F464076

General Info

Members Datasets Scaffolds Average Seq Length
563 236 1126 258

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_246641|Ga0400483_246641_1180_2046
Length 288
Sequence MFRQILIGTSIPVRRLCNFLFSKDEHDKEQGMEILVCVKRVPDTAENEIEISGDGCAIERDDLVYSVNEWDNYAVEEAIQIRDQVGGSVTVVTVGDDESEDILRREMAMGADNGLLLSDDLFESIDGKQTATLLKAAVERGKYDLILTGAQADGGAGQVGGMLAAMLDYPYASLVNQIEVCDEKLKVGREIEGGNQEMNEITLPCVLSIQTGINEPRYVGIRGIRKVASVEIPEMGASDLSVDLGDAKVKRRDYFVPEPGEGAQMLEGDDEEIITKLIELLKAKGGLK

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
130 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
135 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
138 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
139 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
163 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
164 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
165 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
166 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
167 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
168 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
169 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
170 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.38
Metatranscriptomes 4.44
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.73
Rhizosphere 86.32
Stem 0
Stem Tuber 0
Unclassified 14.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_246641 3300039062 Bacteria 2589
2 Ga0065712_10076045 3300005290 Bacteria 3744
3 Ga0065712_10194970 3300005290 Bacteria 1132
4 Ga0065715_10141220 3300005293 Bacteria 1851
5 Ga0070683_100442912 3300005329 Bacteria 1239
6 Ga0068869_100131623 3300005334 Bacteria 1923
7 Ga0070666_10172015 3300005335 Bacteria 1517
8 Ga0070680_100018611 3300005336 Bacteria 5491
9 Ga0070682_100127480 3300005337 Bacteria 1718
10 Ga0068868_100158843 3300005338 Bacteria 1866
11 Ga0070660_100009465 3300005339 Bacteria 6854
12 Ga0070661_100024432 3300005344 Bacteria 4334
13 Ga0070668_100020715 3300005347 Bacteria 4965
14 Ga0070669_100133581 3300005353 Bacteria 1907
15 Ga0070659_100002437 3300005366 Bacteria 13220
16 Ga0070659_100146302 3300005366 Bacteria 1925
17 Ga0070667_100055346 3300005367 Bacteria 3350
18 Ga0070709_10001843 3300005434 Bacteria 11495
19 Ga0070709_10005242 3300005434 Bacteria 7015
20 Ga0070709_10016252 3300005434 Bacteria 4245
21 Ga0070709_10266515 3300005434 Unclassified 1240
22 Ga0070714_100000085 3300005435 Bacteria 79813
23 Ga0070714_100001656 3300005435 Bacteria 16209
24 Ga0070714_100005286 3300005435 Bacteria 9840
25 Ga0070714_100037869 3300005435 Bacteria 4055
26 Ga0070714_100121572 3300005435 Bacteria 2323
27 Ga0070714_100132346 3300005435 Bacteria 2230
28 Ga0070714_100191168 3300005435 Unclassified 1868
29 Ga0070713_100000312 3300005436 Bacteria 31862
30 Ga0070713_100002033 3300005436 Bacteria 13077
31 Ga0070713_100008780 3300005436 Bacteria 7191
32 Ga0070713_100035743 3300005436 Bacteria 4003
33 Ga0070713_100146520 3300005436 Bacteria 2096
34 Ga0070713_100165279 3300005436 Unclassified 1978
35 Ga0070713_100450087 3300005436 Unclassified 1209
36 Ga0070710_10007181 3300005437 Bacteria 5384
37 Ga0070710_10008689 3300005437 Bacteria 4951
38 Ga0070710_10024230 3300005437 Bacteria 3199
39 Ga0070710_10229716 3300005437 Unclassified 1184
40 Ga0070710_10242092 3300005437 Unclassified 1156
41 Ga0070711_100000972 3300005439 Bacteria 15180
42 Ga0070711_100002585 3300005439 Bacteria 10365
43 Ga0070711_100009892 3300005439 Bacteria 5880
44 Ga0070711_100104411 3300005439 Unclassified 2067
45 Ga0070711_100188294 3300005439 Bacteria 1584
46 Ga0070662_100027585 3300005457 Bacteria 3944
47 Ga0070681_10038662 3300005458 Bacteria 4784
48 Ga0070706_100021249 3300005467 Bacteria 5979
49 Ga0070699_100262306 3300005518 Unclassified 1545
50 Ga0070679_100380467 3300005530 Bacteria 1358
51 Ga0070684_100013128 3300005535 Bacteria 6667
52 Ga0070684_100065018 3300005535 Bacteria 3201
53 Ga0070684_100226775 3300005535 Unclassified 1705
54 Ga0068853_100007283 3300005539 Bacteria 8857
55 Ga0068853_100123635 3300005539 Bacteria 2310
56 Ga0070686_100160301 3300005544 Unclassified 1584
57 Ga0070693_100195418 3300005547 Bacteria 1311
58 Ga0070665_100024387 3300005548 Bacteria 6091
59 Ga0070664_100009467 3300005564 Bacteria 7898
60 Ga0070664_100187316 3300005564 Bacteria 1842
61 Ga0068857_100355460 3300005577 Bacteria 1357
62 Ga0068856_100013402 3300005614 Bacteria 7938
63 Ga0068856_100302418 3300005614 Bacteria 1617
64 Ga0068856_100343677 3300005614 Bacteria 1510
65 Ga0068852_100072706 3300005616 Bacteria 3023
66 Ga0068852_100132423 3300005616 Bacteria 2298
67 Ga0068859_100187300 3300005617 Bacteria 2153
68 Ga0068864_100061358 3300005618 Bacteria 3256
69 Ga0068861_100190010 3300005719 Bacteria 1716
70 Ga0068851_10070687 3300005834 Unclassified 1805
71 Ga0068863_100091682 3300005841 Bacteria 2882
72 Ga0068863_100292034 3300005841 Bacteria 1580
73 Ga0068858_100028573 3300005842 Bacteria 5179
74 Ga0068858_100153873 3300005842 Bacteria 2163
75 Ga0068858_100265857 3300005842 Unclassified 1631
76 Ga0068860_100591385 3300005843 Bacteria 1114
77 Ga0070717_10002420 3300006028 Bacteria 13169
78 Ga0070717_10006500 3300006028 Bacteria 8604
79 Ga0070717_10015864 3300006028 Bacteria 5827
80 Ga0070717_10033255 3300006028 Bacteria 4160
81 Ga0070717_10062596 3300006028 Bacteria 3086
82 Ga0070717_10088615 3300006028 Unclassified 2609
83 Ga0070717_10442630 3300006028 Unclassified 1170
84 Ga0070715_10055742 3300006163 Unclassified 1717
85 Ga0070716_100008315 3300006173 Bacteria 5147
86 Ga0070716_100036324 3300006173 Bacteria 2716
87 Ga0070716_100038552 3300006173 Bacteria 2647
88 Ga0070716_100246089 3300006173 Bacteria 1215
89 Ga0070712_100000099 3300006175 Bacteria 44062
90 Ga0070712_100001493 3300006175 Bacteria 14283
91 Ga0097621_100443799 3300006237 Unclassified 1168
92 Ga0068871_100006571 3300006358 Bacteria 8240
93 Ga0068865_100059103 3300006881 Bacteria 2681
94 Ga0075436_100018687 3300006914 Bacteria 4745
95 Ga0097620_100187301 3300006931 Bacteria 2153
96 Ga0075435_100204805 3300007076 Bacteria 1672
97 Ga0075435_100255154 3300007076 Bacteria 1493
98 Ga0105240_10001054 3300009093 Bacteria 48820
99 Ga0105240_10006364 3300009093 Bacteria 17386
100 Ga0105240_10006863 3300009093 Bacteria 16642
101 Ga0105240_10011155 3300009093 Bacteria 12553
102 Ga0105240_10106874 3300009093 Bacteria 3393
103 Ga0105245_10020200 3300009098 Bacteria 5838
104 Ga0105241_10342633 3300009174 Bacteria 1295
105 Ga0105242_10033572 3300009176 Bacteria 4109
106 Ga0105242_10553940 3300009176 Unclassified 1103
107 Ga0105248_10164475 3300009177 Unclassified 2502
108 Ga0105248_10203533 3300009177 Bacteria 2230
109 Ga0105248_10349812 3300009177 Bacteria 1664
110 Ga0105237_10013817 3300009545 Bacteria 8452
111 Ga0105237_10522453 3300009545 Bacteria 1194
112 Ga0105237_10528957 3300009545 Bacteria 1186
113 Ga0105238_10018943 3300009551 Bacteria 7009
114 Ga0105238_10034725 3300009551 Bacteria 5130
115 Ga0105249_10001150 3300009553 Bacteria 23417
116 Ga0105239_10026450 3300010375 Bacteria 6385
117 Ga0105239_10104393 3300010375 Bacteria 3138
118 Ga0157373_10087985 3300013100 Unclassified 2189
119 Ga0157370_10303522 3300013104 Bacteria 1473
120 Ga0157369_10010604 3300013105 Bacteria 10489
121 Ga0157369_10073613 3300013105 Bacteria 3665
122 Ga0157369_10361354 3300013105 Bacteria 1507
123 Ga0157369_10409552 3300013105 Bacteria 1406
124 Ga0157369_10456713 3300013105 Unclassified 1323
125 Ga0157374_10004076 3300013296 Bacteria 12272
126 Ga0157374_10009674 3300013296 Bacteria 8280
127 Ga0157374_10125305 3300013296 Bacteria 2483
128 Ga0157374_10348415 3300013296 Bacteria 1471
129 Ga0157378_10018425 3300013297 Bacteria 6131
130 Ga0157378_10057156 3300013297 Bacteria 3476
131 Ga0163162_10093450 3300013306 Bacteria 3092
132 Ga0163162_10313232 3300013306 Bacteria 1702
133 Ga0163162_10444657 3300013306 Bacteria 1428
134 Ga0157372_10003658 3300013307 Bacteria 16524
135 Ga0157372_10036589 3300013307 Bacteria 5410
136 Ga0157372_10123645 3300013307 Bacteria 2974
137 Ga0157372_10739892 3300013307 Bacteria 1144
138 Ga0157375_10214959 3300013308 Unclassified 2080
139 Ga0163163_10159091 3300014325 Bacteria 2304
140 Ga0163163_10206641 3300014325 Unclassified 2012
141 Ga0163163_10265220 3300014325 Unclassified 1768
142 Ga0163163_10314211 3300014325 Bacteria 1620
143 Ga0163163_10570171 3300014325 Bacteria 1195
144 Ga0182008_10005826 3300014497 Bacteria 6964
145 Ga0157376_10004155 3300014969 Bacteria 10036
146 Ga0157376_10135941 3300014969 Bacteria 2200
147 Ga0182007_10004856 3300015262 Bacteria 6009
148 Ga0182005_1006958 3300015265 Bacteria 3420
149 Ga0207656_10014797 3300025321 Unclassified 3013
150 Ga0207692_10017523 3300025898 Bacteria 3197
151 Ga0207692_10022038 3300025898 Bacteria 2926
152 Ga0207692_10046500 3300025898 Bacteria 2176
153 Ga0207692_10066948 3300025898 Unclassified 1879
154 Ga0207692_10107784 3300025898 Unclassified 1540
155 Ga0207699_10002762 3300025906 Bacteria 8297
156 Ga0207699_10004462 3300025906 Bacteria 6689
157 Ga0207699_10038810 3300025906 Unclassified 2732
158 Ga0207699_10215400 3300025906 Unclassified 1308
159 Ga0207699_10272490 3300025906 Unclassified 1173
160 Ga0207699_10301239 3300025906 Unclassified 1119
161 Ga0207645_10011858 3300025907 Bacteria 5932
162 Ga0207654_10031402 3300025911 Bacteria 2925
163 Ga0207707_10090046 3300025912 Bacteria 2681
164 Ga0207695_10049755 3300025913 Bacteria 4414
165 Ga0207695_10082455 3300025913 Bacteria 3251
166 Ga0207695_10165256 3300025913 Bacteria 2142
167 Ga0207695_10178087 3300025913 Bacteria 2048
168 Ga0207695_10226695 3300025913 Unclassified 1774
169 Ga0207695_10343450 3300025913 Bacteria 1380
170 Ga0207671_10082840 3300025914 Bacteria 2408
171 Ga0207671_10483348 3300025914 Bacteria 987
172 Ga0207693_10000193 3300025915 Bacteria 55368
173 Ga0207693_10000512 3300025915 Bacteria 34997
174 Ga0207693_10002967 3300025915 Bacteria 14691
175 Ga0207663_10000322 3300025916 Bacteria 20921
176 Ga0207663_10014137 3300025916 Bacteria 4362
177 Ga0207663_10056480 3300025916 Bacteria 2469
178 Ga0207663_10079930 3300025916 Bacteria 2136
179 Ga0207663_10129762 3300025916 Unclassified 1740
180 Ga0207660_10180422 3300025917 Bacteria 1639
181 Ga0207657_10000222 3300025919 Bacteria 59330
182 Ga0207657_10005218 3300025919 Bacteria 13608
183 Ga0207649_10003374 3300025920 Bacteria 8740
184 Ga0207652_10129693 3300025921 Bacteria 2248
185 Ga0207681_10066068 3300025923 Bacteria 2503
186 Ga0207694_10074175 3300025924 Bacteria 2663
187 Ga0207694_10644809 3300025924 Unclassified 892
188 Ga0207650_10247609 3300025925 Bacteria 1442
189 Ga0207687_10029059 3300025927 Bacteria 3717
190 Ga0207687_10159305 3300025927 Bacteria 1730
191 Ga0207700_10000600 3300025928 Bacteria 21061
192 Ga0207700_10002829 3300025928 Bacteria 9982
193 Ga0207700_10007121 3300025928 Bacteria 6813
194 Ga0207700_10018211 3300025928 Bacteria 4713
195 Ga0207700_10065571 3300025928 Bacteria 2771
196 Ga0207700_10101109 3300025928 Unclassified 2299
197 Ga0207700_10457924 3300025928 Unclassified 1125
198 Ga0207664_10000164 3300025929 Bacteria 53052
199 Ga0207664_10004036 3300025929 Bacteria 9898
200 Ga0207664_10009572 3300025929 Bacteria 6806
201 Ga0207664_10026832 3300025929 Unclassified 4359
202 Ga0207664_10176540 3300025929 Bacteria 1832
203 Ga0207664_10218629 3300025929 Bacteria 1651
204 Ga0207664_10254807 3300025929 Bacteria 1533
205 Ga0207644_10456390 3300025931 Bacteria 1050
206 Ga0207690_10013311 3300025932 Bacteria 4941
207 Ga0207706_10005516 3300025933 Bacteria 11795
208 Ga0207665_10002873 3300025939 Bacteria 11562
209 Ga0207665_10023844 3300025939 Unclassified 4030
210 Ga0207665_10111054 3300025939 Bacteria 1926
211 Ga0207665_10195167 3300025939 Unclassified 1473
212 Ga0207665_10231686 3300025939 Bacteria 1358
213 Ga0207711_10099081 3300025941 Bacteria 2576
214 Ga0207711_10215649 3300025941 Bacteria 1754
215 Ga0207711_10345364 3300025941 Unclassified 1378
216 Ga0207689_10071859 3300025942 Bacteria 2842
217 Ga0207689_10306250 3300025942 Bacteria 1317
218 Ga0207661_10077170 3300025944 Unclassified 2739
219 Ga0207651_10185449 3300025960 Unclassified 1655
220 Ga0207712_10015367 3300025961 Bacteria 4938
221 Ga0207640_10008048 3300025981 Bacteria 5829
222 Ga0207658_10183857 3300025986 Bacteria 1732
223 Ga0207677_10157673 3300026023 Unclassified 1760
224 Ga0207677_10304123 3300026023 Bacteria 1318
225 Ga0207677_11010785 3300026023 Bacteria 754
226 Ga0207703_10479214 3300026035 Bacteria 1166
227 Ga0207639_10016841 3300026041 Bacteria 5178
228 Ga0207678_10000692 3300026067 Bacteria 30777
229 Ga0207702_10033419 3300026078 Bacteria 4296
230 Ga0207702_10093302 3300026078 Bacteria 2640
231 Ga0207702_10310884 3300026078 Unclassified 1498
232 Ga0207641_10022331 3300026088 Bacteria 5209
233 Ga0207648_10010596 3300026089 Bacteria 8719
234 Ga0207676_10219294 3300026095 Bacteria 1693
235 Ga0207674_10033983 3300026116 Bacteria 5333
236 Ga0207674_10334280 3300026116 Unclassified 1465
237 Ga0207683_10030683 3300026121 Bacteria 4660
238 Ga0265357_1008698 3300028023 Bacteria 1000
239 Ga0268264_10704266 3300028381 Bacteria 1003
240 Ga0265338_10000906 3300028800 Bacteria 49899
241 Ga0265338_10022739 3300028800 Bacteria 6475
242 Ga0265338_10027682 3300028800 Bacteria 5680
243 Ga0265324_10007500 3300029957 Bacteria 4412
244 Ga0265760_10013123 3300031090 Bacteria 2371
245 Ga0265330_10024768 3300031235 Unclassified 2721
246 Ga0265332_10045652 3300031238 Bacteria 1888
247 Ga0265325_10002529 3300031241 Bacteria 12308
248 Ga0265325_10018963 3300031241 Bacteria 3810
249 Ga0265340_10005314 3300031247 Bacteria 7150
250 Ga0265340_10008692 3300031247 Bacteria 5477
251 Ga0265340_10072092 3300031247 Bacteria 1636
252 Ga0265340_10136508 3300031247 Bacteria 1123
253 Ga0265339_10010061 3300031249 Bacteria 5895
254 Ga0265339_10048228 3300031249 Bacteria 2336
255 Ga0265331_10002238 3300031250 Bacteria 13242
256 Ga0265327_10018619 3300031251 Bacteria 4296
257 Ga0265316_10007520 3300031344 Bacteria 10253
258 Ga0265316_10014443 3300031344 Bacteria 6949
259 Ga0265316_10067177 3300031344 Bacteria 2773
260 Ga0265316_10193403 3300031344 Unclassified 1510
261 Ga0265313_10009595 3300031595 Bacteria 6261
262 Ga0316575_10000987 3300031665 Bacteria 8784
263 Ga0316575_10029499 3300031665 Bacteria 2142
264 Ga0316575_10074125 3300031665 Bacteria 1369
265 Ga0316579_10001311 3300031691 Bacteria 8988
266 Ga0316579_10013238 3300031691 Bacteria 3547
267 Ga0316579_10039084 3300031691 Bacteria 2197
268 Ga0316579_10076126 3300031691 Unclassified 1595
269 Ga0316579_10155689 3300031691 Bacteria 1103
270 Ga0316579_10243658 3300031691 Unclassified 869
271 Ga0265314_10175486 3300031711 Bacteria 1289
272 Ga0265342_10019440 3300031712 Unclassified 4377
273 Ga0265342_10024481 3300031712 Bacteria 3810
274 Ga0316576_10000099 3300031727 Bacteria 31461
275 Ga0316576_10016395 3300031727 Bacteria 5002
276 Ga0316576_10052568 3300031727 Bacteria 2966
277 Ga0316576_10056770 3300031727 Bacteria 2860
278 Ga0316576_10075855 3300031727 Bacteria 2487
279 Ga0316576_10077529 3300031727 Bacteria 2461
280 Ga0316576_10103811 3300031727 Bacteria 2127
281 Ga0316576_10126100 3300031727 Bacteria 1924
282 Ga0316576_10242270 3300031727 Unclassified 1354
283 Ga0316576_10258660 3300031727 Bacteria 1306
284 Ga0316576_10389493 3300031727 Bacteria 1034
285 Ga0316578_10014118 3300031728 Bacteria 4256
286 Ga0316578_10015007 3300031728 Bacteria 4155
287 Ga0316578_10018843 3300031728 Bacteria 3790
288 Ga0316578_10021303 3300031728 Bacteria 3596
289 Ga0316578_10192722 3300031728 Bacteria 1228
290 Ga0316578_10226025 3300031728 Bacteria 1125
291 Ga0316577_10005007 3300031733 Bacteria 6907
292 Ga0316577_10088239 3300031733 Bacteria 1736
293 Ga0316577_10095268 3300031733 Bacteria 1667
294 Ga0316577_10320840 3300031733 Bacteria 878
295 Ga0316583_10001184 3300032133 Bacteria 8551
296 Ga0316583_10009841 3300032133 Bacteria 3445
297 Ga0316583_10059583 3300032133 Bacteria 1339
298 Ga0316585_10047962 3300032137 Unclassified 1368
299 Ga0316585_10116054 3300032137 Bacteria 880
300 Ga0316580_10018178 3300032139 Bacteria 2163
301 Ga0316580_10067500 3300032139 Bacteria 1096
302 Ga0316580_10096752 3300032139 Unclassified 903
303 Ga0316593_10002372 3300032168 Bacteria 4438
304 Ga0316593_10005721 3300032168 Bacteria 3306
305 Ga0316593_10019541 3300032168 Bacteria 2094
306 Ga0316593_10020843 3300032168 Bacteria 2043
307 Ga0316593_10030271 3300032168 Bacteria 1756
308 Ga0316593_10044409 3300032168 Bacteria 1488
309 Ga0316593_10046593 3300032168 Bacteria 1456
310 Ga0316593_10055562 3300032168 Bacteria 1346
311 Ga0316593_10108778 3300032168 Bacteria 989
312 Ga0316593_10109554 3300032168 Bacteria 985
313 Ga0316592_1005038 3300033524 Bacteria 2490
314 Ga0316592_1011280 3300033524 Bacteria 1815
315 Ga0316592_1017674 3300033524 Bacteria 1498
316 Ga0316596_1004392 3300033541 Bacteria 3159
317 Ga0316596_1006370 3300033541 Bacteria 2743
318 Ga0316596_1007810 3300033541 Bacteria 2534
319 Ga0316596_1009288 3300033541 Bacteria 2358
320 Ga0316596_1011980 3300033541 Bacteria 2127
321 Ga0316596_1012108 3300033541 Bacteria 2117
322 Ga0316596_1017433 3300033541 Bacteria 1806
323 Ga0316596_1018394 3300033541 Bacteria 1765
324 Ga0316596_1019180 3300033541 Bacteria 1734
325 Ga0316596_1035470 3300033541 Bacteria 1304
326 Ga0316596_1052045 3300033541 Bacteria 1084
327 Ga0373934_0007357 3300035086 Bacteria 4087
328 Ga0373944_0030477 3300035089 Unclassified 1618
329 Ga0373923_0031563 3300035111 Bacteria 2136
330 Ga0373923_0052651 3300035111 Bacteria 1711
331 Ga0373936_0053724 3300035113 Bacteria 1634
332 Ga0373945_0005019 3300035116 Bacteria 4216
333 Ga0373945_0026827 3300035116 Bacteria 2008
334 Ga0373953_0149820 3300035117 Bacteria 1000
335 Ga0373954_0000243 3300035118 Bacteria 19976
336 Ga0373956_0002612 3300035119 Bacteria 7302
337 Ga0373957_0002726 3300035120 Bacteria 5078
338 Ga0373957_0113651 3300035120 Bacteria 1092
339 Ga0373943_0000051 3300035170 Bacteria 40234
340 Ga0373943_0025776 3300035170 Bacteria 2750
341 Ga0373943_0068638 3300035170 Bacteria 1790
342 Ga0373943_0273934 3300035170 Unclassified 953
343 Ga0373955_0001271 3300035172 Bacteria 10721
344 Ga0373955_0179134 3300035172 Bacteria 1257
345 Ga0373955_0191439 3300035172 Unclassified 1216
346 Ga0316574_0000237 3300035398 Bacteria 19967
347 Ga0316574_0006944 3300035398 Bacteria 6164
348 Ga0316574_0007821 3300035398 Bacteria 5892
349 Ga0316574_0018125 3300035398 Bacteria 4131
350 Ga0373935_0001746 3300035692 Bacteria 12191
351 Ga0373935_0035965 3300035692 Bacteria 3093
352 Ga0373927_0000150 3300035695 Bacteria 54680
353 Ga0373927_0028022 3300035695 Bacteria 3676
354 Ga0373927_0082833 3300035695 Bacteria 2080
355 Ga0373927_0142467 3300035695 Bacteria 1568
356 Ga0373933_0003749 3300035724 Bacteria 8399
357 Ga0373933_0021341 3300035724 Bacteria 3678
358 Ga0373933_0094212 3300035724 Bacteria 1851
359 Ga0373933_0169495 3300035724 Bacteria 1389
360 Ga0373947_0002179 3300035725 Bacteria 11894
361 Ga0373947_0026583 3300035725 Bacteria 3385
362 Ga0373947_0043954 3300035725 Bacteria 2669
363 Ga0373947_0048196 3300035725 Bacteria 2556
364 Ga0373947_0104577 3300035725 Unclassified 1783
365 Ga0373947_0118871 3300035725 Unclassified 1677
366 Ga0373937_0000250 3300036401 Bacteria 52583
367 Ga0373937_0012671 3300036401 Bacteria 7421
368 Ga0373937_0047043 3300036401 Bacteria 3946
369 Ga0373937_0097555 3300036401 Bacteria 2726
370 Ga0373937_0324060 3300036401 Bacteria 1458
371 Ga0373937_0386168 3300036401 Bacteria 1328
372 Ga0316582_0011915 3300036647 Bacteria 4831
373 Ga0316582_0026450 3300036647 Bacteria 3493
374 Ga0316582_0046713 3300036647 Bacteria 2730
375 Ga0316582_0047701 3300036647 Bacteria 2705
376 Ga0316582_0103025 3300036647 Bacteria 1892
377 Ga0316582_0181777 3300036647 Bacteria 1431
378 Ga0316582_0452779 3300036647 Bacteria 885
379 Ga0316584_0003841 3300036712 Bacteria 9850
380 Ga0316584_0023000 3300036712 Bacteria 4550
381 Ga0316584_0027714 3300036712 Bacteria 4171
382 Ga0316584_0046895 3300036712 Bacteria 3227
383 Ga0316584_0072137 3300036712 Bacteria 2588
384 Ga0316584_0280099 3300036712 Bacteria 1212
385 Ga0316584_0328349 3300036712 Bacteria 1102
386 Ga0373925_0000673 3300037068 Bacteria 32089
387 Ga0373925_0001538 3300037068 Bacteria 19646
388 Ga0373925_0003572 3300037068 Bacteria 11984
389 Ga0373925_0015801 3300037068 Bacteria 5463
390 Ga0316581_0001301 3300037588 Bacteria 5547
391 Ga0316581_0020218 3300037588 Unclassified 1948
392 Ga0400484_03212 3300038725 Bacteria 6549
393 Ga0400484_21344 3300038725 Bacteria 14441
394 Ga0400484_37081 3300038725 Bacteria 13200
395 Ga0400490_03588 3300038726 Bacteria 18058
396 Ga0400490_11476 3300038726 Bacteria 1689
397 Ga0400490_37139 3300038726 Bacteria 39208
398 Ga0400491_02539 3300038727 Bacteria 2293
399 Ga0400491_10943 3300038727 Bacteria 4456
400 Ga0400491_13864 3300038727 Bacteria 6266
401 Ga0400491_27992 3300038727 Bacteria 7107
402 Ga0400485_02045 3300038735 Bacteria 7246
403 Ga0400485_06211 3300038735 Bacteria 30943
404 Ga0400485_06555 3300038735 Bacteria 71659
405 Ga0400485_10030 3300038735 Bacteria 7022
406 Ga0400485_10317 3300038735 Bacteria 11302
407 Ga0400485_19199 3300038735 Bacteria 7242
408 Ga0400488_12882 3300038741 Bacteria 3399
409 Ga0400488_16465 3300038741 Bacteria 2440
410 Ga0400488_31787 3300038741 Bacteria 3796
411 Ga0400488_59272 3300038741 Bacteria 1511
412 Ga0400486_00988 3300038742 Bacteria 1270
413 Ga0400486_01157 3300038742 Bacteria 1706
414 Ga0400486_03375 3300038742 Bacteria 25334
415 Ga0400486_05265 3300038742 Bacteria 61476
416 Ga0400486_14001 3300038742 Bacteria 7746
417 Ga0400486_17803 3300038742 Bacteria 4224
418 Ga0400486_22641 3300038742 Bacteria 32050
419 Ga0400486_22976 3300038742 Bacteria 93315
420 Ga0400483_000155 3300039062 Bacteria 1481
421 Ga0400483_014335 3300039062 Bacteria 2254
422 Ga0400483_059416 3300039062 Bacteria 3814
423 Ga0400483_094094 3300039062 Bacteria 1516
424 Ga0400483_117247 3300039062 Bacteria 4828
425 Ga0400483_141629 3300039062 Bacteria 9697
426 Ga0400483_145723 3300039062 Bacteria 34433
427 Ga0400483_194202 3300039062 Bacteria 1664
428 Ga0400483_199054 3300039062 Bacteria 2598
429 Ga0400483_202262 3300039062 Bacteria 3975
430 Ga0400483_207414 3300039062 Bacteria 1821
431 Ga0400483_207829 3300039062 Bacteria 67117
432 Ga0400483_208358 3300039062 Bacteria 17273
433 Ga0400483_242607 3300039062 Bacteria 2917
434 Ga0400489_03049 3300039093 Bacteria 14757
435 Ga0400489_20945 3300039093 Bacteria 11502
436 Ga0400489_28764 3300039093 Bacteria 8188
437 Ga0400489_43156 3300039093 Bacteria 2110
438 Ga0400489_66913 3300039093 Bacteria 21932
439 Ga0400489_82117 3300039093 Bacteria 39560
440 Ga0400489_83876 3300039093 Bacteria 27736
441 Ga0400489_90203 3300039093 Bacteria 38544
442 Ga0400489_93718 3300039093 Bacteria 1004
443 Ga0400487_06228 3300039110 Bacteria 38638
444 Ga0400487_09552 3300039110 Bacteria 12045
445 Ga0400487_21303 3300039110 Bacteria 74949
446 Ga0436361_0260284 3300039447 Bacteria 2054
447 Ga0451577_0003510 3300042876 Bacteria 17383
448 Ga0451577_0008141 3300042876 Bacteria 10223
449 Ga0451577_0013407 3300042876 Bacteria 7672
450 Ga0451577_0086146 3300042876 Bacteria 2803
451 Ga0453684_0002307 3300044712 Bacteria 46891
452 Ga0453684_0003023 3300044712 Bacteria 39111
453 Ga0453684_0029438 3300044712 Bacteria 7795
454 Ga0453684_0098524 3300044712 Bacteria 3583
455 Ga0453684_0190332 3300044712 Bacteria 2401
456 Ga0466971_0104245 3300044719 Unclassified 1305
457 Ga0451576_0354138 3300045051 Unclassified 1537
458 Ga0451576_0401207 3300045051 Bacteria 1438
459 Ga0466967_0008384 3300045976 Bacteria 7564
460 Ga0466967_0427940 3300045976 Bacteria 1291
461 Ga0495592_0001447 3300046454 Bacteria 16489
462 Ga0495603_0229697 3300046455 Bacteria 1070
463 Ga0495629_0001842 3300046459 Bacteria 16603
464 Ga0495651_0004852 3300046462 Bacteria 10290
465 Ga0495651_0017791 3300046462 Bacteria 5504
466 Ga0495651_0301102 3300046462 Unclassified 1075
467 Ga0495651_0356113 3300046462 Unclassified 966
468 Ga0495653_0026707 3300046463 Bacteria 4627
469 Ga0495580_0000342 3300046472 Bacteria 37970
470 Ga0495580_0003649 3300046472 Bacteria 13043
471 Ga0495580_0008151 3300046472 Bacteria 8345
472 Ga0495580_0010582 3300046472 Bacteria 7179
473 Ga0495580_0015546 3300046472 Bacteria 5736
474 Ga0495580_0049239 3300046472 Bacteria 2981
475 Ga0495580_0115399 3300046472 Bacteria 1865
476 Ga0495580_0152997 3300046472 Bacteria 1598
477 Ga0495580_0179122 3300046472 Archaea 1464
478 Ga0495662_0001272 3300046476 Bacteria 12457
479 Ga0495664_0000970 3300046477 Bacteria 14754
480 Ga0495608_0011181 3300046511 Bacteria 6248
481 Ga0495608_0098377 3300046511 Bacteria 1888
482 Ga0495628_0002093 3300046516 Bacteria 18089
483 Ga0495628_0400440 3300046516 Unclassified 1003
484 Ga0495630_0003747 3300046517 Bacteria 10606
485 Ga0495630_0153418 3300046517 Unclassified 1753
486 Ga0495630_0167972 3300046517 Bacteria 1671
487 Ga0495652_0002721 3300046529 Bacteria 17944
488 Ga0495665_0079518 3300046531 Bacteria 1725
489 Ga0495640_0001833 3300046533 Bacteria 16872
490 Ga0495587_0003040 3300046536 Bacteria 11201
491 Ga0495587_0007328 3300046536 Bacteria 7150
492 Ga0495645_0000857 3300046543 Bacteria 20726
493 Ga0495645_0359138 3300046543 Unclassified 937
494 Ga0495667_0010264 3300046559 Bacteria 6335
495 Ga0495667_0143838 3300046559 Bacteria 1536
496 Ga0495634_0020530 3300046642 Bacteria 4683
497 Ga0495657_0271453 3300046675 Unclassified 1017
498 Ga0495657_0388248 3300046675 Bacteria 823
499 Ga0495599_0001371 3300046678 Bacteria 13926
500 Ga0495623_0015228 3300046679 Unclassified 4969
501 Ga0495646_0008501 3300046680 Bacteria 6519
502 Ga0495658_0016832 3300046683 Bacteria 3767
503 Ga0495658_0043943 3300046683 Bacteria 2501
504 Ga0495669_0077828 3300046684 Bacteria 1519
505 Ga0495613_0005880 3300046689 Bacteria 9182
506 Ga0495613_0277766 3300046689 Bacteria 1164
507 Ga0495600_0008497 3300046809 Bacteria 6309
508 Ga0495604_0003554 3300047317 Bacteria 12441
509 Ga0495604_0004403 3300047317 Bacteria 11145
510 Ga0495604_0023377 3300047317 Bacteria 4931
511 Ga0495604_0369427 3300047317 Bacteria 950
512 Ga0495674_0004685 3300047319 Bacteria 13150
513 Ga0495674_0008068 3300047319 Bacteria 10053
514 Ga0495674_0042397 3300047319 Bacteria 4059
515 Ga0495674_0107742 3300047319 Bacteria 2365
516 Ga0495674_0139940 3300047319 Bacteria 2035
517 Ga0495680_0005022 3300047322 Bacteria 12515
518 Ga0495675_0002823 3300047444 Bacteria 10410
519 Ga0495684_0005551 3300047471 Bacteria 9828
520 Ga0495684_0006430 3300047471 Bacteria 9119
521 Ga0495684_0010329 3300047471 Bacteria 7220
522 Ga0495684_0351115 3300047471 Bacteria 1047
523 Ga0495602_0002275 3300048088 Bacteria 19432
524 Ga0495602_0006891 3300048088 Bacteria 11941
525 Ga0495602_0058422 3300048088 Bacteria 3376
526 Ga0496100_0130716 3300048903 Unclassified 1768
527 Ga0496101_0367608 3300048904 Unclassified 1131
528 Ga0496102_0035638 3300048905 Bacteria 4479
529 Ga0496102_0097221 3300048905 Bacteria 2731
530 Ga0496102_0289480 3300048905 Unclassified 1544
531 Ga0496106_0026282 3300048909 Bacteria 4334
532 Ga0496107_0005841 3300048910 Bacteria 8424
533 Ga0496108_0015313 3300048911 Bacteria 6256
534 Ga0496109_0019265 3300048912 Bacteria 6013
535 Ga0496109_0095885 3300048912 Bacteria 2747
536 Ga0496109_0584803 3300048912 Unclassified 1052
537 Ga0496110_0018315 3300048913 Bacteria 5872
538 Ga0496112_0055435 3300048915 Bacteria 3898
539 Ga0496112_0116224 3300048915 Bacteria 2646
540 Ga0496112_0144301 3300048915 Bacteria 2349
541 Ga0496112_0266855 3300048915 Unclassified 1660
542 Ga0496112_0374780 3300048915 Unclassified 1364
543 Ga0496113_0007314 3300048916 Bacteria 7089
544 Ga0496113_0083949 3300048916 Bacteria 2445
545 Ga0496114_0034742 3300048917 Bacteria 4161
546 Ga0496115_0082810 3300048918 Unclassified 2615
547 Ga0501038_0145946 3300049574 Unclassified 1932
548 Ga0501041_0017132 3300049577 Unclassified 4311
549 Ga0501048_0048560 3300049582 Bacteria 3027
550 Ga0501067_0091482 3300049583 Unclassified 1689
551 Ga0501075_0057450 3300049591 Bacteria 2930
552 Ga0501076_0014633 3300049592 Bacteria 5914
553 Ga0501077_0086185 3300049593 Unclassified 1991
554 Ga0501045_0008989 3300049824 Bacteria 6977
555 nmdc:mga0rr50_74867_c1 3300050513 Bacteria 2593
556 nmdc:mga08x19_11842_c1 3300050514 Bacteria 5246
557 nmdc:mga08x19_3809_c1 3300050514 Bacteria 8975
558 Ga0495601_0208744 3300053077 Unclassified 1276
559 Ga0495595_0114012 3300053084 Bacteria 1313
560 Ga0501084_0015343 3300054114 Bacteria 6352
561 Ga0501082_0101553 3300060353 Bacteria 2488
562 Ga0530510_0099620 3300061734 Unclassified 2125
563 2740990454 2740891818 Bacteria 6711283
564 Ga0400483_246641
565 Ga0065712_10076045
566 Ga0065712_10194970
567 Ga0065715_10141220
568 Ga0070683_100442912
569 Ga0068869_100131623
570 Ga0070666_10172015
571 Ga0070680_100018611
572 Ga0070682_100127480
573 Ga0068868_100158843
574 Ga0070660_100009465
575 Ga0070661_100024432
576 Ga0070668_100020715
577 Ga0070669_100133581
578 Ga0070659_100002437
579 Ga0070659_100146302
580 Ga0070667_100055346
581 Ga0070709_10001843
582 Ga0070709_10005242
583 Ga0070709_10016252
584 Ga0070709_10266515
585 Ga0070714_100000085
586 Ga0070714_100001656
587 Ga0070714_100005286
588 Ga0070714_100037869
589 Ga0070714_100121572
590 Ga0070714_100132346
591 Ga0070714_100191168
592 Ga0070713_100000312
593 Ga0070713_100002033
594 Ga0070713_100008780
595 Ga0070713_100035743
596 Ga0070713_100146520
597 Ga0070713_100165279
598 Ga0070713_100450087
599 Ga0070710_10007181
600 Ga0070710_10008689
601 Ga0070710_10024230
602 Ga0070710_10229716
603 Ga0070710_10242092
604 Ga0070711_100000972
605 Ga0070711_100002585
606 Ga0070711_100009892
607 Ga0070711_100104411
608 Ga0070711_100188294
609 Ga0070662_100027585
610 Ga0070681_10038662
611 Ga0070706_100021249
612 Ga0070699_100262306
613 Ga0070679_100380467
614 Ga0070684_100013128
615 Ga0070684_100065018
616 Ga0070684_100226775
617 Ga0068853_100007283
618 Ga0068853_100123635
619 Ga0070686_100160301
620 Ga0070693_100195418
621 Ga0070665_100024387
622 Ga0070664_100009467
623 Ga0070664_100187316
624 Ga0068857_100355460
625 Ga0068856_100013402
626 Ga0068856_100302418
627 Ga0068856_100343677
628 Ga0068852_100072706
629 Ga0068852_100132423
630 Ga0068859_100187300
631 Ga0068864_100061358
632 Ga0068861_100190010
633 Ga0068851_10070687
634 Ga0068863_100091682
635 Ga0068863_100292034
636 Ga0068858_100028573
637 Ga0068858_100153873
638 Ga0068858_100265857
639 Ga0068860_100591385
640 Ga0070717_10002420
641 Ga0070717_10006500
642 Ga0070717_10015864
643 Ga0070717_10033255
644 Ga0070717_10062596
645 Ga0070717_10088615
646 Ga0070717_10442630
647 Ga0070715_10055742
648 Ga0070716_100008315
649 Ga0070716_100036324
650 Ga0070716_100038552
651 Ga0070716_100246089
652 Ga0070712_100000099
653 Ga0070712_100001493
654 Ga0097621_100443799
655 Ga0068871_100006571
656 Ga0068865_100059103
657 Ga0075436_100018687
658 Ga0097620_100187301
659 Ga0075435_100204805
660 Ga0075435_100255154
661 Ga0105240_10001054
662 Ga0105240_10006364
663 Ga0105240_10006863
664 Ga0105240_10011155
665 Ga0105240_10106874
666 Ga0105245_10020200
667 Ga0105241_10342633
668 Ga0105242_10033572
669 Ga0105242_10553940
670 Ga0105248_10164475
671 Ga0105248_10203533
672 Ga0105248_10349812
673 Ga0105237_10013817
674 Ga0105237_10522453
675 Ga0105237_10528957
676 Ga0105238_10018943
677 Ga0105238_10034725
678 Ga0105249_10001150
679 Ga0105239_10026450
680 Ga0105239_10104393
681 Ga0157373_10087985
682 Ga0157370_10303522
683 Ga0157369_10010604
684 Ga0157369_10073613
685 Ga0157369_10361354
686 Ga0157369_10409552
687 Ga0157369_10456713
688 Ga0157374_10004076
689 Ga0157374_10009674
690 Ga0157374_10125305
691 Ga0157374_10348415
692 Ga0157378_10018425
693 Ga0157378_10057156
694 Ga0163162_10093450
695 Ga0163162_10313232
696 Ga0163162_10444657
697 Ga0157372_10003658
698 Ga0157372_10036589
699 Ga0157372_10123645
700 Ga0157372_10739892
701 Ga0157375_10214959
702 Ga0163163_10159091
703 Ga0163163_10206641
704 Ga0163163_10265220
705 Ga0163163_10314211
706 Ga0163163_10570171
707 Ga0182008_10005826
708 Ga0157376_10004155
709 Ga0157376_10135941
710 Ga0182007_10004856
711 Ga0182005_1006958
712 Ga0207656_10014797
713 Ga0207692_10017523
714 Ga0207692_10022038
715 Ga0207692_10046500
716 Ga0207692_10066948
717 Ga0207692_10107784
718 Ga0207699_10002762
719 Ga0207699_10004462
720 Ga0207699_10038810
721 Ga0207699_10215400
722 Ga0207699_10272490
723 Ga0207699_10301239
724 Ga0207645_10011858
725 Ga0207654_10031402
726 Ga0207707_10090046
727 Ga0207695_10049755
728 Ga0207695_10082455
729 Ga0207695_10165256
730 Ga0207695_10178087
731 Ga0207695_10226695
732 Ga0207695_10343450
733 Ga0207671_10082840
734 Ga0207671_10483348
735 Ga0207693_10000193
736 Ga0207693_10000512
737 Ga0207693_10002967
738 Ga0207663_10000322
739 Ga0207663_10014137
740 Ga0207663_10056480
741 Ga0207663_10079930
742 Ga0207663_10129762
743 Ga0207660_10180422
744 Ga0207657_10000222
745 Ga0207657_10005218
746 Ga0207649_10003374
747 Ga0207652_10129693
748 Ga0207681_10066068
749 Ga0207694_10074175
750 Ga0207694_10644809
751 Ga0207650_10247609
752 Ga0207687_10029059
753 Ga0207687_10159305
754 Ga0207700_10000600
755 Ga0207700_10002829
756 Ga0207700_10007121
757 Ga0207700_10018211
758 Ga0207700_10065571
759 Ga0207700_10101109
760 Ga0207700_10457924
761 Ga0207664_10000164
762 Ga0207664_10004036
763 Ga0207664_10009572
764 Ga0207664_10026832
765 Ga0207664_10176540
766 Ga0207664_10218629
767 Ga0207664_10254807
768 Ga0207644_10456390
769 Ga0207690_10013311
770 Ga0207706_10005516
771 Ga0207665_10002873
772 Ga0207665_10023844
773 Ga0207665_10111054
774 Ga0207665_10195167
775 Ga0207665_10231686
776 Ga0207711_10099081
777 Ga0207711_10215649
778 Ga0207711_10345364
779 Ga0207689_10071859
780 Ga0207689_10306250
781 Ga0207661_10077170
782 Ga0207651_10185449
783 Ga0207712_10015367
784 Ga0207640_10008048
785 Ga0207658_10183857
786 Ga0207677_10157673
787 Ga0207677_10304123
788 Ga0207677_11010785
789 Ga0207703_10479214
790 Ga0207639_10016841
791 Ga0207678_10000692
792 Ga0207702_10033419
793 Ga0207702_10093302
794 Ga0207702_10310884
795 Ga0207641_10022331
796 Ga0207648_10010596
797 Ga0207676_10219294
798 Ga0207674_10033983
799 Ga0207674_10334280
800 Ga0207683_10030683
801 Ga0265357_1008698
802 Ga0268264_10704266
803 Ga0265338_10000906
804 Ga0265338_10022739
805 Ga0265338_10027682
806 Ga0265324_10007500
807 Ga0265760_10013123
808 Ga0265330_10024768
809 Ga0265332_10045652
810 Ga0265325_10002529
811 Ga0265325_10018963
812 Ga0265340_10005314
813 Ga0265340_10008692
814 Ga0265340_10072092
815 Ga0265340_10136508
816 Ga0265339_10010061
817 Ga0265339_10048228
818 Ga0265331_10002238
819 Ga0265327_10018619
820 Ga0265316_10007520
821 Ga0265316_10014443
822 Ga0265316_10067177
823 Ga0265316_10193403
824 Ga0265313_10009595
825 Ga0316575_10000987
826 Ga0316575_10029499
827 Ga0316575_10074125
828 Ga0316579_10001311
829 Ga0316579_10013238
830 Ga0316579_10039084
831 Ga0316579_10076126
832 Ga0316579_10155689
833 Ga0316579_10243658
834 Ga0265314_10175486
835 Ga0265342_10019440
836 Ga0265342_10024481
837 Ga0316576_10000099
838 Ga0316576_10016395
839 Ga0316576_10052568
840 Ga0316576_10056770
841 Ga0316576_10075855
842 Ga0316576_10077529
843 Ga0316576_10103811
844 Ga0316576_10126100
845 Ga0316576_10242270
846 Ga0316576_10258660
847 Ga0316576_10389493
848 Ga0316578_10014118
849 Ga0316578_10015007
850 Ga0316578_10018843
851 Ga0316578_10021303
852 Ga0316578_10192722
853 Ga0316578_10226025
854 Ga0316577_10005007
855 Ga0316577_10088239
856 Ga0316577_10095268
857 Ga0316577_10320840
858 Ga0316583_10001184
859 Ga0316583_10009841
860 Ga0316583_10059583
861 Ga0316585_10047962
862 Ga0316585_10116054
863 Ga0316580_10018178
864 Ga0316580_10067500
865 Ga0316580_10096752
866 Ga0316593_10002372
867 Ga0316593_10005721
868 Ga0316593_10019541
869 Ga0316593_10020843
870 Ga0316593_10030271
871 Ga0316593_10044409
872 Ga0316593_10046593
873 Ga0316593_10055562
874 Ga0316593_10108778
875 Ga0316593_10109554
876 Ga0316592_1005038
877 Ga0316592_1011280
878 Ga0316592_1017674
879 Ga0316596_1004392
880 Ga0316596_1006370
881 Ga0316596_1007810
882 Ga0316596_1009288
883 Ga0316596_1011980
884 Ga0316596_1012108
885 Ga0316596_1017433
886 Ga0316596_1018394
887 Ga0316596_1019180
888 Ga0316596_1035470
889 Ga0316596_1052045
890 Ga0373934_0007357
891 Ga0373944_0030477
892 Ga0373923_0031563
893 Ga0373923_0052651
894 Ga0373936_0053724
895 Ga0373945_0005019
896 Ga0373945_0026827
897 Ga0373953_0149820
898 Ga0373954_0000243
899 Ga0373956_0002612
900 Ga0373957_0002726
901 Ga0373957_0113651
902 Ga0373943_0000051
903 Ga0373943_0025776
904 Ga0373943_0068638
905 Ga0373943_0273934
906 Ga0373955_0001271
907 Ga0373955_0179134
908 Ga0373955_0191439
909 Ga0316574_0000237
910 Ga0316574_0006944
911 Ga0316574_0007821
912 Ga0316574_0018125
913 Ga0373935_0001746
914 Ga0373935_0035965
915 Ga0373927_0000150
916 Ga0373927_0028022
917 Ga0373927_0082833
918 Ga0373927_0142467
919 Ga0373933_0003749
920 Ga0373933_0021341
921 Ga0373933_0094212
922 Ga0373933_0169495
923 Ga0373947_0002179
924 Ga0373947_0026583
925 Ga0373947_0043954
926 Ga0373947_0048196
927 Ga0373947_0104577
928 Ga0373947_0118871
929 Ga0373937_0000250
930 Ga0373937_0012671
931 Ga0373937_0047043
932 Ga0373937_0097555
933 Ga0373937_0324060
934 Ga0373937_0386168
935 Ga0316582_0011915
936 Ga0316582_0026450
937 Ga0316582_0046713
938 Ga0316582_0047701
939 Ga0316582_0103025
940 Ga0316582_0181777
941 Ga0316582_0452779
942 Ga0316584_0003841
943 Ga0316584_0023000
944 Ga0316584_0027714
945 Ga0316584_0046895
946 Ga0316584_0072137
947 Ga0316584_0280099
948 Ga0316584_0328349
949 Ga0373925_0000673
950 Ga0373925_0001538
951 Ga0373925_0003572
952 Ga0373925_0015801
953 Ga0316581_0001301
954 Ga0316581_0020218
955 Ga0400484_03212
956 Ga0400484_21344
957 Ga0400484_37081
958 Ga0400490_03588
959 Ga0400490_11476
960 Ga0400490_37139
961 Ga0400491_02539
962 Ga0400491_10943
963 Ga0400491_13864
964 Ga0400491_27992
965 Ga0400485_02045
966 Ga0400485_06211
967 Ga0400485_06555
968 Ga0400485_10030
969 Ga0400485_10317
970 Ga0400485_19199
971 Ga0400488_12882
972 Ga0400488_16465
973 Ga0400488_31787
974 Ga0400488_59272
975 Ga0400486_00988
976 Ga0400486_01157
977 Ga0400486_03375
978 Ga0400486_05265
979 Ga0400486_14001
980 Ga0400486_17803
981 Ga0400486_22641
982 Ga0400486_22976
983 Ga0400483_000155
984 Ga0400483_014335
985 Ga0400483_059416
986 Ga0400483_094094
987 Ga0400483_117247
988 Ga0400483_141629
989 Ga0400483_145723
990 Ga0400483_194202
991 Ga0400483_199054
992 Ga0400483_202262
993 Ga0400483_207414
994 Ga0400483_207829
995 Ga0400483_208358
996 Ga0400483_242607
997 Ga0400489_03049
998 Ga0400489_20945
999 Ga0400489_28764
1000 Ga0400489_43156
1001 Ga0400489_66913
1002 Ga0400489_82117
1003 Ga0400489_83876
1004 Ga0400489_90203
1005 Ga0400489_93718
1006 Ga0400487_06228
1007 Ga0400487_09552
1008 Ga0400487_21303
1009 Ga0436361_0260284
1010 Ga0451577_0003510
1011 Ga0451577_0008141
1012 Ga0451577_0013407
1013 Ga0451577_0086146
1014 Ga0453684_0002307
1015 Ga0453684_0003023
1016 Ga0453684_0029438
1017 Ga0453684_0098524
1018 Ga0453684_0190332
1019 Ga0466971_0104245
1020 Ga0451576_0354138
1021 Ga0451576_0401207
1022 Ga0466967_0008384
1023 Ga0466967_0427940
1024 Ga0495592_0001447
1025 Ga0495603_0229697
1026 Ga0495629_0001842
1027 Ga0495651_0004852
1028 Ga0495651_0017791
1029 Ga0495651_0301102
1030 Ga0495651_0356113
1031 Ga0495653_0026707
1032 Ga0495580_0000342
1033 Ga0495580_0003649
1034 Ga0495580_0008151
1035 Ga0495580_0010582
1036 Ga0495580_0015546
1037 Ga0495580_0049239
1038 Ga0495580_0115399
1039 Ga0495580_0152997
1040 Ga0495580_0179122
1041 Ga0495662_0001272
1042 Ga0495664_0000970
1043 Ga0495608_0011181
1044 Ga0495608_0098377
1045 Ga0495628_0002093
1046 Ga0495628_0400440
1047 Ga0495630_0003747
1048 Ga0495630_0153418
1049 Ga0495630_0167972
1050 Ga0495652_0002721
1051 Ga0495665_0079518
1052 Ga0495640_0001833
1053 Ga0495587_0003040
1054 Ga0495587_0007328
1055 Ga0495645_0000857
1056 Ga0495645_0359138
1057 Ga0495667_0010264
1058 Ga0495667_0143838
1059 Ga0495634_0020530
1060 Ga0495657_0271453
1061 Ga0495657_0388248
1062 Ga0495599_0001371
1063 Ga0495623_0015228
1064 Ga0495646_0008501
1065 Ga0495658_0016832
1066 Ga0495658_0043943
1067 Ga0495669_0077828
1068 Ga0495613_0005880
1069 Ga0495613_0277766
1070 Ga0495600_0008497
1071 Ga0495604_0003554
1072 Ga0495604_0004403
1073 Ga0495604_0023377
1074 Ga0495604_0369427
1075 Ga0495674_0004685
1076 Ga0495674_0008068
1077 Ga0495674_0042397
1078 Ga0495674_0107742
1079 Ga0495674_0139940
1080 Ga0495680_0005022
1081 Ga0495675_0002823
1082 Ga0495684_0005551
1083 Ga0495684_0006430
1084 Ga0495684_0010329
1085 Ga0495684_0351115
1086 Ga0495602_0002275
1087 Ga0495602_0006891
1088 Ga0495602_0058422
1089 Ga0496100_0130716
1090 Ga0496101_0367608
1091 Ga0496102_0035638
1092 Ga0496102_0097221
1093 Ga0496102_0289480
1094 Ga0496106_0026282
1095 Ga0496107_0005841
1096 Ga0496108_0015313
1097 Ga0496109_0019265
1098 Ga0496109_0095885
1099 Ga0496109_0584803
1100 Ga0496110_0018315
1101 Ga0496112_0055435
1102 Ga0496112_0116224
1103 Ga0496112_0144301
1104 Ga0496112_0266855
1105 Ga0496112_0374780
1106 Ga0496113_0007314
1107 Ga0496113_0083949
1108 Ga0496114_0034742
1109 Ga0496115_0082810
1110 Ga0501038_0145946
1111 Ga0501041_0017132
1112 Ga0501048_0048560
1113 Ga0501067_0091482
1114 Ga0501075_0057450
1115 Ga0501076_0014633
1116 Ga0501077_0086185
1117 Ga0501045_0008989
1118 nmdc:mga0rr50_74867_c1
1119 nmdc:mga08x19_11842_c1
1120 nmdc:mga08x19_3809_c1
1121 Ga0495601_0208744
1122 Ga0495595_0114012
1123 Ga0501084_0015343
1124 Ga0501082_0101553
1125 Ga0530510_0099620
1126 2740990454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

55

240

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o95-assembly1.cif.gz_E ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9153 1 233
1o95-assembly1.cif.gz_C ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9147 1 232
1o95-assembly1.cif.gz_C ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9073 1 232
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9069 1 233
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9032 1 233
ID Description Score Start End Superfamily
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9149 1 232 3.40.50.620
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9074 1 232 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9069 1 233 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9032 1 233 3.40.50.620
1h9sA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8802 143 172 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A661RKV5-F1-model_v4 deleted 0.9714 1 203
AF-A0A661RKV5-F1-model_v4 deleted 0.9668 1 203
AF-A0A3M1KH12-F1-model_v4 EtfB protein 0.9642 1 84 GO:0009055
AF-A0A5K7ZYH2-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.956 1 89 GO:0009055
AF-X0SM84-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.9547 1 152 GO:0009055

Map