F463981

General Info

Members Datasets Scaffolds Average Seq Length
562 291 428 337

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0119028|Ga0496118_0119028_268_1368
Length 366
Sequence MVVFVRVFFHHCLPVKAGEPLKLAASKELMMKSVVIEQPGELVVAERPLPQPAAGEVRVKVQFASICGSDVHIWHGHNPFAKYPRVIGHEFFGLIDAVGDDVAASRIGERVAVDPVVSCGHCYPCSIGRPNVCTALQVIGVHRDGGFSEYAVAPAKNAFRLPDSIPDKLASMVEPFTIAANITAFLKPQPNDVALIYGAGPMGLTAIQVLKGVYGVEQVLVVDRLPERLALAQENGADQVFNNSEIPLAAQLEGLQPTLIIDAACHPSILAEAAALASPAARIGLLGFSGEPCSITQQSLTSKELSLFTSRLNSNRFPQVIEWIEQGQIQPEKLVTHYFPLADVEQAMTLFEKDPRTCCKVILQMG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
8 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
9 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
10 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
11 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
12 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
13 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
14 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
15 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
16 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
17 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
18 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
19 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
20 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
21 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
22 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
23 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
24 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
25 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
26 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
27 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
28 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
29 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
30 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
31 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
32 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
33 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
34 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
35 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
36 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
37 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
38 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
39 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
40 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
41 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
42 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
43 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
44 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
45 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
46 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
47 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
48 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
49 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
50 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
51 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
52 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
53 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
54 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
55 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
56 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
57 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
58 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
59 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
60 2636415599 Klebsiella variicola DX120E Isolate Unclassified
61 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
62 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
63 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
64 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
65 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
66 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
67 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
68 2751185917 Enterobacter sp. HK169 Isolate Unclassified
69 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
70 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
71 2775507074 Klebsiella sp. D5A Isolate Unclassified
72 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
73 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
74 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
75 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
76 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
77 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
78 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
79 2821118458 Enterobacter asburiae 609 Isolate Unclassified
80 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
81 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
82 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
83 2847085930 Erwinia persicina B64 Isolate Bulb
84 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
85 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
86 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
87 2865014394 Pantoea sp. R-71966 Isolate Unclassified
88 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
89 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
90 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
91 2876601092 Pantoea endophytica 596 Isolate Unclassified
92 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
93 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
94 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
95 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
96 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
97 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
98 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
99 2904504865 Serratia marcescens 1822 Isolate Unclassified
100 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
101 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
102 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
103 2919150387 Rahnella aceris 1817 Isolate Unclassified
104 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
105 2927143783 Rahnella sp. 2050 Isolate Unclassified
106 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
107 2932406140 Serratia sp. 2723 Isolate Rhizosphere
108 2937539931 Pantoea sp. LS15 Isolate Unclassified
109 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
110 2939577877 Serratia sp. 509 Isolate Rhizosphere
111 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
112 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
113 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
114 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
115 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
116 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
117 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
118 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
119 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
120 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
121 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
122 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
123 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
124 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
125 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
126 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
127 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
128 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
129 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
130 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
131 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
132 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
133 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
134 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
135 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
136 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
137 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
138 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
139 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
140 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
141 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
142 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
143 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
144 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
145 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
146 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
147 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
148 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
149 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
150 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
155 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
156 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
166 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
167 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
168 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
169 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
172 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
173 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
182 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
202 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
213 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
214 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
215 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
216 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
217 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
218 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
219 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
220 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
221 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
247 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
250 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
272 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
278 640753048 Serratia proteamaculans 568 Isolate Endosphere
279 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
280 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
281 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
282 8018221730 Enterobacter sp. CM29 Isolate Unclassified
283 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
284 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
285 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
286 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
287 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
288 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
289 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
290 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
291 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.16
Metatranscriptomes 0
Isolates 23.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0.18
Endosphere 5.69
Nodule 3.2
Rhizoplane 11.39
Rhizosphere 53.02
Stem 0
Stem Tuber 1.07
Unclassified 25.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_107088 2162886007 Bacteria 4251
2 SwRhRL2b_contig_2433766 2162886007 Bacteria 2075
3 JGI25162J39368_1000002 3300002737 Bacteria 663004
4 JGI25162J39368_1003127 3300002737 Bacteria 5226
5 JGI25163J39215_1000009 3300002771 Bacteria 93183
6 JGI25164J39214_1000006 3300002772 Bacteria 342675
7 rootH2_10003480 3300003320 Bacteria 26102
8 Ga0055538_1000003 3300003751 Bacteria 663004
9 Ga0055539_1000003 3300003752 Bacteria 663004
10 Ga0055533_1000005 3300003756 Bacteria 663004
11 Ga0055525_1000005 3300003759 Bacteria 663004
12 Ga0055541_1000003 3300003841 Bacteria 663004
13 Ga0058692_1000149 3300003856 Bacteria 44799
14 Ga0058692_1000307 3300003856 Bacteria 24561
15 Ga0058692_1000338 3300003856 Bacteria 22970
16 Ga0058692_1000984 3300003856 Bacteria 11208
17 Ga0058692_1001397 3300003856 Bacteria 8921
18 Ga0058692_1003607 3300003856 Bacteria 4750
19 Ga0058692_1006145 3300003856 Bacteria 3333
20 Ga0058692_1006170 3300003856 Bacteria 3325
21 Ga0058692_1012801 3300003856 Bacteria 1973
22 Ga0058692_1013027 3300003856 Bacteria 1950
23 Ga0058692_1013105 3300003856 Bacteria 1942
24 Ga0065704_10000324 3300005289 Bacteria 38798
25 Ga0065704_10001681 3300005289 Bacteria 24248
26 Ga0065704_10002407 3300005289 Bacteria 12245
27 Ga0065704_10005064 3300005289 Bacteria 7181
28 Ga0070666_10024488 3300005335 Bacteria 3932
29 Ga0070668_100002020 3300005347 Bacteria 14853
30 Ga0070674_100072377 3300005356 Bacteria 2441
31 Ga0070659_100015707 3300005366 Bacteria 5672
32 Ga0070667_100022896 3300005367 Bacteria 5180
33 Ga0070678_100058300 3300005456 Bacteria 2833
34 Ga0070665_100000973 3300005548 Bacteria 36350
35 Ga0070665_100043742 3300005548 Bacteria 4500
36 Ga0068857_100034858 3300005577 Bacteria 4453
37 Ga0068857_100117034 3300005577 Bacteria 2398
38 Ga0068863_100008560 3300005841 Bacteria 9999
39 Ga0068858_100006800 3300005842 Bacteria 11122
40 Ga0068860_100024216 3300005843 Bacteria 5870
41 Ga0075364_10006954 3300006051 Bacteria 6683
42 Ga0075370_10013135 3300006353 Bacteria 4395
43 Ga0079104_1000205 3300006946 Bacteria 82673
44 Ga0079104_1001107 3300006946 Bacteria 19927
45 Ga0079104_1001289 3300006946 Bacteria 17327
46 Ga0079104_1001964 3300006946 Bacteria 12124
47 Ga0079104_1004722 3300006946 Bacteria 5703
48 Ga0079104_1004831 3300006946 Bacteria 5600
49 Ga0079104_1005236 3300006946 Bacteria 5238
50 Ga0105251_10000021 3300009011 Bacteria 137955
51 Ga0105251_10000040 3300009011 Bacteria 115504
52 Ga0105251_10000160 3300009011 Bacteria 68873
53 Ga0105251_10000245 3300009011 Bacteria 54760
54 Ga0105251_10000891 3300009011 Bacteria 26739
55 Ga0105251_10001984 3300009011 Bacteria 16652
56 Ga0105251_10003563 3300009011 Bacteria 11228
57 Ga0105251_10012247 3300009011 Bacteria 4860
58 Ga0105251_10016959 3300009011 Bacteria 3914
59 Ga0105244_10000014 3300009036 Bacteria 257018
60 Ga0105244_10000015 3300009036 Bacteria 256814
61 Ga0105244_10000174 3300009036 Bacteria 65162
62 Ga0105244_10000960 3300009036 Bacteria 24197
63 Ga0105244_10001119 3300009036 Bacteria 22291
64 Ga0105244_10001223 3300009036 Bacteria 21049
65 Ga0105244_10001297 3300009036 Bacteria 20478
66 Ga0105244_10002727 3300009036 Bacteria 13202
67 Ga0105244_10014503 3300009036 Bacteria 4553
68 Ga0105244_10016059 3300009036 Bacteria 4277
69 Ga0105244_10016248 3300009036 Bacteria 4245
70 Ga0105244_10052861 3300009036 Bacteria 2067
71 Ga0105250_10000011 3300009092 Bacteria 276144
72 Ga0105250_10000264 3300009092 Bacteria 42668
73 Ga0105250_10000315 3300009092 Bacteria 37644
74 Ga0105250_10000533 3300009092 Bacteria 26352
75 Ga0105250_10000837 3300009092 Bacteria 18280
76 Ga0105250_10001341 3300009092 Bacteria 13434
77 Ga0105250_10001689 3300009092 Bacteria 11672
78 Ga0105250_10003501 3300009092 Bacteria 7414
79 Ga0105250_10008977 3300009092 Bacteria 4227
80 Ga0105250_10015369 3300009092 Bacteria 3133
81 Ga0105247_10000069 3300009101 Bacteria 116730
82 Ga0105241_10000011 3300009174 Bacteria 243033
83 Ga0105241_10047711 3300009174 Bacteria 3257
84 Ga0105248_10002548 3300009177 Bacteria 20287
85 Ga0105237_10007572 3300009545 Bacteria 11869
86 Ga0105249_10001344 3300009553 Bacteria 21505
87 Ga0105239_10030199 3300010375 Bacteria 5959
88 Ga0105246_10012418 3300011119 Bacteria 5315
89 Ga0105246_10321644 3300011119 Bacteria 1257
90 Ga0157373_10000873 3300013100 Bacteria 23335
91 Ga0157373_10001531 3300013100 Bacteria 17633
92 Ga0157373_10010491 3300013100 Bacteria 6816
93 Ga0157373_10073423 3300013100 Bacteria 2414
94 Ga0157373_10079886 3300013100 Bacteria 2306
95 Ga0157371_10000134 3300013102 Bacteria 108562
96 Ga0157371_10000254 3300013102 Bacteria 74505
97 Ga0157371_10003104 3300013102 Bacteria 15381
98 Ga0157371_10016705 3300013102 Bacteria 5469
99 Ga0157371_10125962 3300013102 Bacteria 1822
100 Ga0157371_10126283 3300013102 Bacteria 1819
101 Ga0157370_10000582 3300013104 Bacteria 45584
102 Ga0157370_10004434 3300013104 Bacteria 16085
103 Ga0157369_10010045 3300013105 Bacteria 10810
104 Ga0163162_10068629 3300013306 Bacteria 3597
105 Ga0163162_10093130 3300013306 Bacteria 3098
106 Ga0157372_10004875 3300013307 Bacteria 14266
107 Ga0157372_10018745 3300013307 Bacteria 7446
108 Ga0157372_10195884 3300013307 Bacteria 2341
109 Ga0182008_10004263 3300014497 Bacteria 8383
110 Ga0157379_10162290 3300014968 Bacteria 2017
111 Ga0182006_1000524 3300015261 Bacteria 29141
112 Ga0182006_1006705 3300015261 Bacteria 5323
113 Ga0183366_1001 3300015679 Bacteria 2743932
114 Ga0183370_1001 3300015680 Bacteria 2743932
115 Ga0183369_1001 3300015685 Bacteria 2743932
116 Ga0183368_1001 3300015687 Bacteria 2743932
117 Ga0163161_10000005 3300017792 Bacteria 327860
118 Ga0213872_10018224 3300021361 Bacteria 3238
119 Ga0213876_10000114 3300021384 Bacteria 88897
120 Ga0209760_100005 3300025207 Bacteria 238315
121 Ga0209760_101862 3300025207 Bacteria 2085
122 Ga0209784_100001 3300025224 Bacteria 3600592
123 Ga0209566_100001 3300025225 Bacteria 3600765
124 Ga0209674_100002 3300025226 Bacteria 3600592
125 Ga0209563_100002 3300025230 Bacteria 2045675
126 Ga0207427_100009 3300025231 Bacteria 663036
127 Ga0209437_100001 3300025233 Bacteria 2045675
128 Ga0209437_100842 3300025233 Bacteria 13344
129 Ga0209677_100002 3300025253 Bacteria 2045675
130 Ga0209233_1000533 3300025261 Bacteria 21699
131 Ga0209455_1001023 3300025272 Bacteria 13979
132 Ga0209025_1000473 3300025294 Bacteria 78078
133 Ga0207696_1000005 3300025711 Bacteria 642078
134 Ga0207696_1000026 3300025711 Bacteria 418166
135 Ga0207696_1000039 3300025711 Bacteria 324954
136 Ga0207696_1000058 3300025711 Bacteria 248495
137 Ga0207696_1000277 3300025711 Bacteria 60768
138 Ga0207696_1000295 3300025711 Bacteria 58179
139 Ga0207696_1000432 3300025711 Bacteria 38094
140 Ga0207696_1000858 3300025711 Bacteria 19072
141 Ga0207696_1001687 3300025711 Bacteria 11483
142 Ga0207655_1000001 3300025728 Bacteria 1866413
143 Ga0207655_1000009 3300025728 Bacteria 664676
144 Ga0207655_1000029 3300025728 Bacteria 432187
145 Ga0207655_1000061 3300025728 Bacteria 258893
146 Ga0207655_1000063 3300025728 Bacteria 257028
147 Ga0207655_1000078 3300025728 Bacteria 219360
148 Ga0207655_1000154 3300025728 Bacteria 125989
149 Ga0207655_1001411 3300025728 Bacteria 22298
150 Ga0207655_1008675 3300025728 Bacteria 6417
151 Ga0207655_1015698 3300025728 Bacteria 4193
152 Ga0207655_1016929 3300025728 Bacteria 3958
153 Ga0207655_1021442 3300025728 Bacteria 3279
154 Ga0207655_1028533 3300025728 Bacteria 2631
155 Ga0207713_1000001 3300025735 Bacteria 2295391
156 Ga0207713_1000002 3300025735 Bacteria 1061749
157 Ga0207713_1000003 3300025735 Bacteria 860698
158 Ga0207713_1000029 3300025735 Bacteria 285054
159 Ga0207713_1000095 3300025735 Bacteria 145778
160 Ga0207713_1000248 3300025735 Bacteria 68881
161 Ga0207713_1000328 3300025735 Bacteria 53307
162 Ga0207713_1002906 3300025735 Bacteria 11996
163 Ga0207713_1011322 3300025735 Bacteria 4862
164 Ga0207713_1016674 3300025735 Bacteria 3720
165 Ga0207713_1020236 3300025735 Bacteria 3230
166 Ga0207713_1023700 3300025735 Bacteria 2881
167 Ga0207710_10000026 3300025900 Bacteria 307644
168 Ga0207688_10033411 3300025901 Bacteria 2845
169 Ga0207680_10018223 3300025903 Bacteria 3727
170 Ga0207654_10000012 3300025911 Bacteria 243044
171 Ga0207654_10068063 3300025911 Bacteria 2106
172 Ga0207671_10009974 3300025914 Bacteria 7890
173 Ga0207681_10333447 3300025923 Bacteria 1210
174 Ga0207690_10013179 3300025932 Bacteria 4962
175 Ga0207706_10254025 3300025933 Bacteria 1535
176 Ga0207711_10003317 3300025941 Bacteria 13965
177 Ga0207712_10013984 3300025961 Bacteria 5151
178 Ga0207668_10012926 3300025972 Bacteria 5126
179 Ga0207703_10014410 3300026035 Bacteria 6165
180 Ga0207648_10321404 3300026089 Bacteria 1391
181 Ga0207674_10060993 3300026116 Bacteria 3812
182 Ga0207674_10117141 3300026116 Bacteria 2635
183 Ga0209281_1000004 3300027111 Bacteria 1253949
184 Ga0209281_1000006 3300027111 Bacteria 1170244
185 Ga0209281_1000024 3300027111 Bacteria 499062
186 Ga0209281_1000315 3300027111 Bacteria 86052
187 Ga0209281_1000402 3300027111 Bacteria 66243
188 Ga0209281_1000627 3300027111 Bacteria 39096
189 Ga0209281_1001069 3300027111 Bacteria 20447
190 Ga0209281_1009118 3300027111 Bacteria 2350
191 Ga0209371_1000001 3300027312 Bacteria 2771503
192 Ga0209371_1000002 3300027312 Bacteria 1551985
193 Ga0209371_1000005 3300027312 Bacteria 1061740
194 Ga0209371_1000041 3300027312 Bacteria 340377
195 Ga0209371_1000099 3300027312 Bacteria 154918
196 Ga0209371_1000109 3300027312 Bacteria 141217
197 Ga0209371_1000120 3300027312 Bacteria 132938
198 Ga0209371_1000187 3300027312 Bacteria 90195
199 Ga0209371_1000883 3300027312 Bacteria 23934
200 Ga0209371_1001442 3300027312 Bacteria 16164
201 Ga0209371_1001763 3300027312 Bacteria 13595
202 Ga0209371_1002178 3300027312 Bacteria 11452
203 Ga0209371_1004452 3300027312 Bacteria 6090
204 Ga0209371_1005478 3300027312 Bacteria 5028
205 Ga0209371_1021097 3300027312 Bacteria 1587
206 Ga0268266_10024950 3300028379 Bacteria 5087
207 Ga0307515_10000382 3300028794 Bacteria 107907
208 Ga0268256_1000001 3300030500 Bacteria 2771065
209 Ga0268256_1000002 3300030500 Bacteria 1535763
210 Ga0268256_1000003 3300030500 Bacteria 1289401
211 Ga0268256_1000006 3300030500 Bacteria 1063991
212 Ga0268256_1000035 3300030500 Bacteria 384794
213 Ga0268256_1000156 3300030500 Bacteria 90195
214 Ga0268256_1000744 3300030500 Bacteria 23948
215 Ga0268256_1001218 3300030500 Bacteria 16325
216 Ga0268256_1001895 3300030500 Bacteria 11543
217 Ga0268256_1002605 3300030500 Bacteria 8998
218 Ga0268256_1004004 3300030500 Bacteria 6349
219 Ga0268256_1006297 3300030500 Bacteria 4443
220 Ga0268256_1017467 3300030500 Bacteria 2019
221 Ga0268256_1023712 3300030500 Bacteria 1587
222 Ga0395899_0004268 3300037312 Bacteria 11181
223 Ga0395898_0158943 3300037466 Bacteria 2161
224 Ga0395905_0074098 3300037471 Bacteria 3190
225 Ga0395905_0077339 3300037471 Bacteria 3118
226 Ga0395901_0274573 3300038443 Bacteria 1752
227 Ga0436365_0454988 3300039437 Bacteria 170585
228 Ga0436361_0548101 3300039447 Bacteria 8089
229 Ga0436361_1160404 3300039447 Bacteria 3112
230 Ga0439438_000002 3300041405 Bacteria 618223
231 Ga0439438_000959 3300041405 Bacteria 12864
232 Ga0439438_004322 3300041405 Bacteria 5489
233 Ga0439438_013867 3300041405 Bacteria 2414
234 Ga0439447_001008 3300041407 Bacteria 10278
235 Ga0439447_003413 3300041407 Bacteria 5647
236 Ga0439466_0000001 3300041411 Bacteria 647258
237 Ga0439433_0009012 3300041999 Bacteria 2173
238 Ga0439432_004842 3300042006 Bacteria 4881
239 Ga0439432_032530 3300042006 Bacteria 1681
240 Ga0439449_0088188 3300042007 Bacteria 1145
241 Ga0439452_000002 3300042010 Bacteria 1377577
242 Ga0439452_000109 3300042010 Bacteria 67189
243 Ga0439452_000280 3300042010 Bacteria 33573
244 Ga0439452_006218 3300042010 Bacteria 3759
245 Ga0439463_016185 3300042016 Bacteria 1844
246 Ga0450907_000135 3300042146 Bacteria 28026
247 Ga0466981_0000027 3300044669 Bacteria 71694
248 Ga0466967_0230020 3300045976 Bacteria 1765
249 Ga0495627_000311 3300046453 Bacteria 47841
250 Ga0495591_000001 3300046458 Bacteria 503087
251 Ga0495591_000003 3300046458 Bacteria 449825
252 Ga0495591_004807 3300046458 Bacteria 6447
253 Ga0495591_007351 3300046458 Bacteria 4698
254 Ga0495638_0000890 3300046460 Bacteria 30629
255 Ga0495650_0000005 3300046471 Bacteria 766553
256 Ga0495650_0000031 3300046471 Bacteria 433811
257 Ga0495650_0000106 3300046471 Bacteria 202178
258 Ga0495650_0002704 3300046471 Bacteria 13751
259 Ga0495605_0034071 3300046474 Bacteria 2580
260 Ga0495585_0032227 3300046492 Bacteria 2969
261 Ga0495596_0003063 3300046500 Bacteria 8639
262 Ga0495607_0068799 3300046501 Bacteria 1984
263 Ga0495583_0100378 3300046506 Bacteria 1236
264 Ga0495606_0002020 3300046507 Bacteria 24910
265 Ga0495616_0017565 3300046513 Bacteria 3945
266 Ga0495620_0009240 3300046515 Bacteria 5250
267 Ga0495644_0007918 3300046523 Bacteria 4090
268 Ga0495648_0003366 3300046524 Bacteria 14074
269 Ga0495648_0037010 3300046524 Bacteria 3140
270 Ga0495654_0000009 3300046530 Bacteria 381872
271 Ga0495654_0000068 3300046530 Bacteria 125533
272 Ga0495654_0000574 3300046530 Bacteria 29547
273 Ga0495654_0020982 3300046530 Bacteria 3402
274 Ga0495654_0038016 3300046530 Bacteria 2409
275 Ga0495586_0031862 3300046535 Bacteria 2826
276 Ga0495597_0000396 3300046542 Bacteria 37594
277 Ga0495656_0081327 3300046615 Bacteria 1462
278 Ga0495611_0187003 3300046648 Bacteria 967
279 Ga0495625_0012453 3300046660 Bacteria 6892
280 Ga0495588_0025880 3300046674 Bacteria 2927
281 Ga0495671_0014369 3300046692 Bacteria 4263
282 Ga0495649_0000229 3300046694 Bacteria 48965
283 Ga0495649_0000261 3300046694 Bacteria 46982
284 Ga0495649_0059961 3300046694 Bacteria 2048
285 Ga0495589_0000032 3300046794 Bacteria 167736
286 Ga0495589_0030503 3300046794 Bacteria 2715
287 Ga0495660_0000004 3300046810 Bacteria 1003183
288 Ga0495660_0000015 3300046810 Bacteria 324892
289 Ga0495672_0000001 3300047320 Bacteria 1458820
290 Ga0495672_0000034 3300047320 Bacteria 290832
291 Ga0495672_0000038 3300047320 Bacteria 273489
292 Ga0495679_000005 3300047446 Bacteria 455007
293 Ga0495679_000484 3300047446 Bacteria 28480
294 Ga0495679_027411 3300047446 Bacteria 1879
295 Ga0495673_0000019 3300047469 Bacteria 554389
296 Ga0495673_0000070 3300047469 Bacteria 217453
297 Ga0495593_0169704 3300047673 Bacteria 1100
298 Ga0496101_0000433 3300048904 Bacteria 26770
299 Ga0496102_0001841 3300048905 Bacteria 18310
300 Ga0496102_0416878 3300048905 Bacteria 1261
301 Ga0496104_0000842 3300048907 Bacteria 26474
302 Ga0496104_0004356 3300048907 Bacteria 12311
303 Ga0496104_0008198 3300048907 Bacteria 9276
304 Ga0496104_0201365 3300048907 Bacteria 1903
305 Ga0496105_0010044 3300048908 Bacteria 7429
306 Ga0496106_0033332 3300048909 Bacteria 3843
307 Ga0496108_0015356 3300048911 Bacteria 6246
308 Ga0496110_0038433 3300048913 Bacteria 4165
309 Ga0496111_0022644 3300048914 Bacteria 4401
310 Ga0496116_0000007 3300048919 Bacteria 795464
311 Ga0496116_0000074 3300048919 Bacteria 231767
312 Ga0496116_0000140 3300048919 Bacteria 151165
313 Ga0496116_0002467 3300048919 Bacteria 19390
314 Ga0496116_0004357 3300048919 Bacteria 13537
315 Ga0496116_0018892 3300048919 Bacteria 5293
316 Ga0496116_0030629 3300048919 Bacteria 3861
317 Ga0496117_0000009 3300048920 Bacteria 613759
318 Ga0496117_0000020 3300048920 Bacteria 458405
319 Ga0496117_0000154 3300048920 Bacteria 146606
320 Ga0496117_0003085 3300048920 Bacteria 19943
321 Ga0496117_0004070 3300048920 Bacteria 16416
322 Ga0496117_0082739 3300048920 Bacteria 2101
323 Ga0496117_0110326 3300048920 Bacteria 1715
324 Ga0496117_0128105 3300048920 Bacteria 1544
325 Ga0496117_0167916 3300048920 Bacteria 1277
326 Ga0496118_0000015 3300048921 Bacteria 551359
327 Ga0496118_0000017 3300048921 Bacteria 549445
328 Ga0496118_0000150 3300048921 Bacteria 123251
329 Ga0496118_0002403 3300048921 Bacteria 25281
330 Ga0496118_0003605 3300048921 Bacteria 19247
331 Ga0496118_0003617 3300048921 Bacteria 19195
332 Ga0496118_0004336 3300048921 Bacteria 16892
333 Ga0496118_0011894 3300048921 Bacteria 8426
334 Ga0496118_0047201 3300048921 Bacteria 3341
335 Ga0496118_0062053 3300048921 Bacteria 2762
336 Ga0496118_0066298 3300048921 Bacteria 2636
337 Ga0496118_0119028 3300048921 Bacteria 1728
338 Ga0496119_0000012 3300048922 Bacteria 411917
339 Ga0496119_0000027 3300048922 Bacteria 249124
340 Ga0496119_0000145 3300048922 Bacteria 99245
341 Ga0496119_0000361 3300048922 Bacteria 63778
342 Ga0496119_0001740 3300048922 Bacteria 25381
343 Ga0496119_0007424 3300048922 Bacteria 9876
344 Ga0496119_0007646 3300048922 Bacteria 9687
345 Ga0496119_0010045 3300048922 Bacteria 8007
346 Ga0496119_0010071 3300048922 Bacteria 7992
347 Ga0496119_0014397 3300048922 Bacteria 6194
348 Ga0496119_0017757 3300048922 Bacteria 5334
349 Ga0496119_0099221 3300048922 Bacteria 1638
350 Ga0496119_0154163 3300048922 Bacteria 1228
351 Ga0496120_0000004 3300048923 Bacteria 534793
352 Ga0496120_0000022 3300048923 Bacteria 249124
353 Ga0496120_0000048 3300048923 Bacteria 187988
354 Ga0496120_0000207 3300048923 Bacteria 101327
355 Ga0496120_0000417 3300048923 Bacteria 67929
356 Ga0496120_0000494 3300048923 Bacteria 61684
357 Ga0496120_0000636 3300048923 Bacteria 52284
358 Ga0496120_0000955 3300048923 Bacteria 39381
359 Ga0496120_0001954 3300048923 Bacteria 22566
360 Ga0496120_0010071 3300048923 Bacteria 6631
361 Ga0496120_0010912 3300048923 Bacteria 6284
362 Ga0496120_0022890 3300048923 Bacteria 3922
363 Ga0496121_0000787 3300048924 Bacteria 57970
364 Ga0496121_0001697 3300048924 Bacteria 36188
365 Ga0496121_0002591 3300048924 Bacteria 27299
366 Ga0496121_0006868 3300048924 Bacteria 13915
367 Ga0496121_0012008 3300048924 Bacteria 9519
368 Ga0496121_0012218 3300048924 Bacteria 9407
369 Ga0496121_0018360 3300048924 Bacteria 7056
370 Ga0496121_0030879 3300048924 Bacteria 4911
371 Ga0496122_0000005 3300048925 Bacteria 630659
372 Ga0496122_0000064 3300048925 Bacteria 239959
373 Ga0496122_0000409 3300048925 Bacteria 91249
374 Ga0496122_0002413 3300048925 Bacteria 26612
375 Ga0496122_0003410 3300048925 Bacteria 20908
376 Ga0496122_0004947 3300048925 Bacteria 16157
377 Ga0496122_0016310 3300048925 Bacteria 7044
378 Ga0496122_0031578 3300048925 Bacteria 4404
379 Ga0496122_0055329 3300048925 Bacteria 2970
380 Ga0496122_0098461 3300048925 Bacteria 1964
381 Ga0496123_0000008 3300048926 Bacteria 630628
382 Ga0496123_0000049 3300048926 Bacteria 239949
383 Ga0496123_0000334 3300048926 Bacteria 89471
384 Ga0496123_0000522 3300048926 Bacteria 66709
385 Ga0496123_0001213 3300048926 Bacteria 37604
386 Ga0496123_0001439 3300048926 Bacteria 33167
387 Ga0496123_0002990 3300048926 Bacteria 19591
388 Ga0496123_0003141 3300048926 Bacteria 18940
389 Ga0496123_0003921 3300048926 Bacteria 16157
390 Ga0496123_0004444 3300048926 Bacteria 14755
391 Ga0496123_0006490 3300048926 Bacteria 11320
392 Ga0496123_0068794 3300048926 Bacteria 2227
393 Ga0496124_0000027 3300048927 Bacteria 376097
394 Ga0496124_0000049 3300048927 Bacteria 269753
395 Ga0496124_0000162 3300048927 Bacteria 135594
396 Ga0496124_0001072 3300048927 Bacteria 43248
397 Ga0496124_0001093 3300048927 Bacteria 42627
398 Ga0496124_0002873 3300048927 Bacteria 21776
399 Ga0496124_0006707 3300048927 Bacteria 12459
400 Ga0496124_0079478 3300048927 Bacteria 2700
401 Ga0496124_0130017 3300048927 Bacteria 2002
402 Ga0496124_0134188 3300048927 Bacteria 1962
403 Ga0496125_0000052 3300048928 Bacteria 281862
404 Ga0496125_0000999 3300048928 Bacteria 44091
405 Ga0496125_0003084 3300048928 Bacteria 20802
406 Ga0496125_0003832 3300048928 Bacteria 17848
407 Ga0496125_0009780 3300048928 Bacteria 9779
408 Ga0496125_0016399 3300048928 Bacteria 7117
409 Ga0496125_0064617 3300048928 Bacteria 2906
410 Ga0496126_0000142 3300048929 Bacteria 164438
411 Ga0496126_0000710 3300048929 Bacteria 60763
412 Ga0496126_0002144 3300048929 Bacteria 27495
413 Ga0496126_0078019 3300048929 Bacteria 2935
414 Ga0496126_0081895 3300048929 Bacteria 2852
415 Ga0496126_0112237 3300048929 Bacteria 2373
416 Ga0496126_0118123 3300048929 Bacteria 2302
417 Ga0496126_0125129 3300048929 Bacteria 2226
418 Ga0496126_0182789 3300048929 Bacteria 1780
419 Ga0495678_000206 3300049459 Bacteria 68472
420 Ga0495678_040509 3300049459 Bacteria 1872
421 Ga0495682_0000001 3300049460 Bacteria 1559116
422 nmdc:mga03683_2489_c1 3300050489 Bacteria 5731
423 nmdc:mga00v17_29493_c1 3300050491 Bacteria 3220
424 nmdc:mga0k408_12106_c1 3300050493 Bacteria 4710
425 nmdc:mga0k408_136231_c1 3300050493 Bacteria 1459
426 nmdc:mga07m45_4434_c1 3300050496 Bacteria 6873
427 nmdc:mga07m45_4932_c1 3300050496 Bacteria 6575
428 Ga0500621_000002 3300053126 Bacteria 849473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2547132416 2548649057 291
2 3300046648 Ga0495611_0187003 Ga0495611_0187003_31_921 296
3 3300046506 Ga0495583_0100378 Ga0495583_0100378_53_1039 312
4 3300009011 Ga0105251_10000040 Ga0105251_1000004029 320
5 3300009036 Ga0105244_10001297 Ga0105244_100012973 320
6 3300025735 Ga0207713_1000002 Ga0207713_1000002716 320
7 3300048927 Ga0496124_0130017 Ga0496124_0130017_298_1311 320
8 3300048922 Ga0496119_0154163 Ga0496119_0154163_211_1218 322
9 iso_pu_bacteria 2511231025 2511379950 322
10 iso_pu_bacteria 2511231035 2511435047 322
11 iso_pu_bacteria 2537561728 2538426496 322
12 iso_pu_bacteria 2608642108 2608669934 322
13 iso_pu_bacteria 2844528606 2844529030 322
14 iso_pu_bacteria 2847085930 2847086736 322
15 iso_pu_bacteria 2865014394 2865018494 322
16 iso_pu_bacteria 2871272651 2871273912 322
17 iso_pu_bacteria 2881609920 2881610393 322
18 iso_pu_bacteria 2945951305 2945952325 322
19 iso_pu_bacteria 2978975091 2978978809 322
20 3300005456 Ga0070678_100058300 Ga0070678_1000583002 323
21 3300028794 Ga0307515_10000382 Ga0307515_1000038255 323
22 3300037471 Ga0395905_0077339 Ga0395905_0077339_1451_2485 323
23 iso_pu_bacteria 2515154189 2516021919 323
24 iso_pu_bacteria 2585427591 2585827352 323
25 iso_pu_bacteria 2585427592 2585833360 323
26 iso_pu_bacteria 2667528173 2671107293 323
27 iso_pu_bacteria 2808606384 2808968866 323
28 iso_pu_bacteria 2808606390 2809003697 323
29 iso_pu_bacteria 2808606391 2809010974 323
30 iso_pu_bacteria 2876601092 2876602871 323
31 iso_pu_bacteria 2891670763 2891670984 323
32 iso_pu_bacteria 2904474040 2904476231 323
33 iso_pu_bacteria 2904504865 2904506647 323
34 iso_pu_bacteria 2908669403 2908672306 323
35 iso_pu_bacteria 2919150387 2919152400 323
36 iso_pu_bacteria 2927143783 2927145069 323
37 iso_pu_bacteria 2932406140 2932409249 323
38 iso_pu_bacteria 2939577877 2939580805 323
39 iso_pu_bacteria 2939602548 2939604706 323
40 iso_pu_bacteria 2939607340 2939607462 323
41 iso_pu_bacteria 8016733728 8016735171 323
42 iso_pu_bacteria 8019499862 8019501347 323
43 iso_pu_bacteria 8054844752 8054845992 323
44 iso_pu_bacteria 8054849141 8054853148 323
45 iso_pu_bacteria 8055097453 8055099173 323
46 3300009092 Ga0105250_10000533 Ga0105250_1000053311 324
47 3300025272 Ga0209455_1001023 Ga0209455_10010235 324
48 3300025711 Ga0207696_1000005 Ga0207696_1000005474 324
49 3300037471 Ga0395905_0074098 Ga0395905_0074098_489_1523 324
50 3300046471 Ga0495650_0002704 Ga0495650_0002704_10140_11144 324
51 3300048907 Ga0496104_0004356 Ga0496104_0004356_10562_11566 324
52 3300048920 Ga0496117_0110326 Ga0496117_0110326_88_1092 324
53 3300048921 Ga0496118_0003605 Ga0496118_0003605_8385_9389 324
54 3300048922 Ga0496119_0000145 Ga0496119_0000145_27134_28138 324
55 3300048923 Ga0496120_0000417 Ga0496120_0000417_64220_65224 324
56 3300048925 Ga0496122_0098461 Ga0496122_0098461_239_1243 324
57 iso_pu_bacteria 2506520007 2506579857 324
58 iso_pu_bacteria 2506520008 2506584996 324
59 iso_pu_bacteria 2508501071 2508853630 324
60 iso_pu_bacteria 2513237150 2513956646 324
61 iso_pu_bacteria 2513237165 2514044520 324
62 iso_pu_bacteria 2554235234 2555257654 324
63 iso_pu_bacteria 2599185169 2599410319 324
64 iso_pu_bacteria 2600255254 2601523531 324
65 iso_pu_bacteria 2600255255 2601528690 324
66 iso_pu_bacteria 2600255256 2601532517 324
67 iso_pu_bacteria 2600255257 2601537887 324
68 iso_pu_bacteria 2600255280 2601615523 324
69 iso_pu_bacteria 2600255281 2601619551 324
70 iso_pu_bacteria 2600255287 2601644034 324
71 iso_pu_bacteria 2600255288 2601647956 324
72 iso_pu_bacteria 2600255289 2601653575 324
73 iso_pu_bacteria 2600255290 2601658304 324
74 iso_pu_bacteria 2600255291 2601663859 324
75 iso_pu_bacteria 2600255298 2601696260 324
76 iso_pu_bacteria 2600255299 2601701491 324
77 iso_pu_bacteria 2600255300 2601706230 324
78 iso_pu_bacteria 2600255301 2601711815 324
79 iso_pu_bacteria 2600255302 2601716833 324
80 iso_pu_bacteria 2600255303 2601721284 324
81 iso_pu_bacteria 2600255304 2601727239 324
82 iso_pu_bacteria 2600255305 2601731779 324
83 iso_pu_bacteria 2600255306 2601736791 324
84 iso_pu_bacteria 2600255307 2601740243 324
85 iso_pu_bacteria 2600255309 2601751180 324
86 iso_pu_bacteria 2600255310 2601756457 324
87 iso_pu_bacteria 2600255311 2601763062 324
88 iso_pu_bacteria 2600255392 2602018960 324
89 iso_pu_bacteria 2602042046 2603638032 324
90 iso_pu_bacteria 2602042052 2603661247 324
91 iso_pu_bacteria 2602042053 2603666522 324
92 iso_pu_bacteria 2602042103 2603839176 324
93 iso_pu_bacteria 2602042104 2603843564 324
94 iso_pu_bacteria 2602042105 2603849333 324
95 iso_pu_bacteria 2602042106 2603854403 324
96 iso_pu_bacteria 2602042110 2603872458 324
97 iso_pu_bacteria 2602042111 2603877334 324
98 iso_pu_bacteria 2603880178 2606049639 324
99 iso_pu_bacteria 2603880184 2606070954 324
100 iso_pu_bacteria 2603880202 2606147323 324
101 iso_pu_bacteria 2603880211 2606177048 324
102 iso_pu_bacteria 2636415599 2637223119 324
103 iso_pu_bacteria 2654587920 2656275516 324
104 iso_pu_bacteria 2675903046 2676408690 324
105 iso_pu_bacteria 2687453601 2689446380 324
106 iso_pu_bacteria 2775507074 2777019443 324
107 iso_pu_bacteria 2806310673 2807179912 324
108 iso_pu_bacteria 2811995292 2813729040 324
109 iso_pu_bacteria 2814123068 2814696583 324
110 iso_pu_bacteria 2888373701 2888377141 324
111 iso_pu_bacteria 2900051742 2900054505 324
112 iso_pu_bacteria 2904513164 2904517033 324
113 iso_pu_bacteria 2919108558 2919108856 324
114 iso_pu_bacteria 2969079654 2969080150 324
115 iso_pu_bacteria 2971820967 2971823422 324
116 iso_pu_bacteria 2984559226 2984562605 324
117 iso_pu_bacteria 2984595703 2984600665 324
118 iso_pu_bacteria 644736347 644749157 324
119 iso_pu_bacteria 8055087960 8055090875 324
120 iso_pu_bacteria 8055092621 8055094662 324
121 3300003856 Ga0058692_1013027 Ga0058692_10130272 325
122 3300003856 Ga0058692_1013105 Ga0058692_10131052 325
123 3300027312 Ga0209371_1000005 Ga0209371_1000005812 325
124 3300027312 Ga0209371_1005478 Ga0209371_10054783 325
125 3300030500 Ga0268256_1000006 Ga0268256_1000006245 325
126 iso_pu_bacteria 2602042047 2603642509 325
127 iso_pu_bacteria 2602042066 2603698417 325
128 iso_pu_bacteria 2602042067 2603703105 325
129 iso_pu_bacteria 2602042109 2603866668 325
130 iso_pu_bacteria 2609459761 2609913611 325
131 iso_pu_bacteria 2667528172 2671103070 325
132 iso_pu_bacteria 2681812866 2681997795 325
133 iso_pu_bacteria 2681812869 2682006692 325
134 iso_pu_bacteria 2751185917 2753855872 325
135 iso_pu_bacteria 2765235842 2765588855 325
136 iso_pu_bacteria 2775506706 2775538887 325
137 iso_pu_bacteria 2791355275 2793405645 325
138 iso_pu_bacteria 2821118458 2821119695 325
139 iso_pu_bacteria 2823373977 2823374646 325
140 iso_pu_bacteria 2844425489 2844427423 325
141 iso_pu_bacteria 2854601825 2854606168 325
142 iso_pu_bacteria 2855195626 2855198498 325
143 iso_pu_bacteria 2858466076 2858467446 325
144 iso_pu_bacteria 2871282230 2871283676 325
145 iso_pu_bacteria 2923634449 2923634740 325
146 iso_pu_bacteria 2927833300 2927834203 325
147 iso_pu_bacteria 2937539931 2937541764 325
148 iso_pu_bacteria 2939568625 2939569074 325
149 iso_pu_bacteria 2939642701 2939643878 325
150 iso_pu_bacteria 2945874760 2945877704 325
151 iso_pu_bacteria 2974310843 2974312222 325
152 iso_pu_bacteria 8018405270 8018407812 325
153 iso_pu_bacteria 8055693939 8055697144 325
154 iso_pu_bacteria 8057304971 8057305511 325
155 3300002737 JGI25162J39368_1003127 JGI25162J39368_10031272 326
156 3300003856 Ga0058692_1000307 Ga0058692_100030715 326
157 3300003856 Ga0058692_1000338 Ga0058692_100033817 326
158 3300003856 Ga0058692_1001397 Ga0058692_10013973 326
159 3300003856 Ga0058692_1003607 Ga0058692_10036073 326
160 3300003856 Ga0058692_1012801 Ga0058692_10128012 326
161 3300005347 Ga0070668_100002020 Ga0070668_1000020208 326
162 3300005366 Ga0070659_100015707 Ga0070659_1000157074 326
163 3300005548 Ga0070665_100043742 Ga0070665_1000437423 326
164 3300009011 Ga0105251_10000891 Ga0105251_1000089116 326
165 3300009011 Ga0105251_10016959 Ga0105251_100169592 326
166 3300009036 Ga0105244_10000960 Ga0105244_1000096020 326
167 3300009036 Ga0105244_10016059 Ga0105244_100160594 326
168 3300009092 Ga0105250_10000837 Ga0105250_100008378 326
169 3300009092 Ga0105250_10003501 Ga0105250_100035013 326
170 3300011119 Ga0105246_10012418 Ga0105246_100124185 326
171 3300011119 Ga0105246_10321644 Ga0105246_103216441 326
172 3300013100 Ga0157373_10001531 Ga0157373_100015315 326
173 3300013100 Ga0157373_10010491 Ga0157373_100104914 326
174 3300013100 Ga0157373_10073423 Ga0157373_100734232 326
175 3300013102 Ga0157371_10000254 Ga0157371_1000025449 326
176 3300013102 Ga0157371_10003104 Ga0157371_100031044 326
177 3300013102 Ga0157371_10126283 Ga0157371_101262832 326
178 3300013105 Ga0157369_10010045 Ga0157369_100100452 326
179 3300013306 Ga0163162_10093130 Ga0163162_100931302 326
180 3300013307 Ga0157372_10004875 Ga0157372_100048754 326
181 3300013307 Ga0157372_10018745 Ga0157372_100187456 326
182 3300013307 Ga0157372_10195884 Ga0157372_101958842 326
183 3300015261 Ga0182006_1006705 Ga0182006_10067054 326
184 3300025207 Ga0209760_101862 Ga0209760_1018622 326
185 3300025233 Ga0209437_100842 Ga0209437_1008422 326
186 3300025711 Ga0207696_1000058 Ga0207696_100005822 326
187 3300025711 Ga0207696_1000858 Ga0207696_100085810 326
188 3300025711 Ga0207696_1001687 Ga0207696_100168711 326
189 3300025728 Ga0207655_1008675 Ga0207655_10086753 326
190 3300025728 Ga0207655_1015698 Ga0207655_10156982 326
191 3300025728 Ga0207655_1016929 Ga0207655_10169293 326
192 3300025735 Ga0207713_1000001 Ga0207713_10000011736 326
193 3300025735 Ga0207713_1020236 Ga0207713_10202363 326
194 3300025735 Ga0207713_1023700 Ga0207713_10237002 326
195 3300025923 Ga0207681_10333447 Ga0207681_103334472 326
196 3300025932 Ga0207690_10013179 Ga0207690_100131792 326
197 3300025972 Ga0207668_10012926 Ga0207668_100129263 326
198 3300027312 Ga0209371_1000001 Ga0209371_10000011197 326
199 3300027312 Ga0209371_1000099 Ga0209371_1000099100 326
200 3300027312 Ga0209371_1000120 Ga0209371_100012019 326
201 3300027312 Ga0209371_1000883 Ga0209371_10008836 326
202 3300027312 Ga0209371_1001763 Ga0209371_10017633 326
203 3300027312 Ga0209371_1004452 Ga0209371_10044525 326
204 3300030500 Ga0268256_1000001 Ga0268256_10000011444 326
205 3300030500 Ga0268256_1000035 Ga0268256_100003595 326
206 3300030500 Ga0268256_1000744 Ga0268256_10007446 326
207 3300030500 Ga0268256_1002605 Ga0268256_10026056 326
208 3300030500 Ga0268256_1004004 Ga0268256_10040045 326
209 3300030500 Ga0268256_1006297 Ga0268256_10062974 326
210 3300041405 Ga0439438_000002 Ga0439438_000002_224976_225986 326
211 3300041405 Ga0439438_000959 Ga0439438_000959_2724_3773 326
212 3300041407 Ga0439447_001008 Ga0439447_001008_755_1804 326
213 3300041407 Ga0439447_003413 Ga0439447_003413_1823_2833 326
214 3300041411 Ga0439466_0000001 Ga0439466_0000001_263570_264580 326
215 3300042006 Ga0439432_004842 Ga0439432_004842_1528_2538 326
216 3300042006 Ga0439432_032530 Ga0439432_032530_511_1521 326
217 3300042007 Ga0439449_0088188 Ga0439449_0088188_12_1091 326
218 3300042010 Ga0439452_000109 Ga0439452_000109_5818_6840 326
219 3300042010 Ga0439452_006218 Ga0439452_006218_1310_2320 326
220 3300042016 Ga0439463_016185 Ga0439463_016185_560_1570 326
221 3300042146 Ga0450907_000135 Ga0450907_000135_17937_18947 326
222 3300046458 Ga0495591_000001 Ga0495591_000001_432910_433923 326
223 3300046458 Ga0495591_007351 Ga0495591_007351_3123_4133 326
224 3300046471 Ga0495650_0000031 Ga0495650_0000031_425348_426358 326
225 3300046474 Ga0495605_0034071 Ga0495605_0034071_995_2005 326
226 3300046492 Ga0495585_0032227 Ga0495585_0032227_914_1924 326
227 3300046500 Ga0495596_0003063 Ga0495596_0003063_1060_2070 326
228 3300046501 Ga0495607_0068799 Ga0495607_0068799_825_1835 326
229 3300046507 Ga0495606_0002020 Ga0495606_0002020_11800_12810 326
230 3300046513 Ga0495616_0017565 Ga0495616_0017565_502_1512 326
231 3300046523 Ga0495644_0007918 Ga0495644_0007918_2068_3078 326
232 3300046524 Ga0495648_0003366 Ga0495648_0003366_7076_8086 326
233 3300046524 Ga0495648_0037010 Ga0495648_0037010_551_1561 326
234 3300046530 Ga0495654_0000009 Ga0495654_0000009_167784_168797 326
235 3300046530 Ga0495654_0000068 Ga0495654_0000068_103216_104226 326
236 3300046542 Ga0495597_0000396 Ga0495597_0000396_11042_12055 326
237 3300046674 Ga0495588_0025880 Ga0495588_0025880_1033_2046 326
238 3300046692 Ga0495671_0014369 Ga0495671_0014369_3127_4137 326
239 3300046694 Ga0495649_0059961 Ga0495649_0059961_380_1390 326
240 3300046794 Ga0495589_0030503 Ga0495589_0030503_515_1525 326
241 3300046810 Ga0495660_0000015 Ga0495660_0000015_179953_180963 326
242 3300047320 Ga0495672_0000001 Ga0495672_0000001_975687_976697 326
243 3300047320 Ga0495672_0000038 Ga0495672_0000038_254540_255550 326
244 3300047469 Ga0495673_0000019 Ga0495673_0000019_81832_82842 326
245 3300048904 Ga0496101_0000433 Ga0496101_0000433_22035_23048 326
246 3300048905 Ga0496102_0001841 Ga0496102_0001841_17186_18196 326
247 3300048909 Ga0496106_0033332 Ga0496106_0033332_173_1183 326
248 3300048919 Ga0496116_0000140 Ga0496116_0000140_6082_7092 326
249 3300048920 Ga0496117_0000009 Ga0496117_0000009_362767_363777 326
250 3300048920 Ga0496117_0000154 Ga0496117_0000154_17318_18328 326
251 3300048921 Ga0496118_0000017 Ga0496118_0000017_298453_299463 326
252 3300048921 Ga0496118_0000150 Ga0496118_0000150_17319_18329 326
253 3300048921 Ga0496118_0119028 Ga0496118_0119028_268_1368 326
254 3300048922 Ga0496119_0000012 Ga0496119_0000012_145320_146336 326
255 3300048922 Ga0496119_0000027 Ga0496119_0000027_239267_240277 326
256 3300048922 Ga0496119_0000361 Ga0496119_0000361_14461_15471 326
257 3300048922 Ga0496119_0001740 Ga0496119_0001740_4485_5495 326
258 3300048922 Ga0496119_0017757 Ga0496119_0017757_4121_5134 326
259 3300048923 Ga0496120_0000004 Ga0496120_0000004_265582_266598 326
260 3300048923 Ga0496120_0000022 Ga0496120_0000022_239267_240277 326
261 3300048923 Ga0496120_0000048 Ga0496120_0000048_120639_121649 326
262 3300048923 Ga0496120_0000207 Ga0496120_0000207_30467_31480 326
263 3300048923 Ga0496120_0001954 Ga0496120_0001954_17721_18731 326
264 3300048924 Ga0496121_0012008 Ga0496121_0012008_8194_9204 326
265 3300048924 Ga0496121_0012218 Ga0496121_0012218_1325_2344 326
266 3300048925 Ga0496122_0002413 Ga0496122_0002413_20220_21230 326
267 3300048926 Ga0496123_0002990 Ga0496123_0002990_1001_2014 326
268 3300048926 Ga0496123_0006490 Ga0496123_0006490_8452_9462 326
269 3300048927 Ga0496124_0001093 Ga0496124_0001093_11932_12942 326
270 3300048927 Ga0496124_0134188 Ga0496124_0134188_320_1333 326
271 3300048928 Ga0496125_0009780 Ga0496125_0009780_7697_8707 326
272 3300048929 Ga0496126_0000142 Ga0496126_0000142_143983_145002 326
273 3300048929 Ga0496126_0112237 Ga0496126_0112237_164_1183 326
274 3300048929 Ga0496126_0125129 Ga0496126_0125129_882_1895 326
275 3300049459 Ga0495678_000206 Ga0495678_000206_13273_14283 326
276 3300049459 Ga0495678_040509 Ga0495678_040509_397_1407 326
277 3300049460 Ga0495682_0000001 Ga0495682_0000001_155655_156665 326
278 3300050491 nmdc:mga00v17_29493_c1 nmdc:mga00v17_29493_c1_2125_3138 326
279 3300050493 nmdc:mga0k408_12106_c1 nmdc:mga0k408_12106_c1_466_1485 326
280 3300053126 Ga0500621_000002 Ga0500621_000002_150957_151967 326
281 iso_pu_bacteria 8018221730 8018221927 326
282 2162886007 SwRhRL2b_contig_2433766 SwRhRL2b_0514.00003130 327
283 3300002737 JGI25162J39368_1000002 JGI25162J39368_1000002197 327
284 3300002771 JGI25163J39215_1000009 JGI25163J39215_100000944 327
285 3300002772 JGI25164J39214_1000006 JGI25164J39214_100000683 327
286 3300003751 Ga0055538_1000003 Ga0055538_1000003197 327
287 3300003752 Ga0055539_1000003 Ga0055539_1000003420 327
288 3300003756 Ga0055533_1000005 Ga0055533_1000005420 327
289 3300003759 Ga0055525_1000005 Ga0055525_1000005197 327
290 3300003841 Ga0055541_1000003 Ga0055541_1000003197 327
291 3300005289 Ga0065704_10001681 Ga0065704_100016815 327
292 3300005289 Ga0065704_10005064 Ga0065704_100050644 327
293 3300009036 Ga0105244_10001223 Ga0105244_100012236 327
294 3300009036 Ga0105244_10014503 Ga0105244_100145032 327
295 3300009036 Ga0105244_10052861 Ga0105244_100528612 327
296 3300009092 Ga0105250_10000011 Ga0105250_10000011210 327
297 3300009092 Ga0105250_10001689 Ga0105250_100016892 327
298 3300009092 Ga0105250_10015369 Ga0105250_100153692 327
299 3300013102 Ga0157371_10000134 Ga0157371_100001344 327
300 3300013102 Ga0157371_10016705 Ga0157371_100167058 327
301 3300013102 Ga0157371_10125962 Ga0157371_101259622 327
302 3300013306 Ga0163162_10068629 Ga0163162_100686292 327
303 3300015679 Ga0183366_1001 Ga0183366_10011265 327
304 3300015680 Ga0183370_1001 Ga0183370_10011265 327
305 3300015685 Ga0183369_1001 Ga0183369_10011265 327
306 3300015687 Ga0183368_1001 Ga0183368_10011265 327
307 3300025207 Ga0209760_100005 Ga0209760_100005198 327
308 3300025224 Ga0209784_100001 Ga0209784_1000013175 327
309 3300025225 Ga0209566_100001 Ga0209566_1000013175 327
310 3300025226 Ga0209674_100002 Ga0209674_1000023175 327
311 3300025230 Ga0209563_100002 Ga0209563_1000021710 327
312 3300025231 Ga0207427_100009 Ga0207427_100009198 327
313 3300025233 Ga0209437_100001 Ga0209437_1000011710 327
314 3300025253 Ga0209677_100002 Ga0209677_1000021710 327
315 3300025261 Ga0209233_1000533 Ga0209233_100053317 327
316 3300025711 Ga0207696_1000026 Ga0207696_100002650 327
317 3300025711 Ga0207696_1000277 Ga0207696_100027748 327
318 3300025728 Ga0207655_1000154 Ga0207655_100015471 327
319 3300025728 Ga0207655_1021442 Ga0207655_10214421 327
320 3300025728 Ga0207655_1028533 Ga0207655_10285332 327
321 3300025735 Ga0207713_1000328 Ga0207713_10003284 327
322 3300025735 Ga0207713_1016674 Ga0207713_10166742 327
323 3300027312 Ga0209371_1021097 Ga0209371_10210972 327
324 3300030500 Ga0268256_1023712 Ga0268256_10237122 327
325 3300041405 Ga0439438_004322 Ga0439438_004322_1480_2517 327
326 3300041999 Ga0439433_0009012 Ga0439433_0009012_736_1764 327
327 3300045976 Ga0466967_0230020 Ga0466967_0230020_419_1450 327
328 3300046471 Ga0495650_0000106 Ga0495650_0000106_147753_148766 327
329 3300046530 Ga0495654_0020982 Ga0495654_0020982_569_1582 327
330 3300046660 Ga0495625_0012453 Ga0495625_0012453_2044_3057 327
331 3300046810 Ga0495660_0000004 Ga0495660_0000004_111766_112779 327
332 3300047320 Ga0495672_0000034 Ga0495672_0000034_122917_123954 327
333 3300047446 Ga0495679_000005 Ga0495679_000005_145666_146679 327
334 3300048907 Ga0496104_0000842 Ga0496104_0000842_12728_13747 327
335 3300048907 Ga0496104_0008198 Ga0496104_0008198_2924_3937 327
336 3300048908 Ga0496105_0010044 Ga0496105_0010044_267_1286 327
337 3300048919 Ga0496116_0000074 Ga0496116_0000074_117363_118376 327
338 3300048919 Ga0496116_0018892 Ga0496116_0018892_270_1289 327
339 3300048920 Ga0496117_0003085 Ga0496117_0003085_3284_4303 327
340 3300048920 Ga0496117_0167916 Ga0496117_0167916_229_1242 327
341 3300048921 Ga0496118_0002403 Ga0496118_0002403_8411_9424 327
342 3300048921 Ga0496118_0003617 Ga0496118_0003617_2478_3497 327
343 3300048921 Ga0496118_0004336 Ga0496118_0004336_2908_3921 327
344 3300048921 Ga0496118_0066298 Ga0496118_0066298_309_1328 327
345 3300048922 Ga0496119_0007424 Ga0496119_0007424_6818_7831 327
346 3300048922 Ga0496119_0014397 Ga0496119_0014397_1877_2923 327
347 3300048923 Ga0496120_0000955 Ga0496120_0000955_18100_19146 327
348 3300048923 Ga0496120_0010071 Ga0496120_0010071_4109_5122 327
349 3300048924 Ga0496121_0000787 Ga0496121_0000787_34326_35372 327
350 3300048924 Ga0496121_0001697 Ga0496121_0001697_25024_26043 327
351 3300048925 Ga0496122_0000064 Ga0496122_0000064_128166_129179 327
352 3300048925 Ga0496122_0003410 Ga0496122_0003410_282_1301 327
353 3300048925 Ga0496122_0031578 Ga0496122_0031578_1882_2901 327
354 3300048925 Ga0496122_0055329 Ga0496122_0055329_1584_2630 327
355 3300048926 Ga0496123_0000049 Ga0496123_0000049_110773_111786 327
356 3300048926 Ga0496123_0001213 Ga0496123_0001213_26477_27523 327
357 3300048926 Ga0496123_0001439 Ga0496123_0001439_19181_20200 327
358 3300048926 Ga0496123_0068794 Ga0496123_0068794_132_1178 327
359 3300048927 Ga0496124_0000027 Ga0496124_0000027_103337_104350 327
360 3300048927 Ga0496124_0001072 Ga0496124_0001072_16434_17453 327
361 3300048927 Ga0496124_0006707 Ga0496124_0006707_2369_3406 327
362 3300048928 Ga0496125_0000052 Ga0496125_0000052_14960_15973 327
363 3300048928 Ga0496125_0000999 Ga0496125_0000999_20458_21504 327
364 3300048928 Ga0496125_0003084 Ga0496125_0003084_2820_3839 327
365 3300048928 Ga0496125_0003832 Ga0496125_0003832_5572_6591 327
366 3300048928 Ga0496125_0016399 Ga0496125_0016399_1271_2290 327
367 3300048929 Ga0496126_0000710 Ga0496126_0000710_10312_11325 327
368 3300048929 Ga0496126_0002144 Ga0496126_0002144_16671_17690 327
369 iso_pu_bacteria 2883087390 2883091827 327
370 3300003856 Ga0058692_1000149 Ga0058692_100014911 328
371 3300003856 Ga0058692_1006145 Ga0058692_10061453 328
372 3300003856 Ga0058692_1006170 Ga0058692_10061702 328
373 3300005335 Ga0070666_10024488 Ga0070666_100244883 328
374 3300005356 Ga0070674_100072377 Ga0070674_1000723772 328
375 3300005367 Ga0070667_100022896 Ga0070667_1000228964 328
376 3300005577 Ga0068857_100034858 Ga0068857_1000348586 328
377 3300005841 Ga0068863_100008560 Ga0068863_1000085606 328
378 3300005842 Ga0068858_100006800 Ga0068858_1000068006 328
379 3300005843 Ga0068860_100024216 Ga0068860_1000242164 328
380 3300006353 Ga0075370_10013135 Ga0075370_100131351 328
381 3300006946 Ga0079104_1004722 Ga0079104_10047223 328
382 3300006946 Ga0079104_1005236 Ga0079104_10052364 328
383 3300009011 Ga0105251_10000021 Ga0105251_1000002151 328
384 3300009011 Ga0105251_10000160 Ga0105251_1000016035 328
385 3300009011 Ga0105251_10000245 Ga0105251_1000024526 328
386 3300009011 Ga0105251_10003563 Ga0105251_100035635 328
387 3300009011 Ga0105251_10012247 Ga0105251_100122473 328
388 3300009036 Ga0105244_10002727 Ga0105244_100027272 328
389 3300009036 Ga0105244_10016248 Ga0105244_100162482 328
390 3300009092 Ga0105250_10001341 Ga0105250_100013414 328
391 3300009101 Ga0105247_10000069 Ga0105247_1000006962 328
392 3300009174 Ga0105241_10000011 Ga0105241_1000001179 328
393 3300009174 Ga0105241_10047711 Ga0105241_100477112 328
394 3300009177 Ga0105248_10002548 Ga0105248_100025485 328
395 3300009545 Ga0105237_10007572 Ga0105237_1000757210 328
396 3300009553 Ga0105249_10001344 Ga0105249_100013447 328
397 3300010375 Ga0105239_10030199 Ga0105239_100301993 328
398 3300013100 Ga0157373_10000873 Ga0157373_1000087310 328
399 3300014497 Ga0182008_10004263 Ga0182008_100042632 328
400 3300014968 Ga0157379_10162290 Ga0157379_101622902 328
401 3300017792 Ga0163161_10000005 Ga0163161_1000000592 328
402 3300025294 Ga0209025_1000473 Ga0209025_100047368 328
403 3300025711 Ga0207696_1000039 Ga0207696_1000039203 328
404 3300025728 Ga0207655_1000078 Ga0207655_100007829 328
405 3300025735 Ga0207713_1000003 Ga0207713_1000003263 328
406 3300025735 Ga0207713_1000095 Ga0207713_100009531 328
407 3300025735 Ga0207713_1000248 Ga0207713_100024835 328
408 3300025735 Ga0207713_1002906 Ga0207713_10029063 328
409 3300025735 Ga0207713_1011322 Ga0207713_10113223 328
410 3300025900 Ga0207710_10000026 Ga0207710_10000026184 328
411 3300025901 Ga0207688_10033411 Ga0207688_100334113 328
412 3300025903 Ga0207680_10018223 Ga0207680_100182232 328
413 3300025911 Ga0207654_10000012 Ga0207654_1000001279 328
414 3300025911 Ga0207654_10068063 Ga0207654_100680631 328
415 3300025914 Ga0207671_10009974 Ga0207671_100099745 328
416 3300025933 Ga0207706_10254025 Ga0207706_102540252 328
417 3300025941 Ga0207711_10003317 Ga0207711_100033179 328
418 3300025961 Ga0207712_10013984 Ga0207712_100139841 328
419 3300026035 Ga0207703_10014410 Ga0207703_100144104 328
420 3300026089 Ga0207648_10321404 Ga0207648_103214042 328
421 3300026116 Ga0207674_10060993 Ga0207674_100609934 328
422 3300027111 Ga0209281_1000315 Ga0209281_100031534 328
423 3300027111 Ga0209281_1009118 Ga0209281_10091182 328
424 3300027312 Ga0209371_1000002 Ga0209371_1000002326 328
425 3300027312 Ga0209371_1000041 Ga0209371_1000041305 328
426 3300027312 Ga0209371_1000109 Ga0209371_10001092 328
427 3300027312 Ga0209371_1001442 Ga0209371_10014423 328
428 3300030500 Ga0268256_1000002 Ga0268256_10000021138 328
429 3300030500 Ga0268256_1000003 Ga0268256_10000031129 328
430 3300030500 Ga0268256_1001218 Ga0268256_100121810 328
431 3300030500 Ga0268256_1017467 Ga0268256_10174671 328
432 3300037312 Ga0395899_0004268 Ga0395899_0004268_13_1050 328
433 3300037466 Ga0395898_0158943 Ga0395898_0158943_125_1162 328
434 3300038443 Ga0395901_0274573 Ga0395901_0274573_383_1420 328
435 3300046453 Ga0495627_000311 Ga0495627_000311_46375_47418 328
436 3300046530 Ga0495654_0000574 Ga0495654_0000574_17652_18695 328
437 3300046535 Ga0495586_0031862 Ga0495586_0031862_669_1766 328
438 3300046615 Ga0495656_0081327 Ga0495656_0081327_413_1447 328
439 3300046794 Ga0495589_0000032 Ga0495589_0000032_89697_90740 328
440 3300047673 Ga0495593_0169704 Ga0495593_0169704_20_1054 328
441 3300048905 Ga0496102_0416878 Ga0496102_0416878_54_1088 328
442 3300048907 Ga0496104_0201365 Ga0496104_0201365_790_1887 328
443 3300048911 Ga0496108_0015356 Ga0496108_0015356_4642_5739 328
444 3300048913 Ga0496110_0038433 Ga0496110_0038433_2306_3403 328
445 3300048914 Ga0496111_0022644 Ga0496111_0022644_1996_3093 328
446 3300048919 Ga0496116_0000007 Ga0496116_0000007_596868_597911 328
447 3300048919 Ga0496116_0002467 Ga0496116_0002467_7095_8129 328
448 3300048920 Ga0496117_0004070 Ga0496117_0004070_3672_4715 328
449 3300048920 Ga0496117_0082739 Ga0496117_0082739_374_1417 328
450 3300048921 Ga0496118_0011894 Ga0496118_0011894_3653_4696 328
451 3300048922 Ga0496119_0010045 Ga0496119_0010045_5278_6312 328
452 3300048922 Ga0496119_0010071 Ga0496119_0010071_1620_2654 328
453 3300048923 Ga0496120_0000494 Ga0496120_0000494_11956_12990 328
454 3300048923 Ga0496120_0000636 Ga0496120_0000636_38403_39437 328
455 3300048925 Ga0496122_0016310 Ga0496122_0016310_660_1703 328
456 3300048926 Ga0496123_0000522 Ga0496123_0000522_52694_53737 328
457 3300048927 Ga0496124_0000049 Ga0496124_0000049_78744_79778 328
458 3300050489 nmdc:mga03683_2489_c1 nmdc:mga03683_2489_c1_594_1628 328
459 3300050493 nmdc:mga0k408_136231_c1 nmdc:mga0k408_136231_c1_257_1297 328
460 3300050496 nmdc:mga07m45_4434_c1 nmdc:mga07m45_4434_c1_831_1871 328
461 3300050496 nmdc:mga07m45_4932_c1 nmdc:mga07m45_4932_c1_101_1135 328
462 iso_pu_bacteria 2869551831 2869555737 328
463 iso_pu_bacteria 2888366609 2888370378 328
464 iso_pu_bacteria 640753048 640939115 328
465 iso_pu_bacteria 8015394850 8015395725 328
466 2162886007 SwRhRL2b_contig_107088 SwRhRL2b_0104.00000880 329
467 3300003320 rootH2_10003480 rootH2_100034802 329
468 3300003856 Ga0058692_1000984 Ga0058692_10009848 329
469 3300005289 Ga0065704_10000324 Ga0065704_100003246 329
470 3300005289 Ga0065704_10002407 Ga0065704_1000240713 329
471 3300005548 Ga0070665_100000973 Ga0070665_10000097311 329
472 3300005577 Ga0068857_100117034 Ga0068857_1001170342 329
473 3300006051 Ga0075364_10006954 Ga0075364_100069546 329
474 3300006946 Ga0079104_1000205 Ga0079104_100020518 329
475 3300006946 Ga0079104_1001107 Ga0079104_10011079 329
476 3300006946 Ga0079104_1001289 Ga0079104_10012898 329
477 3300006946 Ga0079104_1001964 Ga0079104_10019648 329
478 3300006946 Ga0079104_1004831 Ga0079104_10048314 329
479 3300009011 Ga0105251_10001984 Ga0105251_100019848 329
480 3300009036 Ga0105244_10000014 Ga0105244_10000014127 329
481 3300009036 Ga0105244_10000015 Ga0105244_10000015215 329
482 3300009036 Ga0105244_10000174 Ga0105244_1000017444 329
483 3300009036 Ga0105244_10001119 Ga0105244_100011192 329
484 3300009092 Ga0105250_10000264 Ga0105250_100002649 329
485 3300009092 Ga0105250_10000315 Ga0105250_1000031510 329
486 3300009092 Ga0105250_10008977 Ga0105250_100089773 329
487 3300013100 Ga0157373_10079886 Ga0157373_100798862 329
488 3300013104 Ga0157370_10000582 Ga0157370_1000058231 329
489 3300013104 Ga0157370_10004434 Ga0157370_1000443410 329
490 3300015261 Ga0182006_1000524 Ga0182006_100052424 329
491 3300021361 Ga0213872_10018224 Ga0213872_100182242 329
492 3300021384 Ga0213876_10000114 Ga0213876_1000011415 329
493 3300025711 Ga0207696_1000295 Ga0207696_100029527 329
494 3300025711 Ga0207696_1000432 Ga0207696_100043227 329
495 3300025728 Ga0207655_1000001 Ga0207655_10000011305 329
496 3300025728 Ga0207655_1000009 Ga0207655_1000009493 329
497 3300025728 Ga0207655_1000029 Ga0207655_1000029376 329
498 3300025728 Ga0207655_1000061 Ga0207655_1000061215 329
499 3300025728 Ga0207655_1000063 Ga0207655_1000063127 329
500 3300025728 Ga0207655_1001411 Ga0207655_10014118 329
501 3300025735 Ga0207713_1000029 Ga0207713_1000029136 329
502 3300026116 Ga0207674_10117141 Ga0207674_101171412 329
503 3300027111 Ga0209281_1000004 Ga0209281_10000041137 329
504 3300027111 Ga0209281_1000006 Ga0209281_10000061002 329
505 3300027111 Ga0209281_1000024 Ga0209281_1000024407 329
506 3300027111 Ga0209281_1000402 Ga0209281_100040250 329
507 3300027111 Ga0209281_1000627 Ga0209281_100062741 329
508 3300027111 Ga0209281_1001069 Ga0209281_10010698 329
509 3300027312 Ga0209371_1000187 Ga0209371_100018772 329
510 3300027312 Ga0209371_1002178 Ga0209371_100217810 329
511 3300028379 Ga0268266_10024950 Ga0268266_100249506 329
512 3300030500 Ga0268256_1000156 Ga0268256_100015616 329
513 3300030500 Ga0268256_1001895 Ga0268256_10018953 329
514 3300039437 Ga0436365_0454988 Ga0436365_0454988_94615_95640 329
515 3300039447 Ga0436361_0548101 Ga0436361_0548101_267_1286 329
516 3300039447 Ga0436361_1160404 Ga0436361_1160404_512_1531 329
517 3300041405 Ga0439438_013867 Ga0439438_013867_979_1998 329
518 3300042010 Ga0439452_000002 Ga0439452_000002_1177280_1178299 329
519 3300042010 Ga0439452_000280 Ga0439452_000280_8466_9485 329
520 3300044669 Ga0466981_0000027 Ga0466981_0000027_18183_19217 329
521 3300046458 Ga0495591_000003 Ga0495591_000003_391501_392520 329
522 3300046458 Ga0495591_004807 Ga0495591_004807_1947_2966 329
523 3300046460 Ga0495638_0000890 Ga0495638_0000890_26282_27301 329
524 3300046471 Ga0495650_0000005 Ga0495650_0000005_567547_568566 329
525 3300046515 Ga0495620_0009240 Ga0495620_0009240_4052_5110 329
526 3300046530 Ga0495654_0038016 Ga0495654_0038016_920_1966 329
527 3300046694 Ga0495649_0000229 Ga0495649_0000229_26475_27494 329
528 3300046694 Ga0495649_0000261 Ga0495649_0000261_19498_20556 329
529 3300047446 Ga0495679_000484 Ga0495679_000484_12980_14038 329
530 3300047446 Ga0495679_027411 Ga0495679_027411_647_1666 329
531 3300047469 Ga0495673_0000070 Ga0495673_0000070_15880_16926 329
532 3300048919 Ga0496116_0004357 Ga0496116_0004357_7863_8882 329
533 3300048919 Ga0496116_0030629 Ga0496116_0030629_2723_3742 329
534 3300048920 Ga0496117_0000020 Ga0496117_0000020_338345_339364 329
535 3300048920 Ga0496117_0128105 Ga0496117_0128105_60_1079 329
536 3300048921 Ga0496118_0000015 Ga0496118_0000015_353554_354573 329
537 3300048921 Ga0496118_0047201 Ga0496118_0047201_1226_2245 329
538 3300048921 Ga0496118_0062053 Ga0496118_0062053_554_1573 329
539 3300048922 Ga0496119_0007646 Ga0496119_0007646_7334_8353 329
540 3300048922 Ga0496119_0099221 Ga0496119_0099221_13_1032 329
541 3300048923 Ga0496120_0010912 Ga0496120_0010912_1516_2535 329
542 3300048923 Ga0496120_0022890 Ga0496120_0022890_75_1094 329
543 3300048924 Ga0496121_0002591 Ga0496121_0002591_7796_8815 329
544 3300048924 Ga0496121_0006868 Ga0496121_0006868_11443_12462 329
545 3300048924 Ga0496121_0018360 Ga0496121_0018360_430_1449 329
546 3300048924 Ga0496121_0030879 Ga0496121_0030879_1268_2287 329
547 3300048925 Ga0496122_0000005 Ga0496122_0000005_228007_229026 329
548 3300048925 Ga0496122_0000409 Ga0496122_0000409_63540_64565 329
549 3300048925 Ga0496122_0004947 Ga0496122_0004947_7766_8785 329
550 3300048926 Ga0496123_0000008 Ga0496123_0000008_401603_402622 329
551 3300048926 Ga0496123_0000334 Ga0496123_0000334_24442_25467 329
552 3300048926 Ga0496123_0003141 Ga0496123_0003141_14811_15830 329
553 3300048926 Ga0496123_0003921 Ga0496123_0003921_7373_8392 329
554 3300048926 Ga0496123_0004444 Ga0496123_0004444_13053_14072 329
555 3300048927 Ga0496124_0000162 Ga0496124_0000162_42705_43724 329
556 3300048927 Ga0496124_0002873 Ga0496124_0002873_16351_17370 329
557 3300048927 Ga0496124_0079478 Ga0496124_0079478_171_1190 329
558 3300048928 Ga0496125_0064617 Ga0496125_0064617_1545_2564 329
559 3300048929 Ga0496126_0078019 Ga0496126_0078019_478_1497 329
560 3300048929 Ga0496126_0081895 Ga0496126_0081895_1762_2781 329
561 3300048929 Ga0496126_0118123 Ga0496126_0118123_966_1985 329
562 3300048929 Ga0496126_0182789 Ga0496126_0182789_266_1285 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

53

163

0.98

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

201

326

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ilk-assembly1.cif.gz_B crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.9729 1 327
4ilk-assembly1.cif.gz_A crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.9728 1 327
4ilk-assembly1.cif.gz_A crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.9641 1 327
4ilk-assembly1.cif.gz_B crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.9641 1 327
1pl6-assembly1.cif.gz_A human sdh/nadh/inhibitor complex 0.9313 2 328
ID Description Score Start End Superfamily
af_P38105_152_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.994 143 272 3.40.50.720
af_P38105_152_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.979 143 272 3.40.50.720
af_P38105_1_147_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9782 1 136 3.90.180.10
1lluA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9246 135 272 3.40.50.720
af_Q2G2C5_144_285_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9233 135 272 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A773SBV1-F1-model_v4 deleted 0.9849 156 299
AF-A0A773SBV1-F1-model_v4 deleted 0.965 156 299
AF-W1HT28-F1-model_v4 deleted 0.9638 1 279
AF-A0A436H8P5-F1-model_v4 Zn-dependent oxidoreductase 0.9601 1 328 GO:0008270
GO:0016616
AF-A0A436H8P5-F1-model_v4 Zn-dependent oxidoreductase 0.9544 1 328 GO:0008270
GO:0016616

Feature Viewer

pLDDT pTM Quality
91.25 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map