_11488113
928 Ga0268264_10057035
929 Ga0307517_10000071
930 Ga0307517_10300092
931 Ga0307517_10588506
932 Ga0307515_10038013
933 Ga0307515_10244046
934 Ga0307515_10339970
935 Ga0307509_10060139
936 Ga0307408_100521531
937 Ga0307408_102408189
938 Ga0307508_10429490
939 Ga0307516_10053741
940 Ga0307413_10079759
941 Ga0307406_10384448
942 Ga0307409_100210273
943 Ga0307409_101553692
944 Ga0307416_100473845
945 Ga0307416_101301519
946 Ga0307416_102563296
947 Ga0307411_10304767
948 Ga0307411_11591878
949 Ga0307510_10103331
950 Ga0307510_10247384
951 Ga0373950_0125368
952 Ga0373952_0008873
953 Ga0373935_0631023
954 Ga0373927_0074430
955 Ga0373947_0309305
956 Ga0373925_1719115
957 Ga0395905_0149150
958 Ga0237819_01546
959 Ga0451787_419078
960 Ga0451789_0134142
961 Ga0451797_0474604
962 Ga0451797_1048751
963 Ga0451800_0981496
964 Ga0451807_0365807
965 Ga0451837_1681460
966 Ga0451851_0469228
967 Ga0451855_0974468
968 Ga0439458_0023161
969 Ga0495617_012972
970 Ga0495603_0041515
971 Ga0495603_0295046
972 Ga0495629_0206681
973 Ga0495638_0027463
974 Ga0495641_0028034
975 Ga0495582_0199733
976 Ga0495605_0085923
977 Ga0495639_0031883
978 Ga0495639_0476159
979 Ga0495662_0227315
980 Ga0495584_0367442
981 Ga0495585_0077070
982 Ga0495585_0155704
983 Ga0495596_0087438
984 Ga0495616_0468246
985 Ga0495620_0158866
986 Ga0495630_0204504
987 Ga0495631_0101515
988 Ga0495632_0064065
989 Ga0495632_0211362
990 Ga0495632_0506746
991 Ga0495632_0534075
992 Ga0495637_0268245
993 Ga0495643_0225663
994 Ga0495644_0170635
995 Ga0495663_0127835
996 Ga0495598_0023879
997 Ga0495622_0047325
998 Ga0495622_0239676
999 Ga0495656_0099729
1000 Ga0495656_0168163
1001 Ga0495656_0642097
1002 Ga0495668_0131742
1003 Ga0495668_0571134
1004 Ga0495668_0725297
1005 Ga0495625_0121018
1006 Ga0495625_0287906
1007 Ga0495659_0051336
1008 Ga0495661_0474188
1009 Ga0495624_0198541
1010 Ga0495670_0038109
1011 Ga0495670_0256379
1012 Ga0495671_0605845
1013 Ga0495649_0398113
1014 Ga0495589_0105090
1015 Ga0495600_0599272
1016 Ga0495660_0082399
1017 Ga0495581_0080736
1018 Ga0495680_0731530
1019 Ga0495681_0126478
1020 Ga0495681_0226941
1021 Ga0495686_0217080
1022 Ga0495686_0488851
1023 Ga0495615_0011127
1024 Ga0495626_0289126
1025 Ga0496100_0126286
1026 Ga0496100_0463079
1027 Ga0496101_0105388
1028 Ga0496101_0229340
1029 Ga0496101_0526069
1030 Ga0496102_0373947
1031 Ga0496102_0584693
1032 Ga0496102_0913573
1033 Ga0496102_1108283
1034 Ga0496103_0417088
1035 Ga0496105_0208212
1036 Ga0496106_0820096
1037 Ga0496107_0776066
1038 Ga0496108_0174548
1039 Ga0496108_0703381
1040 Ga0496109_0323175
1041 Ga0496109_0383432
1042 Ga0496112_0662165
1043 Ga0496113_0151652
1044 Ga0496113_0238770
1045 Ga0496114_0848226
1046 Ga0496115_0079668
1047 Ga0496115_1470802
1048 Ga0496121_0072729
1049 Ga0496121_0167260
1050 Ga0496121_0799149
1051 Ga0496125_0188449
1052 Ga0496126_0007662
1053 Ga0496126_0073768
1054 Ga0496126_0715763
1055 Ga0496126_0768260
1056 Ga0501034_0390533
1057 Ga0501036_0127951
1058 Ga0501067_0126735
1059 Ga0501069_0245255
1060 Ga0501209_268810
1061 nmdc:mga03683_254548_c1
1062 nmdc:mga03683_316578_c1
1063 nmdc:mga03n38_22066_c1
1064 nmdc:mga03n38_3153_c1
1065 nmdc:mga00v17_162776_c1
1066 nmdc:mga00v17_191836_c1
1067 nmdc:mga00v17_340562_c1
1068 nmdc:mga0yw44_137494_c1
1069 nmdc:mga0yw44_427141_c1
1070 nmdc:mga0k408_169047_c1
1071 nmdc:mga0k408_66725_c1
1072 nmdc:mga06z11_214425_c1
1073 nmdc:mga06z11_214866_c1
1074 nmdc:mga06z11_570398_c1
1075 nmdc:mga06z11_6323_c1
1076 nmdc:mga06z11_747983_c1
1077 nmdc:mga04h51_20772_c1
1078 nmdc:mga04h51_337199_c1
1079 nmdc:mga04h51_403421_c1
1080 nmdc:mga07m45_127513_c1
1081 nmdc:mga07m45_72953_c1
1082 nmdc:mga05p37_2164094_c1
1083 nmdc:mga08y16_45215_c1
1084 nmdc:mga0n895_577740_c1
1085 nmdc:mga0rr50_1274130_c1
1086 nmdc:mga0sz30_212031_c1
1087 nmdc:mga0sz30_298409_c1
1088 nmdc:mga0sz30_310310_c1
1089 nmdc:mga0sz30_389429_c1
1090 Ga0500610_0385291
1091 Ga0495655_0007274
1092 Ga0500641_0004813
1093 Ga0500595_026932
1094 Ga0500658_0211567
1095 Ga0500588_0107072
1096 Ga0500588_0139945
1097 Ga0500638_127923
1098 Ga0500637_0056107
1099 Ga0500645_020227
1100 2509077649
1101 2513637159
1102 2514012230
1103 2793065532
1104 2824676826
1105 2824693304
1106 2824776091
1107 2841945466
1108 2841955919
1109 2841973990
1110 2842041212
1111 2842045843
1112 2844320462
1113 2874608844
1114 2874625808
1115 2874632855
1116 2876812259
1117 2879110734
1118 2881367861
1119 2904673831
1120 2906607000
1121 3002144285
1122 3005511571
1123 8006985221
1124 8007000908
1125 8056675926
1126 8056971866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mk0-assembly1.cif.gz_A catalytic domain of intron endonuclease i-tevi, e75a mutant 0.9284 18 106
1ln0-assembly1.cif.gz_A structure of the catalytic domain of homing endonuclease i-tevi 0.8715 19 110
1ln0-assembly1.cif.gz_A structure of the catalytic domain of homing endonuclease i-tevi 0.8358 19 110
1mk0-assembly1.cif.gz_A catalytic domain of intron endonuclease i-tevi, e75a mutant 0.7838 18 106
2der-assembly1.cif.gz_A cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state 0.6823 81 109
ID Description Score Start End Superfamily
1ln0A00 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.8715 19 110 3.40.1440.10
1ln0A00 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.8358 19 110 3.40.1440.10
2derA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6823 81 109 3.40.50.620
1yd6B00 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.6194 16 108 3.40.1440.10
af_Q64008_51_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6185 82 110 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W9R3C1-F1-model_v4 deleted 0.9858 18 110
AF-A0A1I3LH54-F1-model_v4 GIY-YIG nuclease family protein 0.9783 1 110
AF-A0A6F8UPT6-F1-model_v4 GIY-YIG nuclease family protein 0.9705 19 110
AF-A0A1Q3WST3-F1-model_v4 GIY-YIG domain-containing protein 0.9652 19 104 GO:0004519
AF-A0A359IKX6-F1-model_v4 GIY-YIG domain-containing protein 0.9643 18 106 GO:0003677
GO:0004519

Map