F463919

General Info

Members Datasets Scaffolds Average Seq Length
562 237 1124 269

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100047252|Ga0075430_1000472524
Length 300
Sequence MVTGSWLQISDLGEPENPGTGERQGLEMSNHFDKVQETATWLRQRIPDPPDVAVVLGSGLGDFASTLKAAKTFEYGSMPNWPASAVIGHAGQLVVGMLGSKRVAALSGRVHYYEGHDMRTVTFATRVIGVLGVRTIILTNAAGGINLSFKPGTLMVMDDHINLMGSNPLVGANDERFGPRFPDMSEVYSARLRQVTAAVAARQQLELAHGVYVALHGPSYETPAEIRYLRTIGADAVGMSTVPEAIVARHMQLDVLGISCITNMAAGVLPQPLVHDEVMEVARRVRVRFGALLEGVIGQV

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
155 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
158 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
209 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
210 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0
Rhizoplane 2.85
Rhizosphere 94.66
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100047252 3300006846 Bacteria 3633
2 JGI25406J46586_10000255 3300003203 Bacteria 23756
3 JGI25406J46586_10001663 3300003203 Bacteria 10503
4 Ga0065712_10011391 3300005290 Bacteria 2408
5 Ga0065712_10012408 3300005290 Bacteria 3175
6 Ga0065712_10021936 3300005290 Bacteria 2168
7 Ga0065712_10069800 3300005290 Bacteria 6683
8 Ga0065712_10137001 3300005290 Bacteria 1487
9 Ga0065715_10015226 3300005293 Bacteria 1969
10 Ga0065715_10100318 3300005293 Bacteria 3317
11 Ga0065715_10239931 3300005293 Bacteria 1203
12 Ga0065707_10015338 3300005295 Bacteria 2335
13 Ga0065707_10017233 3300005295 Bacteria 1828
14 Ga0065707_10151181 3300005295 Bacteria 1656
15 Ga0065707_10209743 3300005295 Bacteria 1271
16 Ga0070676_10107679 3300005328 Bacteria 1731
17 Ga0070676_10266983 3300005328 Unclassified 1148
18 Ga0070690_100038006 3300005330 Bacteria 3036
19 Ga0070690_100057756 3300005330 Bacteria 2491
20 Ga0070690_100059814 3300005330 Bacteria 2450
21 Ga0070670_100004928 3300005331 Bacteria 11236
22 Ga0070670_100007124 3300005331 Bacteria 9469
23 Ga0070670_100011553 3300005331 Bacteria 7551
24 Ga0070670_100035107 3300005331 Bacteria 4316
25 Ga0070677_10015666 3300005333 Bacteria 2687
26 Ga0070666_10033652 3300005335 Bacteria 3392
27 Ga0070666_10070080 3300005335 Bacteria 2385
28 Ga0068868_100464260 3300005338 Bacteria 1103
29 Ga0070691_10047847 3300005341 Bacteria 2034
30 Ga0070692_10307258 3300005345 Bacteria 970
31 Ga0070668_100136435 3300005347 Bacteria 1974
32 Ga0070668_100170244 3300005347 Bacteria 1773
33 Ga0070669_100000449 3300005353 Bacteria 31407
34 Ga0070669_100110630 3300005353 Bacteria 2084
35 Ga0070669_100145860 3300005353 Bacteria 1829
36 Ga0070675_100006767 3300005354 Bacteria 8809
37 Ga0070675_100030628 3300005354 Bacteria 4345
38 Ga0070675_100050936 3300005354 Bacteria 3401
39 Ga0070675_100240314 3300005354 Bacteria 1582
40 Ga0070671_100033807 3300005355 Bacteria 4231
41 Ga0070671_100069343 3300005355 Unclassified 2941
42 Ga0070671_100077659 3300005355 Bacteria 2775
43 Ga0070674_100007026 3300005356 Bacteria 6616
44 Ga0070674_100166475 3300005356 Bacteria 1677
45 Ga0070673_100180196 3300005364 Bacteria 1808
46 Ga0070688_100227183 3300005365 Bacteria 1318
47 Ga0070659_100140145 3300005366 Bacteria 1969
48 Ga0070659_100237891 3300005366 Bacteria 1506
49 Ga0070701_10019641 3300005438 Bacteria 3195
50 Ga0070701_10027972 3300005438 Bacteria 2768
51 Ga0070705_100001158 3300005440 Bacteria 14489
52 Ga0070705_100055534 3300005440 Bacteria 2328
53 Ga0070705_100239749 3300005440 Unclassified 1267
54 Ga0070700_100127201 3300005441 Bacteria 1715
55 Ga0070694_100097598 3300005444 Bacteria 2073
56 Ga0070694_100111607 3300005444 Bacteria 1948
57 Ga0070694_100386035 3300005444 Bacteria 1093
58 Ga0070708_100070155 3300005445 Bacteria 3152
59 Ga0070663_100566849 3300005455 Bacteria 951
60 Ga0070678_100344677 3300005456 Unclassified 1279
61 Ga0070662_100420779 3300005457 Bacteria 1105
62 Ga0070681_10184165 3300005458 Bacteria 2009
63 Ga0068867_100042603 3300005459 Bacteria 3321
64 Ga0068867_100179683 3300005459 Bacteria 1681
65 Ga0070698_100001720 3300005471 Bacteria 24404
66 Ga0070698_100054958 3300005471 Bacteria 4040
67 Ga0070698_100197188 3300005471 Bacteria 1950
68 Ga0070699_100004150 3300005518 Bacteria 12803
69 Ga0070699_100016310 3300005518 Bacteria 6379
70 Ga0070699_100041472 3300005518 Bacteria 3984
71 Ga0070699_100067586 3300005518 Bacteria 3104
72 Ga0070699_100081403 3300005518 Bacteria 2822
73 Ga0070699_100133264 3300005518 Bacteria 2191
74 Ga0070699_100152556 3300005518 Bacteria 2044
75 Ga0070684_100068804 3300005535 Bacteria 3113
76 Ga0070697_100024964 3300005536 Bacteria 4763
77 Ga0070697_100080139 3300005536 Bacteria 2689
78 Ga0070672_100013169 3300005543 Bacteria 5833
79 Ga0070672_100026948 3300005543 Bacteria 4284
80 Ga0070672_100358685 3300005543 Bacteria 1244
81 Ga0070686_100000672 3300005544 Bacteria 19954
82 Ga0070686_100167128 3300005544 Bacteria 1553
83 Ga0070686_100378094 3300005544 Bacteria 1071
84 Ga0070686_100501845 3300005544 Bacteria 942
85 Ga0070695_100000008 3300005545 Bacteria 88588
86 Ga0070695_100001631 3300005545 Bacteria 12590
87 Ga0070695_100043919 3300005545 Bacteria 2843
88 Ga0070695_100047565 3300005545 Bacteria 2740
89 Ga0070696_100002395 3300005546 Bacteria 12412
90 Ga0070696_100008410 3300005546 Bacteria 6905
91 Ga0070693_100016073 3300005547 Bacteria 3866
92 Ga0070693_100145127 3300005547 Bacteria 1498
93 Ga0070665_100028891 3300005548 Bacteria 5582
94 Ga0070665_100181261 3300005548 Bacteria 2107
95 Ga0070665_100312749 3300005548 Bacteria 1575
96 Ga0070704_100017048 3300005549 Bacteria 4608
97 Ga0070704_100018815 3300005549 Bacteria 4426
98 Ga0070704_100053687 3300005549 Bacteria 2849
99 Ga0070704_100056445 3300005549 Bacteria 2788
100 Ga0070704_100163314 3300005549 Bacteria 1763
101 Ga0070704_100325830 3300005549 Bacteria 1289
102 Ga0070664_100013747 3300005564 Bacteria 6597
103 Ga0070664_100022349 3300005564 Bacteria 5215
104 Ga0068857_100033902 3300005577 Bacteria 4517
105 Ga0068854_100170820 3300005578 Bacteria 1692
106 Ga0068854_100297877 3300005578 Bacteria 1304
107 Ga0068852_100222395 3300005616 Bacteria 1796
108 Ga0068859_100029596 3300005617 Bacteria 5496
109 Ga0068859_100455315 3300005617 Bacteria 1376
110 Ga0068864_100003763 3300005618 Bacteria 12518
111 Ga0068864_100180450 3300005618 Unclassified 1930
112 Ga0068864_100272852 3300005618 Bacteria 1576
113 Ga0068866_10047737 3300005718 Bacteria 2160
114 Ga0068861_100145260 3300005719 Bacteria 1941
115 Ga0068861_100151235 3300005719 Bacteria 1905
116 Ga0068861_100536161 3300005719 Bacteria 1064
117 Ga0068851_10091842 3300005834 Bacteria 1599
118 Ga0068870_10024155 3300005840 Bacteria 3005
119 Ga0068863_100046011 3300005841 Bacteria 4142
120 Ga0068863_100141128 3300005841 Bacteria 2302
121 Ga0068858_100203844 3300005842 Bacteria 1871
122 Ga0068858_100753601 3300005842 Bacteria 949
123 Ga0068860_100246976 3300005843 Bacteria 1737
124 Ga0068860_100605908 3300005843 Bacteria 1101
125 Ga0068862_100012816 3300005844 Bacteria 6935
126 Ga0068862_100093138 3300005844 Bacteria 2627
127 Ga0081539_10000108 3300005985 Bacteria 195322
128 Ga0081539_10000743 3300005985 Bacteria 65081
129 Ga0081539_10031814 3300005985 Bacteria 3245
130 Ga0075365_10013229 3300006038 Bacteria 4925
131 Ga0075364_10001075 3300006051 Bacteria 14555
132 Ga0075367_10010682 3300006178 Bacteria 4833
133 Ga0075367_10066750 3300006178 Bacteria 2156
134 Ga0075366_10032302 3300006195 Bacteria 3081
135 Ga0075370_10033126 3300006353 Bacteria 2892
136 Ga0068871_100248404 3300006358 Bacteria 1549
137 Ga0068871_100374841 3300006358 Bacteria 1263
138 Ga0068871_100423446 3300006358 Bacteria 1189
139 Ga0075428_100000903 3300006844 Bacteria 31327
140 Ga0075428_100001333 3300006844 Bacteria 26179
141 Ga0075428_100002195 3300006844 Bacteria 21120
142 Ga0075428_100003841 3300006844 Bacteria 16495
143 Ga0075428_100013297 3300006844 Bacteria 9156
144 Ga0075428_100017035 3300006844 Bacteria 8028
145 Ga0075428_100348901 3300006844 Unclassified 1588
146 Ga0075428_100530015 3300006844 Bacteria 1259
147 Ga0075430_100001150 3300006846 Bacteria 21108
148 Ga0075430_100003201 3300006846 Bacteria 13712
149 Ga0075430_100012048 3300006846 Bacteria 7359
150 Ga0075430_100014765 3300006846 Bacteria 6651
151 Ga0075430_100068508 3300006846 Bacteria 2977
152 Ga0075430_100178561 3300006846 Bacteria 1766
153 Ga0075431_100002132 3300006847 Bacteria 18915
154 Ga0075431_100015285 3300006847 Bacteria 7778
155 Ga0075431_100018287 3300006847 Bacteria 7131
156 Ga0075431_100022962 3300006847 Bacteria 6376
157 Ga0075431_100049432 3300006847 Bacteria 4335
158 Ga0075431_100121071 3300006847 Bacteria 2700
159 Ga0075431_100132271 3300006847 Bacteria 2573
160 Ga0075431_100185565 3300006847 Bacteria 2133
161 Ga0075431_100211443 3300006847 Bacteria 1981
162 Ga0075431_100253618 3300006847 Bacteria 1787
163 Ga0075433_10060970 3300006852 Bacteria 3305
164 Ga0075433_10089717 3300006852 Bacteria 2717
165 Ga0075433_10169597 3300006852 Bacteria 1942
166 Ga0075433_10176204 3300006852 Bacteria 1903
167 Ga0075434_100008592 3300006871 Bacteria 9505
168 Ga0075434_100014800 3300006871 Bacteria 7466
169 Ga0075434_100017255 3300006871 Bacteria 6952
170 Ga0075434_100019783 3300006871 Bacteria 6518
171 Ga0075434_100047641 3300006871 Bacteria 4254
172 Ga0075434_100295846 3300006871 Bacteria 1639
173 Ga0075429_100001542 3300006880 Bacteria 18882
174 Ga0075429_100012005 3300006880 Bacteria 7510
175 Ga0075429_100012550 3300006880 Bacteria 7350
176 Ga0075429_100013433 3300006880 Bacteria 7101
177 Ga0075429_100052249 3300006880 Bacteria 3555
178 Ga0075429_100075631 3300006880 Bacteria 2933
179 Ga0075429_100080465 3300006880 Bacteria 2840
180 Ga0075429_100287986 3300006880 Bacteria 1438
181 Ga0068865_100095010 3300006881 Bacteria 2171
182 Ga0068865_100139916 3300006881 Unclassified 1824
183 Ga0075436_100036552 3300006914 Bacteria 3389
184 Ga0097620_100029596 3300006931 Bacteria 5496
185 Ga0097620_100455303 3300006931 Bacteria 1376
186 Ga0075435_100019938 3300007076 Bacteria 5126
187 Ga0075435_100023795 3300007076 Bacteria 4745
188 Ga0075435_100051172 3300007076 Bacteria 3327
189 Ga0075435_100057689 3300007076 Bacteria 3142
190 Ga0075435_100126415 3300007076 Bacteria 2137
191 Ga0075435_100288445 3300007076 Bacteria 1402
192 Ga0105240_10088121 3300009093 Bacteria 3799
193 Ga0111539_10001010 3300009094 Bacteria 36883
194 Ga0111539_10001112 3300009094 Bacteria 35521
195 Ga0111539_10004654 3300009094 Bacteria 17933
196 Ga0111539_10010186 3300009094 Bacteria 11846
197 Ga0111539_10011236 3300009094 Bacteria 11248
198 Ga0111539_10056372 3300009094 Bacteria 4670
199 Ga0111539_10063813 3300009094 Bacteria 4358
200 Ga0111539_10134610 3300009094 Bacteria 2894
201 Ga0111539_10501339 3300009094 Bacteria 1414
202 Ga0111539_10514535 3300009094 Bacteria 1394
203 Ga0111539_10645804 3300009094 Bacteria 1232
204 Ga0105245_10650342 3300009098 Bacteria 1084
205 Ga0114129_10000365 3300009147 Bacteria 52392
206 Ga0114129_10001867 3300009147 Bacteria 28697
207 Ga0114129_10002447 3300009147 Bacteria 25785
208 Ga0114129_10003868 3300009147 Bacteria 21115
209 Ga0114129_10010349 3300009147 Bacteria 13301
210 Ga0114129_10011576 3300009147 Bacteria 12560
211 Ga0114129_10013583 3300009147 Bacteria 11604
212 Ga0114129_10055882 3300009147 Bacteria 5532
213 Ga0114129_10063353 3300009147 Bacteria 5163
214 Ga0114129_10102583 3300009147 Bacteria 3956
215 Ga0114129_10148643 3300009147 Bacteria 3208
216 Ga0114129_10199880 3300009147 Bacteria 2708
217 Ga0114129_10310641 3300009147 Bacteria 2099
218 Ga0114129_10330613 3300009147 Bacteria 2024
219 Ga0114129_10490406 3300009147 Bacteria 1606
220 Ga0114129_10541826 3300009147 Bacteria 1514
221 Ga0105243_10155607 3300009148 Bacteria 1965
222 Ga0105243_10206815 3300009148 Bacteria 1725
223 Ga0105243_10921203 3300009148 Bacteria 871
224 Ga0105241_10633069 3300009174 Bacteria 970
225 Ga0105248_10008326 3300009177 Bacteria 11395
226 Ga0105248_10008629 3300009177 Bacteria 11196
227 Ga0105248_10452359 3300009177 Bacteria 1447
228 Ga0105249_10250452 3300009553 Bacteria 1756
229 Ga0105249_10536394 3300009553 Unclassified 1219
230 Ga0157378_10481051 3300013297 Bacteria 1237
231 Ga0163162_10074570 3300013306 Bacteria 3452
232 Ga0157375_10078147 3300013308 Bacteria 3341
233 Ga0157375_10309105 3300013308 Bacteria 1745
234 Ga0157375_10552923 3300013308 Bacteria 1313
235 Ga0163163_10205539 3300014325 Bacteria 2017
236 Ga0157380_10006766 3300014326 Bacteria 8103
237 Ga0157380_10018649 3300014326 Bacteria 5154
238 Ga0157380_10142913 3300014326 Bacteria 2058
239 Ga0157380_10169110 3300014326 Bacteria 1908
240 Ga0157380_10249809 3300014326 Bacteria 1605
241 Ga0157380_10828578 3300014326 Unclassified 945
242 Ga0157377_10055485 3300014745 Bacteria 2247
243 Ga0163161_10087123 3300017792 Bacteria 2306
244 Ga0207697_10016614 3300025315 Bacteria 3031
245 Ga0207682_10003879 3300025893 Bacteria 6395
246 Ga0207682_10017904 3300025893 Bacteria 2766
247 Ga0207688_10010391 3300025901 Bacteria 5065
248 Ga0207680_10017828 3300025903 Bacteria 3759
249 Ga0207645_10009883 3300025907 Bacteria 6575
250 Ga0207645_10089974 3300025907 Bacteria 1974
251 Ga0207705_10242216 3300025909 Bacteria 1374
252 Ga0207695_10103099 3300025913 Bacteria 2845
253 Ga0207695_10322200 3300025913 Bacteria 1435
254 Ga0207662_10124089 3300025918 Bacteria 1622
255 Ga0207649_10450818 3300025920 Bacteria 971
256 Ga0207646_10096988 3300025922 Bacteria 2641
257 Ga0207646_10393333 3300025922 Bacteria 1252
258 Ga0207646_10574986 3300025922 Bacteria 1012
259 Ga0207681_10042479 3300025923 Bacteria 3037
260 Ga0207681_10145899 3300025923 Bacteria 1768
261 Ga0207681_10158446 3300025923 Bacteria 1703
262 Ga0207681_10394762 3300025923 Bacteria 1116
263 Ga0207650_10013445 3300025925 Bacteria 5667
264 Ga0207659_10001200 3300025926 Bacteria 15456
265 Ga0207659_10009770 3300025926 Bacteria 6001
266 Ga0207659_10127607 3300025926 Bacteria 1958
267 Ga0207659_10225364 3300025926 Bacteria 1509
268 Ga0207659_10229896 3300025926 Bacteria 1495
269 Ga0207706_10029688 3300025933 Bacteria 4880
270 Ga0207706_10107568 3300025933 Bacteria 2454
271 Ga0207706_10143679 3300025933 Bacteria 2099
272 Ga0207706_10432332 3300025933 Bacteria 1140
273 Ga0207706_10491413 3300025933 Bacteria 1060
274 Ga0207686_10002304 3300025934 Bacteria 10456
275 Ga0207709_10047083 3300025935 Bacteria 2620
276 Ga0207669_10000506 3300025937 Bacteria 17008
277 Ga0207669_10035790 3300025937 Bacteria 2829
278 Ga0207669_10184431 3300025937 Bacteria 1499
279 Ga0207669_10192748 3300025937 Unclassified 1472
280 Ga0207669_10226754 3300025937 Bacteria 1376
281 Ga0207704_10068978 3300025938 Bacteria 2232
282 Ga0207704_10198269 3300025938 Bacteria 1467
283 Ga0207691_10013787 3300025940 Bacteria 7722
284 Ga0207691_10023853 3300025940 Bacteria 5758
285 Ga0207691_10031177 3300025940 Bacteria 4978
286 Ga0207691_10073054 3300025940 Bacteria 3093
287 Ga0207711_10057083 3300025941 Bacteria 3356
288 Ga0207711_10081971 3300025941 Bacteria 2820
289 Ga0207711_10125870 3300025941 Bacteria 2292
290 Ga0207711_10381889 3300025941 Bacteria 1307
291 Ga0207661_10012964 3300025944 Bacteria 6082
292 Ga0207679_10041051 3300025945 Bacteria 3316
293 Ga0207679_10214145 3300025945 Unclassified 1617
294 Ga0207679_10303804 3300025945 Bacteria 1376
295 Ga0207679_10440204 3300025945 Bacteria 1154
296 Ga0207651_10019234 3300025960 Bacteria 4086
297 Ga0207651_10148305 3300025960 Bacteria 1822
298 Ga0207651_10287488 3300025960 Bacteria 1362
299 Ga0207712_10089841 3300025961 Bacteria 2259
300 Ga0207668_10394583 3300025972 Bacteria 1168
301 Ga0207640_10151057 3300025981 Bacteria 1706
302 Ga0207640_10296056 3300025981 Bacteria 1278
303 Ga0207677_10067555 3300026023 Bacteria 2505
304 Ga0207703_10694169 3300026035 Bacteria 968
305 Ga0207708_10250478 3300026075 Bacteria 1427
306 Ga0207641_10023020 3300026088 Bacteria 5132
307 Ga0207641_10400726 3300026088 Bacteria 1317
308 Ga0207648_10095949 3300026089 Bacteria 2595
309 Ga0207648_10120723 3300026089 Bacteria 2304
310 Ga0207676_10037997 3300026095 Bacteria 3673
311 Ga0207674_10123370 3300026116 Bacteria 2556
312 Ga0207675_100041082 3300026118 Bacteria 4319
313 Ga0207675_100068171 3300026118 Bacteria 3326
314 Ga0207675_100109794 3300026118 Bacteria 2603
315 Ga0207675_100216996 3300026118 Bacteria 1842
316 Ga0207675_100319763 3300026118 Bacteria 1515
317 Ga0207675_100391184 3300026118 Bacteria 1369
318 Ga0207675_100466520 3300026118 Bacteria 1253
319 Ga0207675_100787952 3300026118 Bacteria 963
320 Ga0207683_10226401 3300026121 Bacteria 1705
321 Ga0207428_10000910 3300027907 Bacteria 33053
322 Ga0207428_10001673 3300027907 Bacteria 22926
323 Ga0207428_10003635 3300027907 Bacteria 14865
324 Ga0268266_10360189 3300028379 Bacteria 1368
325 Ga0268265_10009043 3300028380 Bacteria 6737
326 Ga0268265_10022920 3300028380 Bacteria 4394
327 Ga0268265_10324039 3300028380 Bacteria 1397
328 Ga0268265_10406400 3300028380 Unclassified 1260
329 Ga0268265_10553735 3300028380 Bacteria 1092
330 Ga0268264_10292370 3300028381 Bacteria 1530
331 Ga0265338_10154548 3300028800 Bacteria 1779
332 Ga0307511_10129598 3300030521 Bacteria 1525
333 Ga0265327_10001617 3300031251 Bacteria 27249
334 Ga0307408_100008676 3300031548 Bacteria 6712
335 Ga0307408_100023713 3300031548 Bacteria 4183
336 Ga0307408_100030838 3300031548 Bacteria 3726
337 Ga0307408_100047126 3300031548 Bacteria 3085
338 Ga0307408_100115011 3300031548 Bacteria 2074
339 Ga0307408_100161382 3300031548 Bacteria 1781
340 Ga0265314_10038196 3300031711 Bacteria 3472
341 Ga0316578_10164735 3300031728 Bacteria 1336
342 Ga0307405_10000780 3300031731 Bacteria 12489
343 Ga0307405_10042793 3300031731 Bacteria 2759
344 Ga0307405_10241608 3300031731 Bacteria 1338
345 Ga0307413_10055279 3300031824 Bacteria 2414
346 Ga0307410_10008076 3300031852 Bacteria 5814
347 Ga0307410_10218150 3300031852 Bacteria 1466
348 Ga0307406_10055066 3300031901 Bacteria 2541
349 Ga0307406_10060030 3300031901 Bacteria 2451
350 Ga0307407_10000683 3300031903 Bacteria 10967
351 Ga0307407_10096390 3300031903 Bacteria 1826
352 Ga0307407_10222023 3300031903 Bacteria 1278
353 Ga0307412_10024068 3300031911 Bacteria 3755
354 Ga0307412_10067346 3300031911 Bacteria 2431
355 Ga0307409_100010443 3300031995 Bacteria 5777
356 Ga0307409_100081157 3300031995 Bacteria 2620
357 Ga0307409_100115898 3300031995 Bacteria 2257
358 Ga0307409_100116587 3300031995 Bacteria 2252
359 Ga0307409_100174752 3300031995 Bacteria 1894
360 Ga0307409_100525134 3300031995 Bacteria 1157
361 Ga0307416_100011106 3300032002 Bacteria 5989
362 Ga0307416_100057698 3300032002 Bacteria 3143
363 Ga0307416_100128908 3300032002 Bacteria 2272
364 Ga0307416_100141176 3300032002 Bacteria 2189
365 Ga0307416_100283426 3300032002 Bacteria 1635
366 Ga0307416_100428298 3300032002 Bacteria 1369
367 Ga0307416_100492477 3300032002 Bacteria 1288
368 Ga0307414_10091500 3300032004 Bacteria 2261
369 Ga0307411_10000959 3300032005 Bacteria 11035
370 Ga0307411_10020929 3300032005 Bacteria 3816
371 Ga0307411_10028396 3300032005 Bacteria 3401
372 Ga0307415_100017550 3300032126 Bacteria 4295
373 Ga0307415_100283521 3300032126 Bacteria 1363
374 Ga0373930_0014583 3300034816 Bacteria 1466
375 Ga0373948_0052206 3300034817 Bacteria 881
376 Ga0373958_0013499 3300034819 Bacteria 1416
377 Ga0373946_0001665 3300035171 Bacteria 7736
378 Ga0373955_0012619 3300035172 Bacteria 4064
379 Ga0373924_0013864 3300035410 Bacteria 3035
380 Ga0373935_0025935 3300035692 Bacteria 3613
381 Ga0373947_0003573 3300035725 Bacteria 9174
382 Ga0373947_0068805 3300035725 Bacteria 2166
383 Ga0373937_0087497 3300036401 Bacteria 2884
384 Ga0373937_0181159 3300036401 Bacteria 1978
385 Ga0373937_0205909 3300036401 Bacteria 1850
386 Ga0373937_0318723 3300036401 Bacteria 1471
387 Ga0373925_0004883 3300037068 Bacteria 10089
388 Ga0439433_0000874 3300041999 Bacteria 5992
389 Ga0439456_046056 3300042013 Bacteria 950
390 Ga0439435_0042390 3300042436 Bacteria 1277
391 Ga0439464_0005726 3300042439 Bacteria 3222
392 Ga0439440_0009249 3300042993 Bacteria 2040
393 Ga0439440_0039981 3300042993 Bacteria 1140
394 Ga0451576_0018046 3300045051 Bacteria 7743
395 Ga0451576_0042342 3300045051 Bacteria 4807
396 Ga0466967_0357220 3300045976 Bacteria 1415
397 Ga0495603_0045335 3300046455 Bacteria 2622
398 Ga0495638_0003117 3300046460 Bacteria 13130
399 Ga0495639_0060082 3300046475 Bacteria 1741
400 Ga0495584_0101613 3300046491 Bacteria 1453
401 Ga0495584_0119255 3300046491 Bacteria 1336
402 Ga0495594_0064783 3300046499 Bacteria 2026
403 Ga0495594_0086098 3300046499 Bacteria 1758
404 Ga0495628_0365517 3300046516 Bacteria 1059
405 Ga0495630_0185418 3300046517 Bacteria 1587
406 Ga0495642_0057564 3300046528 Bacteria 1607
407 Ga0495640_0125007 3300046533 Bacteria 1669
408 Ga0495609_0060342 3300046538 Bacteria 1677
409 Ga0495621_0017088 3300046539 Bacteria 2339
410 Ga0495621_0090221 3300046539 Bacteria 1154
411 Ga0495667_0145780 3300046559 Bacteria 1525
412 Ga0495634_0086517 3300046642 Bacteria 2041
413 Ga0495635_0073453 3300046663 Bacteria 2343
414 Ga0495659_0007398 3300046664 Bacteria 3484
415 Ga0495659_0008633 3300046664 Bacteria 3243
416 Ga0495588_0025628 3300046674 Bacteria 2940
417 Ga0495636_0021362 3300047318 Bacteria 2613
418 Ga0495676_0056275 3300047321 Bacteria 3111
419 Ga0495684_0137949 3300047471 Bacteria 1830
420 Ga0495593_0125474 3300047673 Bacteria 1305
421 Ga0496102_0229573 3300048905 Bacteria 1750
422 Ga0496102_0403317 3300048905 Bacteria 1285
423 Ga0496102_0696110 3300048905 Bacteria 939
424 Ga0496104_0074824 3300048907 Bacteria 3224
425 Ga0496105_0182126 3300048908 Bacteria 1720
426 Ga0496105_0459228 3300048908 Bacteria 1004
427 Ga0496106_0065839 3300048909 Bacteria 2759
428 Ga0496106_0264725 3300048909 Bacteria 1376
429 Ga0496107_0253404 3300048910 Unclassified 1310
430 Ga0496107_0363771 3300048910 Bacteria 1076
431 Ga0496108_0027655 3300048911 Bacteria 4688
432 Ga0496109_0005282 3300048912 Bacteria 10792
433 Ga0496111_0234309 3300048914 Bacteria 1364
434 Ga0496112_0003796 3300048915 Bacteria 12623
435 Ga0496112_0122595 3300048915 Bacteria 2570
436 Ga0496112_0681258 3300048915 Bacteria 957
437 Ga0501031_0059110 3300049568 Bacteria 2499
438 Ga0501031_0150629 3300049568 Bacteria 1520
439 Ga0501032_0319551 3300049569 Bacteria 1002
440 Ga0501033_0340415 3300049570 Bacteria 1052
441 Ga0501034_0024694 3300049571 Bacteria 6113
442 Ga0501034_0072197 3300049571 Bacteria 3460
443 Ga0501036_0227656 3300049572 Bacteria 1565
444 Ga0501040_0057124 3300049576 Bacteria 2679
445 Ga0501040_0428562 3300049576 Bacteria 951
446 Ga0501041_0384120 3300049577 Bacteria 889
447 Ga0501042_0448906 3300049578 Unclassified 935
448 Ga0501046_0216680 3300049580 Bacteria 1419
449 Ga0501047_0153500 3300049581 Bacteria 2177
450 Ga0501048_0066028 3300049582 Bacteria 2558
451 Ga0501048_0395464 3300049582 Unclassified 988
452 Ga0501067_0176789 3300049583 Bacteria 1189
453 Ga0501071_0011510 3300049587 Bacteria 5966
454 Ga0501071_0079715 3300049587 Bacteria 2394
455 Ga0501072_0147722 3300049588 Bacteria 1874
456 Ga0501072_0238358 3300049588 Bacteria 1449
457 Ga0501072_0501723 3300049588 Bacteria 960
458 Ga0501073_0174803 3300049589 Bacteria 1486
459 Ga0501075_0242948 3300049591 Bacteria 1373
460 Ga0501076_0073874 3300049592 Bacteria 2730
461 Ga0501077_0076919 3300049593 Bacteria 2114
462 Ga0501235_049295 3300049669 Bacteria 974
463 Ga0501249_003590 3300049679 Bacteria 3120
464 Ga0501225_0048982 3300049705 Bacteria 1174
465 Ga0501079_0055956 3300049741 Bacteria 3044
466 Ga0501079_0083201 3300049741 Bacteria 2476
467 Ga0501079_0265872 3300049741 Bacteria 1341
468 Ga0501080_0083875 3300049742 Bacteria 2961
469 Ga0501080_0520551 3300049742 Bacteria 1061
470 Ga0501081_0016081 3300049743 Bacteria 4942
471 Ga0501081_0140484 3300049743 Bacteria 1731
472 Ga0501044_0036828 3300049823 Bacteria 5117
473 Ga0501045_0012702 3300049824 Bacteria 5929
474 Ga0501045_0035117 3300049824 Bacteria 3640
475 Ga0501045_0035218 3300049824 Bacteria 3634
476 Ga0501045_0094775 3300049824 Bacteria 2208
477 Ga0501045_0190241 3300049824 Unclassified 1530
478 Ga0501045_0360697 3300049824 Bacteria 1082
479 nmdc:mga0yw44_114219_c1 3300050492 Bacteria 1733
480 nmdc:mga0yw44_90809_c1 3300050492 Bacteria 1930
481 nmdc:mga0k408_8941_c1 3300050493 Bacteria 5388
482 nmdc:mga06z11_57494_c1 3300050494 Bacteria 2015
483 nmdc:mga07m45_25373_c1 3300050496 Bacteria 3250
484 nmdc:mga05p37_120786_c1 3300050507 Bacteria 3219
485 nmdc:mga05p37_12191_c1 3300050507 Bacteria 10263
486 nmdc:mga05p37_123261_c1 3300050507 Bacteria 3184
487 nmdc:mga05p37_1769_c1 3300050507 Bacteria 25237
488 nmdc:mga05p37_24056_c1 3300050507 Bacteria 7399
489 nmdc:mga05p37_242590_c1 3300050507 Bacteria 2166
490 nmdc:mga05p37_2811_c1 3300050507 Bacteria 20244
491 nmdc:mga05p37_396868_c1 3300050507 Bacteria 1612
492 nmdc:mga05p37_445371_c1 3300050507 Bacteria 1501
493 nmdc:mga05p37_48756_c1 3300050507 Bacteria 5208
494 nmdc:mga05p37_86259_c1 3300050507 Bacteria 3869
495 nmdc:mga09592_14548_c1 3300050508 Bacteria 6422
496 nmdc:mga09592_5386_c1 3300050508 Bacteria 10409
497 nmdc:mga09592_57070_c1 3300050508 Bacteria 3299
498 nmdc:mga09592_73776_c1 3300050508 Bacteria 2900
499 nmdc:mga09592_9285_c1 3300050508 Bacteria 7994
500 nmdc:mga0qj67_1741_c1 3300050509 Bacteria 15385
501 nmdc:mga0qj67_18533_c1 3300050509 Bacteria 5305
502 nmdc:mga0qj67_275591_c1 3300050509 Bacteria 1364
503 nmdc:mga0qj67_34757_c1 3300050509 Bacteria 3939
504 nmdc:mga0qj67_40149_c1 3300050509 Bacteria 3678
505 nmdc:mga0qj67_49861_c1 3300050509 Bacteria 3309
506 nmdc:mga0qj67_54151_c1 3300050509 Bacteria 3177
507 nmdc:mga0qj67_710_c1 3300050509 Bacteria 22662
508 nmdc:mga06r32_11027_c1 3300050510 Bacteria 8135
509 nmdc:mga06r32_1269_c1 3300050510 Bacteria 22696
510 nmdc:mga06r32_194173_c1 3300050510 Bacteria 2017
511 nmdc:mga06r32_198673_c1 3300050510 Bacteria 1993
512 nmdc:mga06r32_2027_c1 3300050510 Bacteria 18112
513 nmdc:mga06r32_278104_c1 3300050510 Bacteria 1661
514 nmdc:mga06r32_44509_c1 3300050510 Bacteria 4227
515 nmdc:mga08y16_13535_c1 3300050511 Bacteria 8586
516 nmdc:mga08y16_210653_c1 3300050511 Bacteria 2013
517 nmdc:mga08y16_233086_c1 3300050511 Bacteria 1904
518 nmdc:mga08y16_318186_c1 3300050511 Bacteria 1602
519 nmdc:mga08y16_345640_c1 3300050511 Bacteria 1529
520 nmdc:mga08y16_3753_c1 3300050511 Bacteria 15812
521 nmdc:mga08y16_384992_c1 3300050511 Bacteria 1437
522 nmdc:mga08y16_74279_c1 3300050511 Bacteria 3542
523 nmdc:mga08y16_91907_c1 3300050511 Bacteria 3162
524 nmdc:mga0n895_100383_c1 3300050512 Bacteria 2903
525 nmdc:mga0n895_105930_c1 3300050512 Bacteria 2825
526 nmdc:mga0n895_17855_c1 3300050512 Bacteria 6552
527 nmdc:mga0n895_239118_c1 3300050512 Bacteria 1843
528 nmdc:mga0n895_24160_c1 3300050512 Bacteria 5725
529 nmdc:mga0n895_315239_c1 3300050512 Bacteria 1585
530 nmdc:mga0n895_36166_c1 3300050512 Bacteria 4767
531 nmdc:mga0n895_899794_c1 3300050512 Bacteria 871
532 nmdc:mga0rr50_140089_c1 3300050513 Bacteria 1945
533 nmdc:mga0rr50_36883_c1 3300050513 Bacteria 3524
534 nmdc:mga0rr50_56044_c1 3300050513 Unclassified 2943
535 nmdc:mga0rr50_76370_c1 3300050513 Bacteria 2571
536 nmdc:mga08x19_10867_c1 3300050514 Bacteria 5475
537 nmdc:mga08x19_264520_c1 3300050514 Bacteria 1189
538 nmdc:mga0a205_103525_c1 3300050515 Bacteria 1811
539 nmdc:mga0a205_105106_c1 3300050515 Bacteria 2722
540 nmdc:mga0a205_126978_c1 3300050515 Bacteria 2450
541 nmdc:mga0a205_13814_c1 3300050515 Bacteria 7526
542 nmdc:mga0a205_66396_c1 3300050515 Bacteria 3486
543 nmdc:mga0a205_7556_c2 3300050515 Bacteria 4738
544 Ga0500652_077072 3300053131 Bacteria 1386
545 Ga0500645_000579 3300053730 Bacteria 23617
546 Ga0501084_0022018 3300054114 Bacteria 5317
547 Ga0501084_0029388 3300054114 Bacteria 4598
548 Ga0501084_0407598 3300054114 Bacteria 1149
549 Ga0590071_000463 3300059421 Bacteria 11852
550 Ga0590071_009157 3300059421 Bacteria 2327
551 Ga0590074_000752 3300059423 Bacteria 4958
552 Ga0590074_003115 3300059423 Bacteria 2736
553 Ga0590075_000384 3300059424 Bacteria 12137
554 Ga0590075_016061 3300059424 Bacteria 1840
555 Ga0590077_000040 3300059426 Bacteria 29723
556 Ga0590077_001261 3300059426 Bacteria 6061
557 Ga0501082_0014813 3300060353 Bacteria 6717
558 Ga0501082_0115405 3300060353 Bacteria 2326
559 Ga0501082_0161891 3300060353 Bacteria 1945
560 Ga0501082_0278244 3300060353 Bacteria 1457
561 Ga0530510_0024484 3300061734 Bacteria 4308
562 Ga0530510_0168433 3300061734 Bacteria 1622
563 Ga0075430_100047252
564 JGI25406J46586_10000255
565 JGI25406J46586_10001663
566 Ga0065712_10011391
567 Ga0065712_10012408
568 Ga0065712_10021936
569 Ga0065712_10069800
570 Ga0065712_10137001
571 Ga0065715_10015226
572 Ga0065715_10100318
573 Ga0065715_10239931
574 Ga0065707_10015338
575 Ga0065707_10017233
576 Ga0065707_10151181
577 Ga0065707_10209743
578 Ga0070676_10107679
579 Ga0070676_10266983
580 Ga0070690_100038006
581 Ga0070690_100057756
582 Ga0070690_100059814
583 Ga0070670_100004928
584 Ga0070670_100007124
585 Ga0070670_100011553
586 Ga0070670_100035107
587 Ga0070677_10015666
588 Ga0070666_10033652
589 Ga0070666_10070080
590 Ga0068868_100464260
591 Ga0070691_10047847
592 Ga0070692_10307258
593 Ga0070668_100136435
594 Ga0070668_100170244
595 Ga0070669_100000449
596 Ga0070669_100110630
597 Ga0070669_100145860
598 Ga0070675_100006767
599 Ga0070675_100030628
600 Ga0070675_100050936
601 Ga0070675_100240314
602 Ga0070671_100033807
603 Ga0070671_100069343
604 Ga0070671_100077659
605 Ga0070674_100007026
606 Ga0070674_100166475
607 Ga0070673_100180196
608 Ga0070688_100227183
609 Ga0070659_100140145
610 Ga0070659_100237891
611 Ga0070701_10019641
612 Ga0070701_10027972
613 Ga0070705_100001158
614 Ga0070705_100055534
615 Ga0070705_100239749
616 Ga0070700_100127201
617 Ga0070694_100097598
618 Ga0070694_100111607
619 Ga0070694_100386035
620 Ga0070708_100070155
621 Ga0070663_100566849
622 Ga0070678_100344677
623 Ga0070662_100420779
624 Ga0070681_10184165
625 Ga0068867_100042603
626 Ga0068867_100179683
627 Ga0070698_100001720
628 Ga0070698_100054958
629 Ga0070698_100197188
630 Ga0070699_100004150
631 Ga0070699_100016310
632 Ga0070699_100041472
633 Ga0070699_100067586
634 Ga0070699_100081403
635 Ga0070699_100133264
636 Ga0070699_100152556
637 Ga0070684_100068804
638 Ga0070697_100024964
639 Ga0070697_100080139
640 Ga0070672_100013169
641 Ga0070672_100026948
642 Ga0070672_100358685
643 Ga0070686_100000672
644 Ga0070686_100167128
645 Ga0070686_100378094
646 Ga0070686_100501845
647 Ga0070695_100000008
648 Ga0070695_100001631
649 Ga0070695_100043919
650 Ga0070695_100047565
651 Ga0070696_100002395
652 Ga0070696_100008410
653 Ga0070693_100016073
654 Ga0070693_100145127
655 Ga0070665_100028891
656 Ga0070665_100181261
657 Ga0070665_100312749
658 Ga0070704_100017048
659 Ga0070704_100018815
660 Ga0070704_100053687
661 Ga0070704_100056445
662 Ga0070704_100163314
663 Ga0070704_100325830
664 Ga0070664_100013747
665 Ga0070664_100022349
666 Ga0068857_100033902
667 Ga0068854_100170820
668 Ga0068854_100297877
669 Ga0068852_100222395
670 Ga0068859_100029596
671 Ga0068859_100455315
672 Ga0068864_100003763
673 Ga0068864_100180450
674 Ga0068864_100272852
675 Ga0068866_10047737
676 Ga0068861_100145260
677 Ga0068861_100151235
678 Ga0068861_100536161
679 Ga0068851_10091842
680 Ga0068870_10024155
681 Ga0068863_100046011
682 Ga0068863_100141128
683 Ga0068858_100203844
684 Ga0068858_100753601
685 Ga0068860_100246976
686 Ga0068860_100605908
687 Ga0068862_100012816
688 Ga0068862_100093138
689 Ga0081539_10000108
690 Ga0081539_10000743
691 Ga0081539_10031814
692 Ga0075365_10013229
693 Ga0075364_10001075
694 Ga0075367_10010682
695 Ga0075367_10066750
696 Ga0075366_10032302
697 Ga0075370_10033126
698 Ga0068871_100248404
699 Ga0068871_100374841
700 Ga0068871_100423446
701 Ga0075428_100000903
702 Ga0075428_100001333
703 Ga0075428_100002195
704 Ga0075428_100003841
705 Ga0075428_100013297
706 Ga0075428_100017035
707 Ga0075428_100348901
708 Ga0075428_100530015
709 Ga0075430_100001150
710 Ga0075430_100003201
711 Ga0075430_100012048
712 Ga0075430_100014765
713 Ga0075430_100068508
714 Ga0075430_100178561
715 Ga0075431_100002132
716 Ga0075431_100015285
717 Ga0075431_100018287
718 Ga0075431_100022962
719 Ga0075431_100049432
720 Ga0075431_100121071
721 Ga0075431_100132271
722 Ga0075431_100185565
723 Ga0075431_100211443
724 Ga0075431_100253618
725 Ga0075433_10060970
726 Ga0075433_10089717
727 Ga0075433_10169597
728 Ga0075433_10176204
729 Ga0075434_100008592
730 Ga0075434_100014800
731 Ga0075434_100017255
732 Ga0075434_100019783
733 Ga0075434_100047641
734 Ga0075434_100295846
735 Ga0075429_100001542
736 Ga0075429_100012005
737 Ga0075429_100012550
738 Ga0075429_100013433
739 Ga0075429_100052249
740 Ga0075429_100075631
741 Ga0075429_100080465
742 Ga0075429_100287986
743 Ga0068865_100095010
744 Ga0068865_100139916
745 Ga0075436_100036552
746 Ga0097620_100029596
747 Ga0097620_100455303
748 Ga0075435_100019938
749 Ga0075435_100023795
750 Ga0075435_100051172
751 Ga0075435_100057689
752 Ga0075435_100126415
753 Ga0075435_100288445
754 Ga0105240_10088121
755 Ga0111539_10001010
756 Ga0111539_10001112
757 Ga0111539_10004654
758 Ga0111539_10010186
759 Ga0111539_10011236
760 Ga0111539_10056372
761 Ga0111539_10063813
762 Ga0111539_10134610
763 Ga0111539_10501339
764 Ga0111539_10514535
765 Ga0111539_10645804
766 Ga0105245_10650342
767 Ga0114129_10000365
768 Ga0114129_10001867
769 Ga0114129_10002447
770 Ga0114129_10003868
771 Ga0114129_10010349
772 Ga0114129_10011576
773 Ga0114129_10013583
774 Ga0114129_10055882
775 Ga0114129_10063353
776 Ga0114129_10102583
777 Ga0114129_10148643
778 Ga0114129_10199880
779 Ga0114129_10310641
780 Ga0114129_10330613
781 Ga0114129_10490406
782 Ga0114129_10541826
783 Ga0105243_10155607
784 Ga0105243_10206815
785 Ga0105243_10921203
786 Ga0105241_10633069
787 Ga0105248_10008326
788 Ga0105248_10008629
789 Ga0105248_10452359
790 Ga0105249_10250452
791 Ga0105249_10536394
792 Ga0157378_10481051
793 Ga0163162_10074570
794 Ga0157375_10078147
795 Ga0157375_10309105
796 Ga0157375_10552923
797 Ga0163163_10205539
798 Ga0157380_10006766
799 Ga0157380_10018649
800 Ga0157380_10142913
801 Ga0157380_10169110
802 Ga0157380_10249809
803 Ga0157380_10828578
804 Ga0157377_10055485
805 Ga0163161_10087123
806 Ga0207697_10016614
807 Ga0207682_10003879
808 Ga0207682_10017904
809 Ga0207688_10010391
810 Ga0207680_10017828
811 Ga0207645_10009883
812 Ga0207645_10089974
813 Ga0207705_10242216
814 Ga0207695_10103099
815 Ga0207695_10322200
816 Ga0207662_10124089
817 Ga0207649_10450818
818 Ga0207646_10096988
819 Ga0207646_10393333
820 Ga0207646_10574986
821 Ga0207681_10042479
822 Ga0207681_10145899
823 Ga0207681_10158446
824 Ga0207681_10394762
825 Ga0207650_10013445
826 Ga0207659_10001200
827 Ga0207659_10009770
828 Ga0207659_10127607
829 Ga0207659_10225364
830 Ga0207659_10229896
831 Ga0207706_10029688
832 Ga0207706_10107568
833 Ga0207706_10143679
834 Ga0207706_10432332
835 Ga0207706_10491413
836 Ga0207686_10002304
837 Ga0207709_10047083
838 Ga0207669_10000506
839 Ga0207669_10035790
840 Ga0207669_10184431
841 Ga0207669_10192748
842 Ga0207669_10226754
843 Ga0207704_10068978
844 Ga0207704_10198269
845 Ga0207691_10013787
846 Ga0207691_10023853
847 Ga0207691_10031177
848 Ga0207691_10073054
849 Ga0207711_10057083
850 Ga0207711_10081971
851 Ga0207711_10125870
852 Ga0207711_10381889
853 Ga0207661_10012964
854 Ga0207679_10041051
855 Ga0207679_10214145
856 Ga0207679_10303804
857 Ga0207679_10440204
858 Ga0207651_10019234
859 Ga0207651_10148305
860 Ga0207651_10287488
861 Ga0207712_10089841
862 Ga0207668_10394583
863 Ga0207640_10151057
864 Ga0207640_10296056
865 Ga0207677_10067555
866 Ga0207703_10694169
867 Ga0207708_10250478
868 Ga0207641_10023020
869 Ga0207641_10400726
870 Ga0207648_10095949
871 Ga0207648_10120723
872 Ga0207676_10037997
873 Ga0207674_10123370
874 Ga0207675_100041082
875 Ga0207675_100068171
876 Ga0207675_100109794
877 Ga0207675_100216996
878 Ga0207675_100319763
879 Ga0207675_100391184
880 Ga0207675_100466520
881 Ga0207675_100787952
882 Ga0207683_10226401
883 Ga0207428_10000910
884 Ga0207428_10001673
885 Ga0207428_10003635
886 Ga0268266_10360189
887 Ga0268265_10009043
888 Ga0268265_10022920
889 Ga0268265_10324039
890 Ga0268265_10406400
891 Ga0268265_10553735
892 Ga0268264_10292370
893 Ga0265338_10154548
894 Ga0307511_10129598
895 Ga0265327_10001617
896 Ga0307408_100008676
897 Ga0307408_100023713
898 Ga0307408_100030838
899 Ga0307408_100047126
900 Ga0307408_100115011
901 Ga0307408_100161382
902 Ga0265314_10038196
903 Ga0316578_10164735
904 Ga0307405_10000780
905 Ga0307405_10042793
906 Ga0307405_10241608
907 Ga0307413_10055279
908 Ga0307410_10008076
909 Ga0307410_10218150
910 Ga0307406_10055066
911 Ga0307406_10060030
912 Ga0307407_10000683
913 Ga0307407_10096390
914 Ga0307407_10222023
915 Ga0307412_10024068
916 Ga0307412_10067346
917 Ga0307409_100010443
918 Ga0307409_100081157
919 Ga0307409_100115898
920 Ga0307409_100116587
921 Ga0307409_100174752
922 Ga0307409_100525134
923 Ga0307416_100011106
924 Ga0307416_100057698
925 Ga0307416_100128908
926 Ga0307416_100141176
927 Ga0307416_100283426
928 Ga0307416_100428298
929 Ga0307416_100492477
930 Ga0307414_10091500
931 Ga0307411_10000959
932 Ga0307411_10020929
933 Ga0307411_10028396
934 Ga0307415_100017550
935 Ga0307415_100283521
936 Ga0373930_0014583
937 Ga0373948_0052206
938 Ga0373958_0013499
939 Ga0373946_0001665
940 Ga0373955_0012619
941 Ga0373924_0013864
942 Ga0373935_0025935
943 Ga0373947_0003573
944 Ga0373947_0068805
945 Ga0373937_0087497
946 Ga0373937_0181159
947 Ga0373937_0205909
948 Ga0373937_0318723
949 Ga0373925_0004883
950 Ga0439433_0000874
951 Ga0439456_046056
952 Ga0439435_0042390
953 Ga0439464_0005726
954 Ga0439440_0009249
955 Ga0439440_0039981
956 Ga0451576_0018046
957 Ga0451576_0042342
958 Ga0466967_0357220
959 Ga0495603_0045335
960 Ga0495638_0003117
961 Ga0495639_0060082
962 Ga0495584_0101613
963 Ga0495584_0119255
964 Ga0495594_0064783
965 Ga0495594_0086098
966 Ga0495628_0365517
967 Ga0495630_0185418
968 Ga0495642_0057564
969 Ga0495640_0125007
970 Ga0495609_0060342
971 Ga0495621_0017088
972 Ga0495621_0090221
973 Ga0495667_0145780
974 Ga0495634_0086517
975 Ga0495635_0073453
976 Ga0495659_0007398
977 Ga0495659_0008633
978 Ga0495588_0025628
979 Ga0495636_0021362
980 Ga0495676_0056275
981 Ga0495684_0137949
982 Ga0495593_0125474
983 Ga0496102_0229573
984 Ga0496102_0403317
985 Ga0496102_0696110
986 Ga0496104_0074824
987 Ga0496105_0182126
988 Ga0496105_0459228
989 Ga0496106_0065839
990 Ga0496106_0264725
991 Ga0496107_0253404
992 Ga0496107_0363771
993 Ga0496108_0027655
994 Ga0496109_0005282
995 Ga0496111_0234309
996 Ga0496112_0003796
997 Ga0496112_0122595
998 Ga0496112_0681258
999 Ga0501031_0059110
1000 Ga0501031_0150629
1001 Ga0501032_0319551
1002 Ga0501033_0340415
1003 Ga0501034_0024694
1004 Ga0501034_0072197
1005 Ga0501036_0227656
1006 Ga0501040_0057124
1007 Ga0501040_0428562
1008 Ga0501041_0384120
1009 Ga0501042_0448906
1010 Ga0501046_0216680
1011 Ga0501047_0153500
1012 Ga0501048_0066028
1013 Ga0501048_0395464
1014 Ga0501067_0176789
1015 Ga0501071_0011510
1016 Ga0501071_0079715
1017 Ga0501072_0147722
1018 Ga0501072_0238358
1019 Ga0501072_0501723
1020 Ga0501073_0174803
1021 Ga0501075_0242948
1022 Ga0501076_0073874
1023 Ga0501077_0076919
1024 Ga0501235_049295
1025 Ga0501249_003590
1026 Ga0501225_0048982
1027 Ga0501079_0055956
1028 Ga0501079_0083201
1029 Ga0501079_0265872
1030 Ga0501080_0083875
1031 Ga0501080_0520551
1032 Ga0501081_0016081
1033 Ga0501081_0140484
1034 Ga0501044_0036828
1035 Ga0501045_0012702
1036 Ga0501045_0035117
1037 Ga0501045_0035218
1038 Ga0501045_0094775
1039 Ga0501045_0190241
1040 Ga0501045_0360697
1041 nmdc:mga0yw44_114219_c1
1042 nmdc:mga0yw44_90809_c1
1043 nmdc:mga0k408_8941_c1
1044 nmdc:mga06z11_57494_c1
1045 nmdc:mga07m45_25373_c1
1046 nmdc:mga05p37_120786_c1
1047 nmdc:mga05p37_12191_c1
1048 nmdc:mga05p37_123261_c1
1049 nmdc:mga05p37_1769_c1
1050 nmdc:mga05p37_24056_c1
1051 nmdc:mga05p37_242590_c1
1052 nmdc:mga05p37_2811_c1
1053 nmdc:mga05p37_396868_c1
1054 nmdc:mga05p37_445371_c1
1055 nmdc:mga05p37_48756_c1
1056 nmdc:mga05p37_86259_c1
1057 nmdc:mga09592_14548_c1
1058 nmdc:mga09592_5386_c1
1059 nmdc:mga09592_57070_c1
1060 nmdc:mga09592_73776_c1
1061 nmdc:mga09592_9285_c1
1062 nmdc:mga0qj67_1741_c1
1063 nmdc:mga0qj67_18533_c1
1064 nmdc:mga0qj67_275591_c1
1065 nmdc:mga0qj67_34757_c1
1066 nmdc:mga0qj67_40149_c1
1067 nmdc:mga0qj67_49861_c1
1068 nmdc:mga0qj67_54151_c1
1069 nmdc:mga0qj67_710_c1
1070 nmdc:mga06r32_11027_c1
1071 nmdc:mga06r32_1269_c1
1072 nmdc:mga06r32_194173_c1
1073 nmdc:mga06r32_198673_c1
1074 nmdc:mga06r32_2027_c1
1075 nmdc:mga06r32_278104_c1
1076 nmdc:mga06r32_44509_c1
1077 nmdc:mga08y16_13535_c1
1078 nmdc:mga08y16_210653_c1
1079 nmdc:mga08y16_233086_c1
1080 nmdc:mga08y16_318186_c1
1081 nmdc:mga08y16_345640_c1
1082 nmdc:mga08y16_3753_c1
1083 nmdc:mga08y16_384992_c1
1084 nmdc:mga08y16_74279_c1
1085 nmdc:mga08y16_91907_c1
1086 nmdc:mga0n895_100383_c1
1087 nmdc:mga0n895_105930_c1
1088 nmdc:mga0n895_17855_c1
1089 nmdc:mga0n895_239118_c1
1090 nmdc:mga0n895_24160_c1
1091 nmdc:mga0n895_315239_c1
1092 nmdc:mga0n895_36166_c1
1093 nmdc:mga0n895_899794_c1
1094 nmdc:mga0rr50_140089_c1
1095 nmdc:mga0rr50_36883_c1
1096 nmdc:mga0rr50_56044_c1
1097 nmdc:mga0rr50_76370_c1
1098 nmdc:mga08x19_10867_c1
1099 nmdc:mga08x19_264520_c1
1100 nmdc:mga0a205_103525_c1
1101 nmdc:mga0a205_105106_c1
1102 nmdc:mga0a205_126978_c1
1103 nmdc:mga0a205_13814_c1
1104 nmdc:mga0a205_66396_c1
1105 nmdc:mga0a205_7556_c2
1106 Ga0500652_077072
1107 Ga0500645_000579
1108 Ga0501084_0022018
1109 Ga0501084_0029388
1110 Ga0501084_0407598
1111 Ga0590071_000463
1112 Ga0590071_009157
1113 Ga0590074_000752
1114 Ga0590074_003115
1115 Ga0590075_000384
1116 Ga0590075_016061
1117 Ga0590077_000040
1118 Ga0590077_001261
1119 Ga0501082_0014813
1120 Ga0501082_0115405
1121 Ga0501082_0161891
1122 Ga0501082_0278244
1123 Ga0530510_0024484
1124 Ga0530510_0168433

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

51

298

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ece-assembly2.cif.gz_E crystal structure of purine nucleoside phosphorylase (w16y, w94y, w178y, h257w) mutant from human complexed with guanine 0.9644 4 257
5ugf-assembly1.cif.gz_B crystal structure of human purine nucleoside phosphorylase (f159y) mutant complexed with dadme-immg and phosphate 0.9589 4 257
2oc4-assembly1.cif.gz_A crystal structure of human purine nucleoside phosphorylase mutant h257d with imm-h 0.9575 4 257
1a9o-assembly1.cif.gz_A bovine purine nucleoside phosphorylase complexed with phosphate 0.9569 4 257
6tk9-assembly1.cif.gz_B purine-nucleoside phosphorylase from thermus thermophilus 0.9554 4 257
ID Description Score Start End Superfamily
af_A0A1D8PJL8_4_307_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9462 3 257 3.40.50.1580
af_U4PSA1_35_317_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9459 4 257 3.40.50.1580
af_Q7TP15_194_361_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9438 138 256 3.40.50.1580
1td1C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9426 1 257 3.40.50.1580
3d1vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.942 4 257 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A645GZB6-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9948 141 257 GO:0004731
GO:0005737
GO:0009116
AF-A0A2V7V3Y9-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9927 67 256 GO:0004731
GO:0005737
GO:0009116
AF-A0A6I9P6G6-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.987 79 220 GO:0004731
GO:0005737
GO:0009116
AF-A0A2V8CF72-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9845 1 257 GO:0004731
GO:0005737
GO:0009116
AF-A0A450ASY5-F1-model_v4 deleted 0.9841 4 257

Map