F463918

General Info

Members Datasets Scaffolds Average Seq Length
562 259 525 239

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10206228|Ga0075370_102062281
Length 256
Sequence VEFEKIRGISVYFYNMIRCLVVDDEPLALHILEDYISKMPFLQLVKATTNPIEALTLVQAGNVDLVFLDVQMPELTGIQFLKIANGKAKVILTTAYPQYALEGYELDVVDYLLKPIAFDRFFKAVQKAQGIIQPVTKTVIQAEPAQQDDFSTDFIFVKTEHKIQKVYLHDILFIEGLKDYISIFTCAERIITLQGMKKMEDALPEKHFVRVHKSYIVALNKIDSIERSRIQIGEKIIPVGDTYRDEFFKIIDDKNV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2739367663 Pedobacter sp. YR510 Isolate Unclassified
11 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
12 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
13 2818991437 Pedobacter terrae 518 Isolate Unclassified
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
16 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
17 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
18 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
19 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
20 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
21 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
22 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
23 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
24 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
25 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
26 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
27 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
28 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
29 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
30 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
31 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
32 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
33 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
34 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
35 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
36 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
40 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
41 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
42 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
43 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
44 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
45 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
46 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
49 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
50 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
53 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
54 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
58 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
59 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
209 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
244 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
248 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
253 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
254 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
255 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
258 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
259 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.42
Metatranscriptomes 0
Isolates 6.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.79
Nodule 0
Rhizoplane 0.36
Rhizosphere 78.65
Stem 0
Stem Tuber 0
Unclassified 11.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2665874 2162886007 Bacteria 8637
2 SwRhRL2b_contig_3558340 2162886007 Bacteria 2637
3 JGI24736J21556_1003835 3300001904 Bacteria 2594
4 JGI24741J21665_1025892 3300001915 Unclassified 894
5 JGI24740J21852_10004600 3300001979 Bacteria 5932
6 JGI24740J21852_10060740 3300001979 Unclassified 1043
7 JGI24739J22299_10014648 3300001989 Bacteria 2850
8 JGI24739J22299_10014958 3300001989 Bacteria 2822
9 JGI24737J22298_10000815 3300001990 Bacteria 11065
10 JGI24735J21928_10000005 3300002067 Bacteria 356755
11 JGI24744J21845_10001973 3300002077 Bacteria 4148
12 JGI24744J21845_10012287 3300002077 Bacteria 1740
13 JGI25162J39368_1000016 3300002737 Bacteria 288734
14 JGI25162J39368_1001346 3300002737 Bacteria 13624
15 JGI25162J39368_1003362 3300002737 Bacteria 4742
16 JGI25157J39369_1002614 3300002741 Bacteria 4267
17 JGI25157J39369_1002760 3300002741 Bacteria 4028
18 JGI25164J39214_1000709 3300002772 Bacteria 12796
19 JGI25152J39213_1000054 3300002773 Bacteria 76796
20 JGI25150J39212_1000003 3300002774 Bacteria 508651
21 JGI25150J39212_1000004 3300002774 Bacteria 417320
22 JGI25151J46595_10000002 3300003187 Bacteria 731381
23 JGI25165J46597_1000414 3300003214 Bacteria 44920
24 JGI25165J46597_1000989 3300003214 Bacteria 18960
25 JGI25153J46596_10000015 3300003215 Bacteria 289820
26 JGI25153J46596_10028457 3300003215 Bacteria 1937
27 rootH1_10129858 3300003316 Bacteria 4126
28 rootH1_10141331 3300003316 Bacteria 3473
29 rootH1_10155978 3300003316 Bacteria 1593
30 rootH2_10004626 3300003320 Bacteria 9058
31 rootH2_10012714 3300003320 Bacteria 66260
32 rootH2_10076865 3300003320 Bacteria 4583
33 rootH2_10113384 3300003320 Bacteria 7920
34 rootH2_10183865 3300003320 Bacteria 1148
35 rootH2_10239693 3300003320 Bacteria 1432
36 rootL2_10006864 3300003322 Bacteria 1814
37 rootL2_10006865 3300003322 Bacteria 2095
38 rootL2_10028123 3300003322 Bacteria 4596
39 rootL2_10212590 3300003322 Unclassified 3224
40 rootL2_10246779 3300003322 Bacteria 2863
41 rootH1_10011145 3300003323 Bacteria 3948
42 rootH1_10012646 3300003323 Bacteria 62371
43 rootH1_10056133 3300003323 Bacteria 1431
44 rootH1_10061083 3300003323 Bacteria 11019
45 rootH1_10061983 3300003323 Bacteria 4339
46 rootH1_10071187 3300003323 Bacteria 3657
47 rootH1_10121043 3300003323 Bacteria 4624
48 rootH1_10192598 3300003323 Bacteria 2561
49 rootH1_10279924 3300003323 Bacteria 1592
50 JGI25160J50197_1000425 3300003354 Bacteria 26592
51 JGI25160J50197_1000835 3300003354 Bacteria 16456
52 Ga0055536_1000001 3300003781 Bacteria 630663
53 Ga0055536_1000006 3300003781 Bacteria 347733
54 Ga0055530_10003396 3300003791 Bacteria 9087
55 Ga0055530_10004526 3300003791 Bacteria 7110
56 Ga0055531_10000324 3300003794 Bacteria 47052
57 Ga0065714_10002307 3300005288 Bacteria 26043
58 Ga0065714_10002609 3300005288 Bacteria 23390
59 Ga0065714_10022472 3300005288 Bacteria 1040
60 Ga0065714_10065739 3300005288 Bacteria 8667
61 Ga0065714_10074750 3300005288 Bacteria 2994
62 Ga0065714_10080932 3300005288 Bacteria 2407
63 Ga0065714_10108263 3300005288 Bacteria 1518
64 Ga0065704_10001668 3300005289 Bacteria 7109
65 Ga0065704_10070323 3300005289 Bacteria 32863
66 Ga0070658_10000008 3300005327 Bacteria 319912
67 Ga0070658_10022913 3300005327 Bacteria 5013
68 Ga0070658_10422414 3300005327 Bacteria 1146
69 Ga0070676_10002139 3300005328 Bacteria 10059
70 Ga0070683_100118318 3300005329 Bacteria 2502
71 Ga0070666_10018751 3300005335 Unclassified 4455
72 Ga0070680_100006228 3300005336 Bacteria 9053
73 Ga0068868_100291581 3300005338 Unclassified 1384
74 Ga0070660_100055694 3300005339 Bacteria 3057
75 Ga0070660_100075742 3300005339 Bacteria 2635
76 Ga0070660_100409965 3300005339 Bacteria 1121
77 Ga0070671_100024425 3300005355 Bacteria 4947
78 Ga0070673_100004700 3300005364 Bacteria 8667
79 Ga0070673_100025171 3300005364 Bacteria 4376
80 Ga0070659_100009688 3300005366 Bacteria 7080
81 Ga0070659_100020672 3300005366 Bacteria 5005
82 Ga0070667_100542552 3300005367 Bacteria 1068
83 Ga0070663_100012482 3300005455 Bacteria 5376
84 Ga0070678_100004429 3300005456 Bacteria 7968
85 Ga0070678_100024244 3300005456 Bacteria 4058
86 Ga0070662_100000790 3300005457 Bacteria 19431
87 Ga0070681_10006627 3300005458 Bacteria 11278
88 Ga0068867_100013769 3300005459 Bacteria 5727
89 Ga0068867_100045744 3300005459 Bacteria 3211
90 Ga0070679_100002383 3300005530 Bacteria 17030
91 Ga0070679_100104490 3300005530 Bacteria 2819
92 Ga0070684_100552826 3300005535 Bacteria 1068
93 Ga0068853_100023999 3300005539 Bacteria 5112
94 Ga0068853_100130508 3300005539 Bacteria 2249
95 Ga0068853_100254964 3300005539 Bacteria 1611
96 Ga0068853_100320095 3300005539 Bacteria 1438
97 Ga0070672_100039429 3300005543 Bacteria 3618
98 Ga0070665_100000118 3300005548 Bacteria 149830
99 Ga0070665_100502512 3300005548 Bacteria 1224
100 Ga0068855_100000019 3300005563 Bacteria 205963
101 Ga0068855_100000057 3300005563 Bacteria 134898
102 Ga0068855_100000155 3300005563 Bacteria 86903
103 Ga0068855_100002647 3300005563 Bacteria 22069
104 Ga0068855_100007287 3300005563 Bacteria 13397
105 Ga0068855_100010187 3300005563 Bacteria 11330
106 Ga0068855_100040341 3300005563 Bacteria 5542
107 Ga0068855_100050668 3300005563 Bacteria 4891
108 Ga0068855_100085967 3300005563 Bacteria 3638
109 Ga0068857_100012630 3300005577 Bacteria 7360
110 Ga0068854_100316558 3300005578 Bacteria 1267
111 Ga0068856_100000005 3300005614 Bacteria 225505
112 Ga0068856_100000371 3300005614 Bacteria 49295
113 Ga0068856_100005649 3300005614 Bacteria 12311
114 Ga0068856_100055518 3300005614 Bacteria 3909
115 Ga0068856_100082027 3300005614 Bacteria 3200
116 Ga0068856_100351552 3300005614 Bacteria 1492
117 Ga0068852_100002261 3300005616 Bacteria 13217
118 Ga0068852_100002850 3300005616 Bacteria 11991
119 Ga0068852_100013978 3300005616 Bacteria 6158
120 Ga0068866_10088782 3300005718 Bacteria 1678
121 Ga0068866_10331712 3300005718 Bacteria 960
122 Ga0068860_100001478 3300005843 Bacteria 25387
123 Ga0081539_10179948 3300005985 Unclassified 992
124 Ga0075366_10000248 3300006195 Bacteria 23710
125 Ga0075366_10000835 3300006195 Bacteria 14803
126 Ga0075366_10016896 3300006195 Bacteria 4194
127 Ga0097621_100000174 3300006237 Bacteria 40714
128 Ga0097621_100004837 3300006237 Bacteria 9434
129 Ga0075370_10206228 3300006353 Bacteria 1160
130 Ga0068871_100000060 3300006358 Bacteria 59245
131 Ga0068871_100000728 3300006358 Bacteria 22327
132 Ga0068871_100365198 3300006358 Bacteria 1279
133 Ga0068865_100000345 3300006881 Bacteria 25771
134 Ga0068865_100000626 3300006881 Bacteria 19886
135 Ga0105240_10000371 3300009093 Bacteria 84390
136 Ga0105240_10004289 3300009093 Bacteria 21785
137 Ga0105240_10017291 3300009093 Bacteria 9724
138 Ga0105240_10062117 3300009093 Bacteria 4652
139 Ga0105240_10069664 3300009093 Bacteria 4353
140 Ga0105240_10101416 3300009093 Bacteria 3501
141 Ga0105240_10138905 3300009093 Bacteria 2907
142 Ga0105240_10244189 3300009093 Bacteria 2080
143 Ga0105240_10281969 3300009093 Bacteria 1908
144 Ga0105240_10304215 3300009093 Bacteria 1823
145 Ga0105240_10426732 3300009093 Bacteria 1488
146 Ga0105240_10456774 3300009093 Bacteria 1428
147 Ga0105240_10738245 3300009093 Bacteria 1071
148 Ga0105245_10661915 3300009098 Unclassified 1075
149 Ga0105243_10008576 3300009148 Bacteria 7841
150 Ga0105241_10003593 3300009174 Bacteria 11536
151 Ga0105241_10004960 3300009174 Bacteria 9814
152 Ga0105241_10026855 3300009174 Bacteria 4285
153 Ga0105241_10032558 3300009174 Bacteria 3909
154 Ga0105241_10079889 3300009174 Bacteria 2558
155 Ga0105241_10124654 3300009174 Bacteria 2079
156 Ga0105241_10212792 3300009174 Unclassified 1620
157 Ga0105242_10138219 3300009176 Bacteria 2111
158 Ga0105242_10968465 3300009176 Bacteria 856
159 Ga0105237_10000632 3300009545 Bacteria 49178
160 Ga0105237_10002011 3300009545 Bacteria 25894
161 Ga0105237_10002057 3300009545 Bacteria 25541
162 Ga0105237_10002169 3300009545 Bacteria 24637
163 Ga0105237_10004069 3300009545 Bacteria 17053
164 Ga0105237_10035982 3300009545 Bacteria 5009
165 Ga0105237_10042926 3300009545 Bacteria 4558
166 Ga0105237_10068456 3300009545 Bacteria 3543
167 Ga0105237_10111182 3300009545 Bacteria 2731
168 Ga0105237_10165332 3300009545 Bacteria 2211
169 Ga0105237_10185420 3300009545 Bacteria 2081
170 Ga0105237_10826680 3300009545 Bacteria 933
171 Ga0105238_10042711 3300009551 Bacteria 4590
172 Ga0105238_10047634 3300009551 Bacteria 4321
173 Ga0105238_10059039 3300009551 Bacteria 3844
174 Ga0105238_10115733 3300009551 Bacteria 2661
175 Ga0105238_10707735 3300009551 Bacteria 1019
176 Ga0105239_10000166 3300010375 Bacteria 94743
177 Ga0105239_10000478 3300010375 Bacteria 58328
178 Ga0105239_10000865 3300010375 Bacteria 43041
179 Ga0105239_10002482 3300010375 Bacteria 23507
180 Ga0105239_10026667 3300010375 Bacteria 6360
181 Ga0105239_10028716 3300010375 Bacteria 6116
182 Ga0105239_10051414 3300010375 Bacteria 4517
183 Ga0105239_10066097 3300010375 Bacteria 3973
184 Ga0105239_10165057 3300010375 Bacteria 2476
185 Ga0105239_10598080 3300010375 Bacteria 1258
186 Ga0105239_10930720 3300010375 Bacteria 998
187 Ga0105246_10027502 3300011119 Bacteria 3727
188 Ga0157373_10000034 3300013100 Bacteria 124053
189 Ga0157373_10000262 3300013100 Bacteria 42799
190 Ga0157373_10000678 3300013100 Bacteria 26681
191 Ga0157373_10019649 3300013100 Bacteria 4914
192 Ga0157373_10039002 3300013100 Bacteria 3402
193 Ga0157371_10000107 3300013102 Bacteria 126477
194 Ga0157371_10000117 3300013102 Bacteria 121069
195 Ga0157371_10001520 3300013102 Bacteria 23949
196 Ga0157371_10001854 3300013102 Bacteria 21234
197 Ga0157371_10003549 3300013102 Bacteria 14071
198 Ga0157371_10009852 3300013102 Bacteria 7487
199 Ga0157371_10012224 3300013102 Bacteria 6573
200 Ga0157371_10070992 3300013102 Bacteria 2465
201 Ga0157370_10003772 3300013104 Bacteria 17695
202 Ga0157370_10006526 3300013104 Bacteria 12848
203 Ga0157370_10018299 3300013104 Bacteria 7047
204 Ga0157370_10021228 3300013104 Bacteria 6473
205 Ga0157370_10022433 3300013104 Bacteria 6280
206 Ga0157370_10024043 3300013104 Bacteria 6041
207 Ga0157370_10036382 3300013104 Bacteria 4777
208 Ga0157370_10040242 3300013104 Bacteria 4513
209 Ga0157370_10047122 3300013104 Bacteria 4132
210 Ga0157370_10077377 3300013104 Bacteria 3134
211 Ga0157370_10089811 3300013104 Bacteria 2886
212 Ga0157370_10104960 3300013104 Bacteria 2645
213 Ga0157370_10134462 3300013104 Bacteria 2305
214 Ga0157369_10000047 3300013105 Bacteria 172682
215 Ga0157369_10001802 3300013105 Bacteria 25924
216 Ga0157369_10038399 3300013105 Bacteria 5236
217 Ga0157369_10195198 3300013105 Bacteria 2126
218 Ga0157369_10241661 3300013105 Bacteria 1886
219 Ga0157374_10002065 3300013296 Bacteria 16892
220 Ga0157374_10112964 3300013296 Bacteria 2614
221 Ga0157374_10211391 3300013296 Bacteria 1902
222 Ga0157378_10004388 3300013297 Bacteria 12417
223 Ga0157378_10031756 3300013297 Bacteria 4665
224 Ga0157378_10040378 3300013297 Bacteria 4137
225 Ga0157378_10161984 3300013297 Bacteria 2093
226 Ga0157378_10184186 3300013297 Unclassified 1966
227 Ga0157378_10607636 3300013297 Bacteria 1105
228 Ga0163162_10000012 3300013306 Bacteria 292674
229 Ga0163162_10000895 3300013306 Bacteria 27750
230 Ga0163162_10001433 3300013306 Bacteria 22226
231 Ga0163162_10034166 3300013306 Bacteria 5059
232 Ga0163162_10047890 3300013306 Bacteria 4283
233 Ga0163162_10282015 3300013306 Bacteria 1793
234 Ga0163162_10791067 3300013306 Bacteria 1066
235 Ga0157372_10000039 3300013307 Bacteria 165839
236 Ga0157372_10000238 3300013307 Bacteria 60988
237 Ga0157372_10000632 3300013307 Bacteria 38535
238 Ga0157372_10003372 3300013307 Bacteria 17233
239 Ga0157372_10019063 3300013307 Bacteria 7386
240 Ga0157372_10046042 3300013307 Bacteria 4841
241 Ga0157372_10871204 3300013307 Unclassified 1045
242 Ga0157375_10004936 3300013308 Bacteria 11601
243 Ga0157375_10006259 3300013308 Bacteria 10369
244 Ga0157375_10029791 3300013308 Bacteria 5138
245 Ga0157375_10047594 3300013308 Bacteria 4190
246 Ga0157375_10078439 3300013308 Bacteria 3336
247 Ga0157375_10160864 3300013308 Bacteria 2387
248 Ga0157375_10415300 3300013308 Bacteria 1512
249 Ga0157380_10082262 3300014326 Unclassified 2635
250 Ga0182008_10000002 3300014497 Bacteria 480216
251 Ga0182008_10000294 3300014497 Bacteria 39204
252 Ga0182008_10000773 3300014497 Bacteria 22437
253 Ga0182008_10000914 3300014497 Bacteria 20553
254 Ga0157377_10010267 3300014745 Bacteria 4625
255 Ga0157379_10182336 3300014968 Bacteria 1897
256 Ga0182006_1000179 3300015261 Bacteria 66779
257 Ga0182006_1000182 3300015261 Bacteria 65171
258 Ga0182006_1000349 3300015261 Bacteria 38806
259 Ga0182006_1002524 3300015261 Bacteria 9945
260 Ga0182006_1003312 3300015261 Bacteria 8314
261 Ga0182006_1012363 3300015261 Bacteria 3731
262 Ga0182007_10000005 3300015262 Bacteria 442702
263 Ga0182007_10011302 3300015262 Bacteria 3478
264 Ga0182007_10019662 3300015262 Bacteria 2425
265 Ga0183373_1002 3300015682 Bacteria 990153
266 Ga0163161_10000800 3300017792 Bacteria 24627
267 Ga0163161_10000830 3300017792 Bacteria 24159
268 Ga0163161_10000838 3300017792 Bacteria 23986
269 Ga0163161_10001299 3300017792 Bacteria 18626
270 Ga0163161_10002768 3300017792 Bacteria 12458
271 Ga0163161_10012376 3300017792 Bacteria 5923
272 Ga0163161_10115883 3300017792 Bacteria 2008
273 Ga0213872_10046824 3300021361 Bacteria 1967
274 Ga0213876_10081162 3300021384 Unclassified 1715
275 Ga0209563_105052 3300025230 Bacteria 2437
276 Ga0207427_100098 3300025231 Bacteria 122817
277 Ga0207427_100122 3300025231 Bacteria 99064
278 Ga0209437_100008 3300025233 Bacteria 921142
279 Ga0209437_100048 3300025233 Bacteria 405107
280 Ga0209437_100262 3300025233 Bacteria 81344
281 Ga0207425_1000003 3300025245 Bacteria 1145342
282 Ga0209026_1000225 3300025250 Bacteria 77234
283 Ga0209026_1000358 3300025250 Bacteria 42992
284 Ga0209026_1003123 3300025250 Bacteria 5643
285 Ga0209026_1014987 3300025250 Bacteria 1282
286 Ga0209129_1000014 3300025258 Bacteria 509018
287 Ga0209129_1009689 3300025258 Bacteria 2500
288 Ga0209233_1000024 3300025261 Bacteria 695418
289 Ga0209233_1000029 3300025261 Bacteria 641642
290 Ga0209233_1007433 3300025261 Bacteria 3473
291 Ga0209233_1012661 3300025261 Bacteria 2437
292 Ga0209676_1000008 3300025292 Bacteria 991778
293 Ga0209676_1000039 3300025292 Bacteria 443158
294 Ga0209025_1000007 3300025294 Bacteria 1145109
295 Ga0209758_1000012 3300025297 Bacteria 949866
296 Ga0209758_1015469 3300025297 Bacteria 3945
297 Ga0209050_1000033 3300025298 Bacteria 442615
298 Ga0209050_1000055 3300025298 Bacteria 339254
299 Ga0207426_1000032 3300025302 Bacteria 457997
300 Ga0207426_1000277 3300025302 Bacteria 106036
301 Ga0209257_1000023 3300025304 Bacteria 753019
302 Ga0207642_10071118 3300025899 Bacteria 1656
303 Ga0207647_10000071 3300025904 Bacteria 79170
304 Ga0207647_10000231 3300025904 Bacteria 46261
305 Ga0207647_10116980 3300025904 Bacteria 1574
306 Ga0207645_10000229 3300025907 Bacteria 46502
307 Ga0207645_10003426 3300025907 Bacteria 12058
308 Ga0207705_10000026 3300025909 Bacteria 256051
309 Ga0207705_10033906 3300025909 Bacteria 3648
310 Ga0207654_10001012 3300025911 Bacteria 15381
311 Ga0207654_10002331 3300025911 Bacteria 9744
312 Ga0207654_10088415 3300025911 Bacteria 1882
313 Ga0207654_10456843 3300025911 Bacteria 896
314 Ga0207695_10000142 3300025913 Bacteria 214715
315 Ga0207695_10013341 3300025913 Bacteria 9806
316 Ga0207695_10014435 3300025913 Bacteria 9358
317 Ga0207695_10017626 3300025913 Bacteria 8299
318 Ga0207695_10094760 3300025913 Bacteria 2991
319 Ga0207695_10101179 3300025913 Bacteria 2877
320 Ga0207695_10257484 3300025913 Bacteria 1643
321 Ga0207695_10286780 3300025913 Unclassified 1539
322 Ga0207695_10364437 3300025913 Bacteria 1331
323 Ga0207695_10377272 3300025913 Unclassified 1304
324 Ga0207695_10393057 3300025913 Bacteria 1271
325 Ga0207671_10000110 3300025914 Bacteria 126480
326 Ga0207671_10006512 3300025914 Bacteria 10378
327 Ga0207671_10010547 3300025914 Bacteria 7608
328 Ga0207671_10014241 3300025914 Bacteria 6294
329 Ga0207671_10030644 3300025914 Bacteria 4010
330 Ga0207671_10046584 3300025914 Bacteria 3208
331 Ga0207671_10131554 3300025914 Bacteria 1921
332 Ga0207671_10554174 3300025914 Bacteria 916
333 Ga0207657_10023346 3300025919 Bacteria 5761
334 Ga0207657_10326634 3300025919 Bacteria 1212
335 Ga0207652_10008028 3300025921 Bacteria 8469
336 Ga0207694_10021244 3300025924 Bacteria 4917
337 Ga0207694_10058698 3300025924 Bacteria 2993
338 Ga0207694_10160542 3300025924 Bacteria 1815
339 Ga0207694_10263972 3300025924 Bacteria 1411
340 Ga0207687_10345123 3300025927 Unclassified 1211
341 Ga0207644_10066744 3300025931 Bacteria 2620
342 Ga0207690_10022923 3300025932 Bacteria 3890
343 Ga0207706_10001203 3300025933 Bacteria 26147
344 Ga0207709_10059860 3300025935 Bacteria 2372
345 Ga0207704_10000047 3300025938 Bacteria 84386
346 Ga0207704_10000705 3300025938 Bacteria 14720
347 Ga0207691_10139056 3300025940 Bacteria 2141
348 Ga0207661_10695096 3300025944 Bacteria 935
349 Ga0207667_10000015 3300025949 Bacteria 417534
350 Ga0207667_10000020 3300025949 Bacteria 374770
351 Ga0207667_10000355 3300025949 Bacteria 62384
352 Ga0207667_10000953 3300025949 Bacteria 36919
353 Ga0207667_10265836 3300025949 Bacteria 1754
354 Ga0207667_10681475 3300025949 Bacteria 1031
355 Ga0207667_10854730 3300025949 Bacteria 904
356 Ga0207651_10005261 3300025960 Bacteria 6622
357 Ga0207651_10133542 3300025960 Bacteria 1904
358 Ga0207640_10329459 3300025981 Bacteria 1219
359 Ga0207677_10149624 3300026023 Unclassified 1799
360 Ga0207677_10223730 3300026023 Unclassified 1511
361 Ga0207639_10085365 3300026041 Bacteria 2510
362 Ga0207639_10163181 3300026041 Bacteria 1880
363 Ga0207678_10202106 3300026067 Unclassified 1699
364 Ga0207702_10000047 3300026078 Bacteria 143192
365 Ga0207702_10000163 3300026078 Bacteria 79263
366 Ga0207702_10005501 3300026078 Bacteria 11081
367 Ga0207702_10039219 3300026078 Bacteria 3968
368 Ga0207702_10101511 3300026078 Bacteria 2540
369 Ga0207702_10144506 3300026078 Bacteria 2157
370 Ga0207648_10001813 3300026089 Bacteria 23430
371 Ga0207648_10024141 3300026089 Bacteria 5432
372 Ga0207674_10048242 3300026116 Bacteria 4359
373 Ga0207674_10271416 3300026116 Bacteria 1644
374 Ga0207683_10001294 3300026121 Bacteria 22621
375 Ga0207683_10002360 3300026121 Bacteria 16496
376 Ga0207698_10042241 3300026142 Bacteria 3404
377 Ga0207698_10361431 3300026142 Bacteria 1375
378 Ga0268266_10000121 3300028379 Bacteria 154995
379 Ga0268264_10001375 3300028381 Bacteria 22770
380 Ga0307517_10000198 3300028786 Bacteria 102181
381 Ga0307515_10000081 3300028794 Bacteria 224753
382 Ga0307515_10025142 3300028794 Bacteria 10324
383 Ga0307515_10046709 3300028794 Bacteria 6610
384 Ga0307515_10218049 3300028794 Bacteria 1734
385 Ga0265338_10011146 3300028800 Bacteria 10422
386 Ga0265338_10020641 3300028800 Bacteria 6918
387 Ga0265338_10168222 3300028800 Bacteria 1685
388 Ga0316181_1252002 3300030744 Bacteria 1572
389 Ga0265327_10000593 3300031251 Bacteria 60421
390 Ga0307509_10016881 3300031507 Bacteria 8423
391 Ga0307509_10145662 3300031507 Bacteria 2295
392 Ga0307408_100000464 3300031548 Bacteria 35518
393 Ga0307508_10240445 3300031616 Bacteria 1408
394 Ga0307405_10000009 3300031731 Bacteria 259388
395 Ga0307407_10000001 3300031903 Bacteria 570048
396 Ga0307412_10000050 3300031911 Bacteria 151527
397 Ga0307412_10205705 3300031911 Bacteria 1498
398 Ga0307412_10213335 3300031911 Unclassified 1475
399 Ga0307412_10469042 3300031911 Bacteria 1041
400 Ga0307409_100063639 3300031995 Bacteria 2893
401 Ga0307416_100000008 3300032002 Bacteria 401343
402 Ga0307414_10000344 3300032004 Bacteria 26282
403 Ga0307414_10003900 3300032004 Bacteria 8034
404 Ga0307414_10008697 3300032004 Bacteria 5782
405 Ga0307414_10034467 3300032004 Bacteria 3357
406 Ga0307414_10035597 3300032004 Bacteria 3315
407 Ga0307414_10345679 3300032004 Bacteria 1275
408 Ga0307414_10370003 3300032004 Bacteria 1236
409 Ga0307414_10606160 3300032004 Bacteria 982
410 Ga0307507_10002452 3300033179 Bacteria 38846
411 Ga0307510_10010234 3300033180 Bacteria 11150
412 Ga0373941_0052234 3300035115 Bacteria 1303
413 Ga0373935_0510920 3300035692 Unclassified 873
414 Ga0395899_0000024 3300037312 Bacteria 357402
415 Ga0395899_0000027 3300037312 Bacteria 337387
416 Ga0395899_0014872 3300037312 Bacteria 5939
417 Ga0395900_0000140 3300037418 Bacteria 121917
418 Ga0395900_0000275 3300037418 Bacteria 78207
419 Ga0395900_0028740 3300037418 Bacteria 5700
420 Ga0395898_0001454 3300037466 Bacteria 33553
421 Ga0395898_0074989 3300037466 Bacteria 3268
422 Ga0395905_0000248 3300037471 Bacteria 81042
423 Ga0395905_0009775 3300037471 Bacteria 9353
424 Ga0395901_0000145 3300038443 Bacteria 91739
425 Ga0395901_0003259 3300038443 Bacteria 16332
426 Ga0436365_0866629 3300039437 Unclassified 2004
427 Ga0436361_1205912 3300039447 Bacteria 6506
428 Ga0439431_0003046 3300041997 Bacteria 3678
429 Ga0439448_0005766 3300042005 Bacteria 3537
430 Ga0466969_0018232 3300044656 Bacteria 3659
431 Ga0466966_0071647 3300044684 Bacteria 2171
432 Ga0466961_0008755 3300044693 Bacteria 6454
433 Ga0466963_0480368 3300044694 Bacteria 877
434 Ga0453684_0525683 3300044712 Bacteria 1306
435 Ga0495629_0083670 3300046459 Bacteria 2227
436 Ga0495638_0026765 3300046460 Bacteria 3737
437 Ga0495638_0074641 3300046460 Bacteria 2068
438 Ga0495651_0062374 3300046462 Bacteria 2852
439 Ga0495650_0001672 3300046471 Bacteria 20481
440 Ga0495650_0024651 3300046471 Bacteria 2838
441 Ga0495585_0000170 3300046492 Bacteria 70224
442 Ga0495585_0000359 3300046492 Bacteria 44166
443 Ga0495583_0151649 3300046506 Bacteria 960
444 Ga0495606_0000074 3300046507 Bacteria 170848
445 Ga0495606_0004155 3300046507 Bacteria 14678
446 Ga0495606_0005856 3300046507 Bacteria 11585
447 Ga0495606_0035081 3300046507 Bacteria 3434
448 Ga0495606_0134294 3300046507 Bacteria 1467
449 Ga0495610_0000076 3300046512 Bacteria 118246
450 Ga0495610_0000696 3300046512 Bacteria 32341
451 Ga0495610_0004662 3300046512 Bacteria 10029
452 Ga0495610_0054352 3300046512 Bacteria 1935
453 Ga0495616_0000883 3300046513 Bacteria 21770
454 Ga0495616_0002487 3300046513 Bacteria 12190
455 Ga0495628_0410442 3300046516 Bacteria 988
456 Ga0495637_0005787 3300046520 Bacteria 6262
457 Ga0495644_0002931 3300046523 Bacteria 6780
458 Ga0495648_0020240 3300046524 Bacteria 4649
459 Ga0495648_0108630 3300046524 Bacteria 1514
460 Ga0495652_0422606 3300046529 Bacteria 939
461 Ga0495609_0011609 3300046538 Bacteria 4193
462 Ga0495609_0025947 3300046538 Bacteria 2684
463 Ga0495633_0000006 3300046558 Bacteria 326774
464 Ga0495633_0039283 3300046558 Bacteria 2259
465 Ga0495633_0254934 3300046558 Bacteria 800
466 Ga0495668_0000011 3300046616 Bacteria 472186
467 Ga0495668_0190190 3300046616 Bacteria 1124
468 Ga0495625_0000239 3300046660 Bacteria 85876
469 Ga0495625_0000270 3300046660 Bacteria 80894
470 Ga0495625_0002864 3300046660 Bacteria 18101
471 Ga0495625_0016250 3300046660 Bacteria 5863
472 Ga0495625_0039623 3300046660 Bacteria 3439
473 Ga0495661_0000360 3300046665 Bacteria 49386
474 Ga0495661_0003653 3300046665 Bacteria 11317
475 Ga0495661_0005931 3300046665 Bacteria 8629
476 Ga0495661_0160712 3300046665 Bacteria 1206
477 Ga0495661_0242362 3300046665 Bacteria 924
478 Ga0495658_0229730 3300046683 Bacteria 1163
479 Ga0495671_0066510 3300046692 Bacteria 1774
480 Ga0495649_0000082 3300046694 Bacteria 82099
481 Ga0495649_0079372 3300046694 Bacteria 1756
482 Ga0495600_0132355 3300046809 Bacteria 1621
483 Ga0495660_0012942 3300046810 Bacteria 4836
484 Ga0495687_002555 3300047443 Bacteria 14392
485 Ga0495687_008257 3300047443 Bacteria 5988
486 Ga0495687_023638 3300047443 Bacteria 2932
487 Ga0495685_015598 3300047447 Bacteria 2593
488 Ga0495686_0000112 3300047472 Bacteria 168354
489 Ga0495686_0001903 3300047472 Bacteria 20836
490 Ga0495614_0094101 3300048089 Bacteria 1305
491 Ga0496115_0067953 3300048918 Bacteria 2884
492 Ga0496122_0004298 3300048925 Bacteria 17852
493 Ga0496123_0005429 3300048926 Bacteria 12835
494 Ga0496125_0028448 3300048928 Bacteria 5048
495 Ga0495678_003539 3300049459 Bacteria 9587
496 Ga0501036_0027786 3300049572 Bacteria 4782
497 Ga0501037_0025283 3300049573 Bacteria 4387
498 Ga0501038_0201856 3300049574 Bacteria 1595
499 Ga0501039_0288097 3300049575 Bacteria 1291
500 Ga0501043_0022953 3300049579 Bacteria 4892
501 Ga0501046_0007258 3300049580 Bacteria 9745
502 Ga0501047_0003056 3300049581 Bacteria 15875
503 Ga0501048_0037072 3300049582 Bacteria 3502
504 Ga0501067_0358216 3300049583 Bacteria 813
505 Ga0501070_0031978 3300049586 Bacteria 4407
506 Ga0501073_0001600 3300049589 Bacteria 16770
507 Ga0501074_0021696 3300049590 Bacteria 4663
508 Ga0501202_006206 3300049652 Bacteria 2133
509 Ga0501259_007778 3300049688 Bacteria 1717
510 Ga0501080_0032193 3300049742 Bacteria 4888
511 Ga0501083_0010977 3300049744 Bacteria 6368
512 Ga0501241_001867 3300049758 Bacteria 4146
513 Ga0501241_003024 3300049758 Bacteria 3216
514 Ga0501280_013750 3300049776 Bacteria 1146
515 Ga0501035_0076931 3300049822 Bacteria 2950
516 Ga0501044_0045529 3300049823 Bacteria 4545
517 nmdc:mga0k408_244_c1 3300050493 Bacteria 29460
518 nmdc:mga0k408_61_c1 3300050493 Bacteria 53671
519 Ga0500651_0000350 3300053093 Bacteria 25883
520 Ga0500608_000630 3300053122 Bacteria 12952
521 Ga0500614_008705 3300053123 Bacteria 2155
522 Ga0500618_000273 3300053125 Bacteria 39574
523 Ga0500616_0026780 3300053153 Unclassified 3188
524 Ga0500622_0000303 3300053156 Bacteria 50358
525 Ga0500624_000313 3300053157 Bacteria 16612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10061983 rootH1_100619835 198
2 3300009148 Ga0105243_10008576 Ga0105243_100085767 200
3 3300013102 Ga0157371_10000107 Ga0157371_1000010755 206
4 3300013307 Ga0157372_10000238 Ga0157372_1000023843 206
5 3300013105 Ga0157369_10241661 Ga0157369_102416612 209
6 3300050493 nmdc:mga0k408_244_c1 nmdc:mga0k408_244_c1_31_669 210
7 3300013307 Ga0157372_10046042 Ga0157372_100460422 216
8 3300009093 Ga0105240_10456774 Ga0105240_104567742 217
9 3300013296 Ga0157374_10211391 Ga0157374_102113912 217
10 3300001979 JGI24740J21852_10004600 JGI24740J21852_100046002 219
11 3300003215 JGI25153J46596_10028457 JGI25153J46596_100284572 219
12 3300003323 rootH1_10011145 rootH1_100111452 219
13 3300003354 JGI25160J50197_1000835 JGI25160J50197_100083511 219
14 3300025258 Ga0209129_1009689 Ga0209129_10096893 219
15 3300025297 Ga0209758_1015469 Ga0209758_10154693 219
16 3300025302 Ga0207426_1000277 Ga0207426_100027716 219
17 iso_pu_bacteria 2739367866 2740033584 219
18 3300010375 Ga0105239_10165057 Ga0105239_101650573 220
19 3300013102 Ga0157371_10009852 Ga0157371_100098526 220
20 3300013104 Ga0157370_10077377 Ga0157370_100773772 220
21 3300013105 Ga0157369_10038399 Ga0157369_100383994 220
22 3300037418 Ga0395900_0000140 Ga0395900_0000140_120734_121459 220
23 3300005355 Ga0070671_100024425 Ga0070671_1000244253 221
24 3300025931 Ga0207644_10066744 Ga0207644_100667443 221
25 3300044684 Ga0466966_0071647 Ga0466966_0071647_684_1424 221
26 3300044694 Ga0466963_0480368 Ga0466963_0480368_187_867 221
27 3300053122 Ga0500608_000630 Ga0500608_000630_12092_12817 221
28 3300003316 rootH1_10155978 rootH1_101559782 222
29 3300003323 rootH1_10121043 rootH1_101210435 222
30 3300009545 Ga0105237_10004069 Ga0105237_1000406915 222
31 3300010375 Ga0105239_10930720 Ga0105239_109307202 222
32 3300021361 Ga0213872_10046824 Ga0213872_100468242 222
33 3300025914 Ga0207671_10010547 Ga0207671_100105471 222
34 3300028786 Ga0307517_10000198 Ga0307517_1000019876 222
35 3300032004 Ga0307414_10008697 Ga0307414_100086974 222
36 3300033180 Ga0307510_10010234 Ga0307510_100102346 222
37 3300039447 Ga0436361_1205912 Ga0436361_1205912_5572_6297 222
38 3300049572 Ga0501036_0027786 Ga0501036_0027786_2229_2918 222
39 3300049573 Ga0501037_0025283 Ga0501037_0025283_3312_4001 222
40 3300049574 Ga0501038_0201856 Ga0501038_0201856_299_988 222
41 3300049575 Ga0501039_0288097 Ga0501039_0288097_204_893 222
42 3300049579 Ga0501043_0022953 Ga0501043_0022953_428_1117 222
43 3300049580 Ga0501046_0007258 Ga0501046_0007258_1944_2633 222
44 3300049581 Ga0501047_0003056 Ga0501047_0003056_8504_9193 222
45 3300049582 Ga0501048_0037072 Ga0501048_0037072_700_1389 222
46 3300049583 Ga0501067_0358216 Ga0501067_0358216_17_706 222
47 3300049586 Ga0501070_0031978 Ga0501070_0031978_2260_2949 222
48 3300049589 Ga0501073_0001600 Ga0501073_0001600_14546_15235 222
49 3300049590 Ga0501074_0021696 Ga0501074_0021696_1937_2626 222
50 3300049742 Ga0501080_0032193 Ga0501080_0032193_3360_4049 222
51 3300049744 Ga0501083_0010977 Ga0501083_0010977_869_1558 222
52 3300049822 Ga0501035_0076931 Ga0501035_0076931_1778_2467 222
53 3300049823 Ga0501044_0045529 Ga0501044_0045529_2514_3203 222
54 3300002077 JGI24744J21845_10001973 JGI24744J21845_100019735 223
55 3300003320 rootH2_10012714 rootH2_1001271418 223
56 3300003320 rootH2_10239693 rootH2_102396932 223
57 3300003323 rootH1_10056133 rootH1_100561331 223
58 3300005327 Ga0070658_10422414 Ga0070658_104224142 223
59 3300005328 Ga0070676_10002139 Ga0070676_100021397 223
60 3300005364 Ga0070673_100025171 Ga0070673_1000251715 223
61 3300005456 Ga0070678_100004429 Ga0070678_1000044297 223
62 3300005459 Ga0068867_100045744 Ga0068867_1000457443 223
63 3300005616 Ga0068852_100002261 Ga0068852_10000226112 223
64 3300005718 Ga0068866_10088782 Ga0068866_100887822 223
65 3300006237 Ga0097621_100000174 Ga0097621_10000017432 223
66 3300006358 Ga0068871_100000060 Ga0068871_10000006043 223
67 3300006881 Ga0068865_100000345 Ga0068865_10000034524 223
68 3300009174 Ga0105241_10003593 Ga0105241_100035934 223
69 3300009176 Ga0105242_10968465 Ga0105242_109684651 223
70 3300009545 Ga0105237_10002057 Ga0105237_1000205722 223
71 3300009551 Ga0105238_10042711 Ga0105238_100427116 223
72 3300010375 Ga0105239_10028716 Ga0105239_100287163 223
73 3300013296 Ga0157374_10002065 Ga0157374_1000206510 223
74 3300013297 Ga0157378_10031756 Ga0157378_100317564 223
75 3300013306 Ga0163162_10000012 Ga0163162_1000001295 223
76 3300013308 Ga0157375_10078439 Ga0157375_100784392 223
77 3300025907 Ga0207645_10000229 Ga0207645_100002297 223
78 3300025914 Ga0207671_10014241 Ga0207671_100142416 223
79 3300025924 Ga0207694_10021244 Ga0207694_100212443 223
80 3300025935 Ga0207709_10059860 Ga0207709_100598602 223
81 3300025938 Ga0207704_10000047 Ga0207704_1000004767 223
82 3300025960 Ga0207651_10133542 Ga0207651_101335422 223
83 3300026089 Ga0207648_10001813 Ga0207648_1000181316 223
84 3300026121 Ga0207683_10001294 Ga0207683_1000129413 223
85 3300026142 Ga0207698_10042241 Ga0207698_100422411 223
86 3300035115 Ga0373941_0052234 Ga0373941_0052234_233_958 223
87 3300013308 Ga0157375_10006259 Ga0157375_1000625911 224
88 3300025261 Ga0209233_1007433 Ga0209233_10074334 224
89 3300025949 Ga0207667_10854730 Ga0207667_108547301 224
90 3300031507 Ga0307509_10016881 Ga0307509_100168813 224
91 3300037312 Ga0395899_0014872 Ga0395899_0014872_4567_5292 224
92 3300037418 Ga0395900_0000275 Ga0395900_0000275_13554_14279 224
93 3300037466 Ga0395898_0001454 Ga0395898_0001454_2090_2815 224
94 3300037471 Ga0395905_0000248 Ga0395905_0000248_35630_36355 224
95 3300038443 Ga0395901_0000145 Ga0395901_0000145_84721_85446 224
96 3300047443 Ga0495687_002555 Ga0495687_002555_12280_13005 224
97 3300005548 Ga0070665_100502512 Ga0070665_1005025122 225
98 3300002077 JGI24744J21845_10012287 JGI24744J21845_100122872 226
99 3300002737 JGI25162J39368_1003362 JGI25162J39368_10033623 226
100 3300002772 JGI25164J39214_1000709 JGI25164J39214_10007099 226
101 3300003214 JGI25165J46597_1000414 JGI25165J46597_10004148 226
102 3300003316 rootH1_10129858 rootH1_101298583 226
103 3300003316 rootH1_10141331 rootH1_101413313 226
104 3300003322 rootL2_10246779 rootL2_102467794 226
105 3300003794 Ga0055531_10000324 Ga0055531_1000032436 226
106 3300005335 Ga0070666_10018751 Ga0070666_100187514 226
107 3300005338 Ga0068868_100291581 Ga0068868_1002915812 226
108 3300005364 Ga0070673_100004700 Ga0070673_1000047003 226
109 3300005456 Ga0070678_100024244 Ga0070678_1000242441 226
110 3300005459 Ga0068867_100013769 Ga0068867_1000137695 226
111 3300005539 Ga0068853_100023999 Ga0068853_1000239994 226
112 3300005543 Ga0070672_100039429 Ga0070672_1000394293 226
113 3300005563 Ga0068855_100000019 Ga0068855_100000019156 226
114 3300005614 Ga0068856_100000005 Ga0068856_100000005137 226
115 3300005614 Ga0068856_100005649 Ga0068856_1000056495 226
116 3300005616 Ga0068852_100002850 Ga0068852_1000028509 226
117 3300005718 Ga0068866_10331712 Ga0068866_103317122 226
118 3300005985 Ga0081539_10179948 Ga0081539_101799481 226
119 3300006237 Ga0097621_100004837 Ga0097621_10000483710 226
120 3300006358 Ga0068871_100000728 Ga0068871_10000072817 226
121 3300006881 Ga0068865_100000626 Ga0068865_10000062615 226
122 3300009093 Ga0105240_10244189 Ga0105240_102441893 226
123 3300009093 Ga0105240_10304215 Ga0105240_103042152 226
124 3300009174 Ga0105241_10032558 Ga0105241_100325583 226
125 3300009174 Ga0105241_10212792 Ga0105241_102127922 226
126 3300009176 Ga0105242_10138219 Ga0105242_101382193 226
127 3300009545 Ga0105237_10165332 Ga0105237_101653322 226
128 3300009551 Ga0105238_10115733 Ga0105238_101157333 226
129 3300010375 Ga0105239_10066097 Ga0105239_100660973 226
130 3300013297 Ga0157378_10040378 Ga0157378_100403783 226
131 3300013297 Ga0157378_10184186 Ga0157378_101841862 226
132 3300013306 Ga0163162_10282015 Ga0163162_102820152 226
133 3300013308 Ga0157375_10160864 Ga0157375_101608641 226
134 3300014326 Ga0157380_10082262 Ga0157380_100822622 226
135 3300014497 Ga0182008_10000773 Ga0182008_1000077312 226
136 3300015261 Ga0182006_1002524 Ga0182006_10025247 226
137 3300025230 Ga0209563_105052 Ga0209563_1050522 226
138 3300025231 Ga0207427_100098 Ga0207427_10009836 226
139 3300025233 Ga0209437_100008 Ga0209437_100008284 226
140 3300025261 Ga0209233_1000024 Ga0209233_1000024375 226
141 3300025304 Ga0209257_1000023 Ga0209257_1000023526 226
142 3300025899 Ga0207642_10071118 Ga0207642_100711181 226
143 3300025907 Ga0207645_10003426 Ga0207645_100034263 226
144 3300025913 Ga0207695_10286780 Ga0207695_102867802 226
145 3300025914 Ga0207671_10131554 Ga0207671_101315542 226
146 3300025924 Ga0207694_10160542 Ga0207694_101605422 226
147 3300025938 Ga0207704_10000705 Ga0207704_1000070514 226
148 3300025940 Ga0207691_10139056 Ga0207691_101390562 226
149 3300025949 Ga0207667_10000020 Ga0207667_1000002013 226
150 3300025960 Ga0207651_10005261 Ga0207651_100052612 226
151 3300026023 Ga0207677_10149624 Ga0207677_101496242 226
152 3300026041 Ga0207639_10085365 Ga0207639_100853653 226
153 3300026078 Ga0207702_10000047 Ga0207702_10000047140 226
154 3300026089 Ga0207648_10024141 Ga0207648_100241414 226
155 3300026121 Ga0207683_10002360 Ga0207683_100023603 226
156 3300028800 Ga0265338_10011146 Ga0265338_100111464 226
157 3300031251 Ga0265327_10000593 Ga0265327_1000059328 226
158 3300046665 Ga0495661_0000360 Ga0495661_0000360_30049_30762 226
159 3300046665 Ga0495661_0242362 Ga0495661_0242362_27_740 226
160 3300005367 Ga0070667_100542552 Ga0070667_1005425521 227
161 3300005563 Ga0068855_100000057 Ga0068855_10000005772 227
162 3300009093 Ga0105240_10738245 Ga0105240_107382452 227
163 3300013297 Ga0157378_10161984 Ga0157378_101619841 227
164 3300025913 Ga0207695_10377272 Ga0207695_103772721 227
165 3300025949 Ga0207667_10000355 Ga0207667_1000035562 227
166 3300046512 Ga0495610_0000076 Ga0495610_0000076_40544_41293 227
167 3300002737 JGI25162J39368_1001346 JGI25162J39368_10013469 228
168 3300003214 JGI25165J46597_1000989 JGI25165J46597_100098917 228
169 3300003320 rootH2_10076865 rootH2_100768656 228
170 3300003322 rootL2_10212590 rootL2_102125901 228
171 3300003323 rootH1_10012646 rootH1_1001264626 228
172 3300025231 Ga0207427_100122 Ga0207427_1001227 228
173 3300025233 Ga0209437_100048 Ga0209437_100048289 228
174 3300025250 Ga0209026_1014987 Ga0209026_10149872 228
175 3300025261 Ga0209233_1000029 Ga0209233_100002987 228
176 3300028800 Ga0265338_10020641 Ga0265338_100206417 228
177 3300035692 Ga0373935_0510920 Ga0373935_0510920_67_789 228
178 iso_pu_bacteria 8055588893 8055591092 228
179 3300001904 JGI24736J21556_1003835 JGI24736J21556_10038352 229
180 3300003323 rootH1_10279924 rootH1_102799242 229
181 3300005457 Ga0070662_100000790 Ga0070662_1000007908 229
182 3300005539 Ga0068853_100320095 Ga0068853_1003200952 229
183 3300005548 Ga0070665_100000118 Ga0070665_10000011883 229
184 3300009093 Ga0105240_10017291 Ga0105240_100172918 229
185 3300009093 Ga0105240_10281969 Ga0105240_102819692 229
186 3300009098 Ga0105245_10661915 Ga0105245_106619152 229
187 3300009174 Ga0105241_10004960 Ga0105241_100049607 229
188 3300009545 Ga0105237_10002169 Ga0105237_100021698 229
189 3300010375 Ga0105239_10000166 Ga0105239_1000016666 229
190 3300011119 Ga0105246_10027502 Ga0105246_100275023 229
191 3300013102 Ga0157371_10070992 Ga0157371_100709922 229
192 3300013104 Ga0157370_10047122 Ga0157370_100471225 229
193 3300013105 Ga0157369_10195198 Ga0157369_101951982 229
194 3300013307 Ga0157372_10019063 Ga0157372_100190632 229
195 3300014745 Ga0157377_10010267 Ga0157377_100102673 229
196 3300025904 Ga0207647_10000231 Ga0207647_1000023146 229
197 3300025911 Ga0207654_10001012 Ga0207654_100010129 229
198 3300025913 Ga0207695_10013341 Ga0207695_100133413 229
199 3300025927 Ga0207687_10345123 Ga0207687_103451231 229
200 3300025933 Ga0207706_10001203 Ga0207706_1000120310 229
201 3300026023 Ga0207677_10223730 Ga0207677_102237301 229
202 3300026041 Ga0207639_10163181 Ga0207639_101631812 229
203 3300028379 Ga0268266_10000121 Ga0268266_1000012173 229
204 3300042005 Ga0439448_0005766 Ga0439448_0005766_854_1579 229
205 iso_pu_bacteria 2857627736 2857629690 229
206 3300046694 Ga0495649_0079372 Ga0495649_0079372_205_903 230
207 iso_pu_bacteria 2739367663 2739647253 230
208 iso_pu_bacteria 2919437846 2919439126 230
209 iso_pu_bacteria 2929177148 2929180734 230
210 iso_pu_bacteria 2945977869 2945983132 230
211 iso_pu_bacteria 2946013367 2946017476 230
212 3300003354 JGI25160J50197_1000425 JGI25160J50197_10004252 231
213 3300005563 Ga0068855_100010187 Ga0068855_1000101877 231
214 3300009093 Ga0105240_10004289 Ga0105240_1000428913 231
215 3300017792 Ga0163161_10000800 Ga0163161_100008006 231
216 3300025302 Ga0207426_1000032 Ga0207426_100003239 231
217 3300025913 Ga0207695_10014435 Ga0207695_100144357 231
218 3300049652 Ga0501202_006206 Ga0501202_006206_172_891 231
219 3300049688 Ga0501259_007778 Ga0501259_007778_245_964 231
220 3300053153 Ga0500616_0026780 Ga0500616_0026780_289_993 231
221 3300013100 Ga0157373_10000678 Ga0157373_100006786 232
222 3300031616 Ga0307508_10240445 Ga0307508_102404452 232
223 3300013104 Ga0157370_10006526 Ga0157370_1000652610 233
224 3300003320 rootH2_10004626 rootH2_100046264 234
225 3300003323 rootH1_10061083 rootH1_100610834 234
226 3300005288 Ga0065714_10002307 Ga0065714_1000230720 234
227 3300005843 Ga0068860_100001478 Ga0068860_1000014782 234
228 3300006358 Ga0068871_100365198 Ga0068871_1003651982 234
229 3300009545 Ga0105237_10826680 Ga0105237_108266802 234
230 3300009551 Ga0105238_10707735 Ga0105238_107077351 234
231 3300010375 Ga0105239_10051414 Ga0105239_100514144 234
232 3300013296 Ga0157374_10112964 Ga0157374_101129644 234
233 3300013306 Ga0163162_10001433 Ga0163162_100014339 234
234 3300014968 Ga0157379_10182336 Ga0157379_101823362 234
235 3300025261 Ga0209233_1012661 Ga0209233_10126612 234
236 3300025924 Ga0207694_10263972 Ga0207694_102639722 234
237 3300026078 Ga0207702_10101511 Ga0207702_101015114 234
238 3300026116 Ga0207674_10271416 Ga0207674_102714162 234
239 3300028381 Ga0268264_10001375 Ga0268264_1000137514 234
240 3300031507 Ga0307509_10145662 Ga0307509_101456622 234
241 3300032004 Ga0307414_10370003 Ga0307414_103700032 234
242 3300049758 Ga0501241_003024 Ga0501241_003024_1367_2116 234
243 3300003322 rootL2_10006864 rootL2_100068642 235
244 3300003322 rootL2_10006865 rootL2_100068653 235
245 3300005458 Ga0070681_10006627 Ga0070681_100066274 235
246 3300006195 Ga0075366_10016896 Ga0075366_100168965 235
247 3300013102 Ga0157371_10000117 Ga0157371_1000011748 235
248 3300031911 Ga0307412_10205705 Ga0307412_102057052 235
249 3300046512 Ga0495610_0004662 Ga0495610_0004662_5406_6131 235
250 3300046558 Ga0495633_0254934 Ga0495633_0254934_62_787 235
251 3300046810 Ga0495660_0012942 Ga0495660_0012942_548_1267 235
252 3300050493 nmdc:mga0k408_61_c1 nmdc:mga0k408_61_c1_3171_3920 235
253 iso_pu_bacteria 2599185184 2599479931 235
254 iso_pu_bacteria 2852623160 2852626225 235
255 iso_pu_bacteria 2884933994 2884934679 235
256 iso_pu_bacteria 2919437846 2919440392 235
257 iso_pu_bacteria 2928078545 2928081061 235
258 iso_pu_bacteria 2928147474 2928152519 235
259 iso_pu_bacteria 2932082852 2932088464 235
260 3300005327 Ga0070658_10000008 Ga0070658_10000008169 236
261 3300013104 Ga0157370_10018299 Ga0157370_100182994 236
262 3300013104 Ga0157370_10024043 Ga0157370_100240432 236
263 3300025909 Ga0207705_10000026 Ga0207705_10000026171 236
264 3300031548 Ga0307408_100000464 Ga0307408_10000046434 236
265 3300041997 Ga0439431_0003046 Ga0439431_0003046_2909_3664 236
266 iso_pu_bacteria 2977232053 2977234036 236
267 3300003781 Ga0055536_1000001 Ga0055536_1000001491 237
268 3300003791 Ga0055530_10004526 Ga0055530_100045263 237
269 3300005339 Ga0070660_100409965 Ga0070660_1004099652 237
270 3300005366 Ga0070659_100009688 Ga0070659_1000096883 237
271 3300013102 Ga0157371_10001854 Ga0157371_1000185417 237
272 3300013104 Ga0157370_10022433 Ga0157370_100224333 237
273 3300013104 Ga0157370_10040242 Ga0157370_100402423 237
274 3300013104 Ga0157370_10104960 Ga0157370_101049602 237
275 3300013308 Ga0157375_10047594 Ga0157375_100475942 237
276 3300017792 Ga0163161_10001299 Ga0163161_100012997 237
277 3300025292 Ga0209676_1000008 Ga0209676_1000008372 237
278 3300025298 Ga0209050_1000055 Ga0209050_100005540 237
279 3300025919 Ga0207657_10326634 Ga0207657_103266342 237
280 3300047472 Ga0495686_0001903 Ga0495686_0001903_6252_6977 237
281 3300005339 Ga0070660_100075742 Ga0070660_1000757422 238
282 3300005366 Ga0070659_100020672 Ga0070659_1000206722 238
283 3300005577 Ga0068857_100012630 Ga0068857_1000126305 238
284 3300005614 Ga0068856_100055518 Ga0068856_1000555185 238
285 3300009545 Ga0105237_10002011 Ga0105237_1000201113 238
286 3300013307 Ga0157372_10871204 Ga0157372_108712042 238
287 3300014497 Ga0182008_10000294 Ga0182008_1000029425 238
288 3300015261 Ga0182006_1000349 Ga0182006_100034924 238
289 3300017792 Ga0163161_10115883 Ga0163161_101158832 238
290 3300021384 Ga0213876_10081162 Ga0213876_100811623 238
291 3300025904 Ga0207647_10000071 Ga0207647_1000007127 238
292 3300025932 Ga0207690_10022923 Ga0207690_100229232 238
293 3300026078 Ga0207702_10039219 Ga0207702_100392195 238
294 3300026116 Ga0207674_10048242 Ga0207674_100482424 238
295 3300037312 Ga0395899_0000024 Ga0395899_0000024_305496_306245 238
296 3300039437 Ga0436365_0866629 Ga0436365_0866629_822_1556 238
297 3300046471 Ga0495650_0024651 Ga0495650_0024651_1569_2291 238
298 3300047472 Ga0495686_0000112 Ga0495686_0000112_102712_103434 238
299 3300001989 JGI24739J22299_10014648 JGI24739J22299_100146481 239
300 3300001989 JGI24739J22299_10014958 JGI24739J22299_100149583 239
301 3300001990 JGI24737J22298_10000815 JGI24737J22298_100008157 239
302 3300002067 JGI24735J21928_10000005 JGI24735J21928_1000000516 239
303 3300002737 JGI25162J39368_1000016 JGI25162J39368_100001642 239
304 3300002741 JGI25157J39369_1002760 JGI25157J39369_10027605 239
305 3300003322 rootL2_10028123 rootL2_100281232 239
306 3300003323 rootH1_10192598 rootH1_101925983 239
307 3300005288 Ga0065714_10080932 Ga0065714_100809322 239
308 3300005327 Ga0070658_10022913 Ga0070658_100229134 239
309 3300005329 Ga0070683_100118318 Ga0070683_1001183181 239
310 3300005336 Ga0070680_100006228 Ga0070680_10000622811 239
311 3300005530 Ga0070679_100002383 Ga0070679_10000238315 239
312 3300005530 Ga0070679_100104490 Ga0070679_1001044901 239
313 3300005535 Ga0070684_100552826 Ga0070684_1005528261 239
314 3300005539 Ga0068853_100254964 Ga0068853_1002549642 239
315 3300005563 Ga0068855_100000155 Ga0068855_10000015545 239
316 3300005563 Ga0068855_100040341 Ga0068855_1000403412 239
317 3300005563 Ga0068855_100050668 Ga0068855_1000506682 239
318 3300005578 Ga0068854_100316558 Ga0068854_1003165583 239
319 3300005614 Ga0068856_100000371 Ga0068856_10000037116 239
320 3300006195 Ga0075366_10000248 Ga0075366_1000024814 239
321 3300006195 Ga0075366_10000835 Ga0075366_1000083514 239
322 3300009093 Ga0105240_10000371 Ga0105240_1000037121 239
323 3300009093 Ga0105240_10138905 Ga0105240_101389052 239
324 3300009093 Ga0105240_10426732 Ga0105240_104267322 239
325 3300009174 Ga0105241_10026855 Ga0105241_100268552 239
326 3300009545 Ga0105237_10000632 Ga0105237_1000063243 239
327 3300009545 Ga0105237_10035982 Ga0105237_100359822 239
328 3300009545 Ga0105237_10042926 Ga0105237_100429262 239
329 3300009545 Ga0105237_10068456 Ga0105237_100684564 239
330 3300009545 Ga0105237_10185420 Ga0105237_101854202 239
331 3300009551 Ga0105238_10047634 Ga0105238_100476342 239
332 3300010375 Ga0105239_10000478 Ga0105239_1000047846 239
333 3300010375 Ga0105239_10002482 Ga0105239_1000248224 239
334 3300010375 Ga0105239_10598080 Ga0105239_105980802 239
335 3300013100 Ga0157373_10000034 Ga0157373_10000034104 239
336 3300013102 Ga0157371_10012224 Ga0157371_100122242 239
337 3300013297 Ga0157378_10004388 Ga0157378_100043887 239
338 3300013297 Ga0157378_10607636 Ga0157378_106076362 239
339 3300013306 Ga0163162_10034166 Ga0163162_100341662 239
340 3300013306 Ga0163162_10047890 Ga0163162_100478905 239
341 3300013306 Ga0163162_10791067 Ga0163162_107910671 239
342 3300013307 Ga0157372_10000632 Ga0157372_1000063229 239
343 3300013307 Ga0157372_10003372 Ga0157372_100033722 239
344 3300013308 Ga0157375_10004936 Ga0157375_100049368 239
345 3300017792 Ga0163161_10012376 Ga0163161_100123766 239
346 3300025233 Ga0209437_100262 Ga0209437_10026241 239
347 3300025250 Ga0209026_1000225 Ga0209026_100022515 239
348 3300025250 Ga0209026_1003123 Ga0209026_10031232 239
349 3300025909 Ga0207705_10033906 Ga0207705_100339062 239
350 3300025913 Ga0207695_10364437 Ga0207695_103644372 239
351 3300025913 Ga0207695_10393057 Ga0207695_103930572 239
352 3300025914 Ga0207671_10006512 Ga0207671_1000651210 239
353 3300025914 Ga0207671_10030644 Ga0207671_100306443 239
354 3300025914 Ga0207671_10554174 Ga0207671_105541741 239
355 3300025921 Ga0207652_10008028 Ga0207652_100080282 239
356 3300025944 Ga0207661_10695096 Ga0207661_106950962 239
357 3300025949 Ga0207667_10000953 Ga0207667_100009537 239
358 3300025949 Ga0207667_10265836 Ga0207667_102658362 239
359 3300025981 Ga0207640_10329459 Ga0207640_103294591 239
360 3300026078 Ga0207702_10000163 Ga0207702_1000016333 239
361 3300028794 Ga0307515_10000081 Ga0307515_1000008147 239
362 3300028794 Ga0307515_10025142 Ga0307515_100251422 239
363 3300028794 Ga0307515_10218049 Ga0307515_102180492 239
364 3300028800 Ga0265338_10168222 Ga0265338_101682222 239
365 3300031911 Ga0307412_10213335 Ga0307412_102133352 239
366 3300032004 Ga0307414_10034467 Ga0307414_100344672 239
367 3300032004 Ga0307414_10345679 Ga0307414_103456792 239
368 3300032004 Ga0307414_10606160 Ga0307414_106061601 239
369 3300033179 Ga0307507_10002452 Ga0307507_1000245212 239
370 3300037312 Ga0395899_0000027 Ga0395899_0000027_104249_104989 239
371 3300044712 Ga0453684_0525683 Ga0453684_0525683_311_1033 239
372 3300046459 Ga0495629_0083670 Ga0495629_0083670_1125_1850 239
373 3300046460 Ga0495638_0026765 Ga0495638_0026765_1312_2037 239
374 3300046460 Ga0495638_0074641 Ga0495638_0074641_349_1086 239
375 3300046462 Ga0495651_0062374 Ga0495651_0062374_1523_2248 239
376 3300046471 Ga0495650_0001672 Ga0495650_0001672_15124_15861 239
377 3300046492 Ga0495585_0000170 Ga0495585_0000170_48699_49424 239
378 3300046492 Ga0495585_0000359 Ga0495585_0000359_14829_15563 239
379 3300046506 Ga0495583_0151649 Ga0495583_0151649_37_774 239
380 3300046507 Ga0495606_0000074 Ga0495606_0000074_15723_16460 239
381 3300046507 Ga0495606_0005856 Ga0495606_0005856_4673_5398 239
382 3300046507 Ga0495606_0134294 Ga0495606_0134294_671_1399 239
383 3300046512 Ga0495610_0054352 Ga0495610_0054352_1118_1855 239
384 3300046513 Ga0495616_0000883 Ga0495616_0000883_11615_12340 239
385 3300046513 Ga0495616_0002487 Ga0495616_0002487_10271_11008 239
386 3300046516 Ga0495628_0410442 Ga0495628_0410442_177_902 239
387 3300046524 Ga0495648_0020240 Ga0495648_0020240_2371_3096 239
388 3300046524 Ga0495648_0108630 Ga0495648_0108630_313_1038 239
389 3300046529 Ga0495652_0422606 Ga0495652_0422606_101_838 239
390 3300046538 Ga0495609_0011609 Ga0495609_0011609_1188_1913 239
391 3300046538 Ga0495609_0025947 Ga0495609_0025947_291_1028 239
392 3300046558 Ga0495633_0000006 Ga0495633_0000006_176338_177063 239
393 3300046616 Ga0495668_0000011 Ga0495668_0000011_38948_39673 239
394 3300046616 Ga0495668_0190190 Ga0495668_0190190_19_756 239
395 3300046660 Ga0495625_0000239 Ga0495625_0000239_77797_78522 239
396 3300046660 Ga0495625_0000270 Ga0495625_0000270_65007_65744 239
397 3300046660 Ga0495625_0002864 Ga0495625_0002864_4188_4913 239
398 3300046660 Ga0495625_0016250 Ga0495625_0016250_2493_3218 239
399 3300046660 Ga0495625_0039623 Ga0495625_0039623_128_853 239
400 3300046665 Ga0495661_0003653 Ga0495661_0003653_9885_10613 239
401 3300046665 Ga0495661_0005931 Ga0495661_0005931_3930_4667 239
402 3300046665 Ga0495661_0160712 Ga0495661_0160712_187_915 239
403 3300046683 Ga0495658_0229730 Ga0495658_0229730_259_984 239
404 3300046692 Ga0495671_0066510 Ga0495671_0066510_87_824 239
405 3300046694 Ga0495649_0000082 Ga0495649_0000082_66227_66964 239
406 3300046809 Ga0495600_0132355 Ga0495600_0132355_429_1154 239
407 3300047443 Ga0495687_008257 Ga0495687_008257_216_941 239
408 3300047443 Ga0495687_023638 Ga0495687_023638_26_763 239
409 3300048089 Ga0495614_0094101 Ga0495614_0094101_112_837 239
410 3300049459 Ga0495678_003539 Ga0495678_003539_8145_8870 239
411 3300053123 Ga0500614_008705 Ga0500614_008705_215_940 239
412 3300053125 Ga0500618_000273 Ga0500618_000273_18647_19372 239
413 3300053157 Ga0500624_000313 Ga0500624_000313_7113_7838 239
414 3300002741 JGI25157J39369_1002614 JGI25157J39369_10026142 240
415 3300005339 Ga0070660_100055694 Ga0070660_1000556942 240
416 3300005539 Ga0068853_100130508 Ga0068853_1001305083 240
417 3300005563 Ga0068855_100002647 Ga0068855_10000264715 240
418 3300005563 Ga0068855_100007287 Ga0068855_1000072873 240
419 3300005614 Ga0068856_100082027 Ga0068856_1000820272 240
420 3300005614 Ga0068856_100351552 Ga0068856_1003515521 240
421 3300009093 Ga0105240_10062117 Ga0105240_100621174 240
422 3300009093 Ga0105240_10101416 Ga0105240_101014162 240
423 3300010375 Ga0105239_10000865 Ga0105239_100008657 240
424 3300013104 Ga0157370_10089811 Ga0157370_100898114 240
425 3300025250 Ga0209026_1000358 Ga0209026_100035815 240
426 3300025913 Ga0207695_10094760 Ga0207695_100947602 240
427 3300025913 Ga0207695_10101179 Ga0207695_101011792 240
428 3300025913 Ga0207695_10257484 Ga0207695_102574842 240
429 3300025919 Ga0207657_10023346 Ga0207657_100233463 240
430 3300025949 Ga0207667_10000015 Ga0207667_10000015237 240
431 3300026078 Ga0207702_10005501 Ga0207702_100055016 240
432 3300026078 Ga0207702_10144506 Ga0207702_101445063 240
433 3300031911 Ga0307412_10469042 Ga0307412_104690421 240
434 3300037418 Ga0395900_0028740 Ga0395900_0028740_2580_3308 240
435 3300037466 Ga0395898_0074989 Ga0395898_0074989_1188_1916 240
436 3300037471 Ga0395905_0009775 Ga0395905_0009775_6921_7649 240
437 3300038443 Ga0395901_0003259 Ga0395901_0003259_235_963 240
438 3300046523 Ga0495644_0002931 Ga0495644_0002931_5701_6429 240
439 3300047447 Ga0495685_015598 Ga0495685_015598_688_1416 240
440 3300053156 Ga0500622_0000303 Ga0500622_0000303_393_1139 240
441 3300003320 rootH2_10183865 rootH2_101838651 241
442 3300005616 Ga0068852_100013978 Ga0068852_1000139787 241
443 3300006353 Ga0075370_10206228 Ga0075370_102062281 241
444 3300009174 Ga0105241_10124654 Ga0105241_101246541 241
445 3300013104 Ga0157370_10003772 Ga0157370_1000377214 241
446 3300015682 Ga0183373_1002 Ga0183373_1002765 241
447 3300025911 Ga0207654_10002331 Ga0207654_100023313 241
448 3300025911 Ga0207654_10456843 Ga0207654_104568431 241
449 3300025913 Ga0207695_10000142 Ga0207695_1000014262 241
450 3300025914 Ga0207671_10000110 Ga0207671_1000011043 241
451 3300026142 Ga0207698_10361431 Ga0207698_103614311 241
452 3300046507 Ga0495606_0004155 Ga0495606_0004155_3877_4608 241
453 3300048925 Ga0496122_0004298 Ga0496122_0004298_4475_5224 241
454 3300048926 Ga0496123_0005429 Ga0496123_0005429_5567_6316 241
455 3300048928 Ga0496125_0028448 Ga0496125_0028448_2988_3737 241
456 3300003320 rootH2_10113384 rootH2_101133844 242
457 3300003323 rootH1_10071187 rootH1_100711873 242
458 3300009093 Ga0105240_10069664 Ga0105240_100696643 242
459 3300009174 Ga0105241_10079889 Ga0105241_100798892 242
460 3300009545 Ga0105237_10111182 Ga0105237_101111824 242
461 3300009551 Ga0105238_10059039 Ga0105238_100590392 242
462 3300010375 Ga0105239_10026667 Ga0105239_100266676 242
463 3300025904 Ga0207647_10116980 Ga0207647_101169802 242
464 3300025911 Ga0207654_10088415 Ga0207654_100884152 242
465 3300025913 Ga0207695_10017626 Ga0207695_100176267 242
466 3300025914 Ga0207671_10046584 Ga0207671_100465842 242
467 3300025924 Ga0207694_10058698 Ga0207694_100586982 242
468 iso_pu_bacteria 2902048731 2902051305 242
469 3300001915 JGI24741J21665_1025892 JGI24741J21665_10258921 244
470 3300001979 JGI24740J21852_10060740 JGI24740J21852_100607402 244
471 3300005455 Ga0070663_100012482 Ga0070663_1000124822 244
472 3300013105 Ga0157369_10001802 Ga0157369_1000180215 244
473 3300013307 Ga0157372_10000039 Ga0157372_1000003912 244
474 3300026067 Ga0207678_10202106 Ga0207678_102021062 244
475 3300032004 Ga0307414_10000344 Ga0307414_100003449 244
476 3300044656 Ga0466969_0018232 Ga0466969_0018232_2470_3219 244
477 3300044693 Ga0466961_0008755 Ga0466961_0008755_120_869 244
478 iso_pu_bacteria 2585427687 2586208796 244
479 iso_pu_bacteria 2738541302 2738854856 244
480 iso_pu_bacteria 2739367651 2739587030 244
481 iso_pu_bacteria 2739367656 2739618220 244
482 iso_pu_bacteria 2739367663 2739646327 244
483 iso_pu_bacteria 2775506987 2776615559 244
484 iso_pu_bacteria 2818991437 2819547483 244
485 iso_pu_bacteria 2842722452 2842727524 244
486 iso_pu_bacteria 2842909656 2842911267 244
487 iso_pu_bacteria 2849281842 2849286477 244
488 iso_pu_bacteria 2857627736 2857631490 244
489 iso_pu_bacteria 2904445276 2904449717 244
490 iso_pu_bacteria 2919186247 2919190749 244
491 iso_pu_bacteria 2939664404 2939669041 244
492 iso_pu_bacteria 2945997725 2946003194 244
493 iso_pu_bacteria 2954016120 2954020051 244
494 iso_pu_bacteria 2738541283 2738759095 245
495 iso_pu_bacteria 2738541284 2738761795 245
496 iso_pu_bacteria 2738543023 2739302297 245
497 iso_pu_bacteria 2852627209 2852631044 245
498 3300028794 Ga0307515_10046709 Ga0307515_100467092 246
499 3300049776 Ga0501280_013750 Ga0501280_013750_284_1030 247
500 2162886007 SwRhRL2b_contig_3558340 SwRhRL2b_0134.00007210 248
501 3300002773 JGI25152J39213_1000054 JGI25152J39213_100005440 248
502 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003252 248
503 3300002774 JGI25150J39212_1000004 JGI25150J39212_1000004372 248
504 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002252 248
505 3300003215 JGI25153J46596_10000015 JGI25153J46596_1000001563 248
506 3300003781 Ga0055536_1000006 Ga0055536_1000006156 248
507 3300003791 Ga0055530_10003396 Ga0055530_100033965 248
508 3300005288 Ga0065714_10022472 Ga0065714_100224722 248
509 3300005289 Ga0065704_10001668 Ga0065704_100016683 248
510 3300005563 Ga0068855_100085967 Ga0068855_1000859674 248
511 3300013100 Ga0157373_10019649 Ga0157373_100196492 248
512 3300013100 Ga0157373_10039002 Ga0157373_100390023 248
513 3300013102 Ga0157371_10001520 Ga0157371_1000152012 248
514 3300013104 Ga0157370_10036382 Ga0157370_100363824 248
515 3300013104 Ga0157370_10134462 Ga0157370_101344622 248
516 3300013105 Ga0157369_10000047 Ga0157369_1000004793 248
517 3300013306 Ga0163162_10000895 Ga0163162_1000089521 248
518 3300013308 Ga0157375_10029791 Ga0157375_100297913 248
519 3300013308 Ga0157375_10415300 Ga0157375_104153002 248
520 3300014497 Ga0182008_10000914 Ga0182008_100009141 248
521 3300015261 Ga0182006_1000179 Ga0182006_10001792 248
522 3300015261 Ga0182006_1000182 Ga0182006_10001822 248
523 3300015262 Ga0182007_10000005 Ga0182007_10000005178 248
524 3300015262 Ga0182007_10011302 Ga0182007_100113022 248
525 3300015262 Ga0182007_10019662 Ga0182007_100196622 248
526 3300017792 Ga0163161_10000830 Ga0163161_100008303 248
527 3300017792 Ga0163161_10000838 Ga0163161_1000083820 248
528 3300017792 Ga0163161_10002768 Ga0163161_100027682 248
529 3300025245 Ga0207425_1000003 Ga0207425_1000003590 248
530 3300025258 Ga0209129_1000014 Ga0209129_1000014243 248
531 3300025292 Ga0209676_1000039 Ga0209676_1000039248 248
532 3300025294 Ga0209025_1000007 Ga0209025_1000007589 248
533 3300025297 Ga0209758_1000012 Ga0209758_1000012590 248
534 3300025298 Ga0209050_1000033 Ga0209050_1000033200 248
535 3300025949 Ga0207667_10681475 Ga0207667_106814751 248
536 3300031731 Ga0307405_10000009 Ga0307405_1000000995 248
537 3300031903 Ga0307407_10000001 Ga0307407_10000001272 248
538 3300031995 Ga0307409_100063639 Ga0307409_1000636394 248
539 3300032002 Ga0307416_100000008 Ga0307416_100000008117 248
540 3300046507 Ga0495606_0035081 Ga0495606_0035081_551_1300 248
541 3300046512 Ga0495610_0000696 Ga0495610_0000696_26210_26959 248
542 3300046520 Ga0495637_0005787 Ga0495637_0005787_4829_5578 248
543 3300046558 Ga0495633_0039283 Ga0495633_0039283_352_1101 248
544 3300048918 Ga0496115_0067953 Ga0496115_0067953_1353_2105 248
545 2162886007 SwRhRL2b_contig_2665874 SwRhRL2b_0027.00000340 249
546 3300005288 Ga0065714_10002609 Ga0065714_1000260923 249
547 3300005288 Ga0065714_10065739 Ga0065714_100657395 249
548 3300005288 Ga0065714_10074750 Ga0065714_100747501 249
549 3300005288 Ga0065714_10108263 Ga0065714_101082632 249
550 3300005289 Ga0065704_10070323 Ga0065704_1007032311 249
551 3300013100 Ga0157373_10000262 Ga0157373_1000026220 249
552 3300013102 Ga0157371_10003549 Ga0157371_100035494 249
553 3300013104 Ga0157370_10021228 Ga0157370_100212283 249
554 3300014497 Ga0182008_10000002 Ga0182008_10000002113 249
555 3300015261 Ga0182006_1003312 Ga0182006_10033128 249
556 3300015261 Ga0182006_1012363 Ga0182006_10123632 249
557 3300030744 Ga0316181_1252002 Ga0316181_12520022 249
558 3300031911 Ga0307412_10000050 Ga0307412_1000005060 249
559 3300032004 Ga0307414_10003900 Ga0307414_100039003 249
560 3300032004 Ga0307414_10035597 Ga0307414_100355974 249
561 3300049758 Ga0501241_001867 Ga0501241_001867_1298_2047 249
562 3300053093 Ga0500651_0000350 Ga0500651_0000350_13719_14468 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

19

126

0.93

PF04397

LytTR

LytTr DNA-binding domain

161

252

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qv0-assembly1.cif.gz_A crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae 0.9164 4 121
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9137 2 115
4ldz-assembly1.cif.gz_B crystal structure of the full-length response regulator desr in the active state 0.9032 2 118
7ssi-assembly1.cif.gz_C crystal structure of the desk:desr-q10a complex in the phosphotransfer state 0.8997 2 118
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.8983 3 115
ID Description Score Start End Superfamily
af_P60611_135_244_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9485 146 244 2.40.50.1020
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9398 146 214 2.40.50.40
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9146 146 214 2.40.50.40
2qv0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9146 4 121 3.40.50.2300
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9137 2 115 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A5J4T1K6-F1-model_v4 HTH LytTR-type domain-containing protein 0.9839 157 245 GO:0000156
GO:0003677
AF-A0A1J5SZP7-F1-model_v4 LytTr DNA-binding domain protein 0.9818 145 247 GO:0000156
GO:0003677
AF-A0A4Q5YUE0-F1-model_v4 LytTR family transcriptional regulator 0.9806 147 244 GO:0000156
GO:0003677
AF-A0A0F8ZVN2-F1-model_v4 HTH LytTR-type domain-containing protein 0.9734 157 247 GO:0000156
GO:0003677
AF-A0A6N6KK57-F1-model_v4 LytTR family transcriptional regulator 0.9634 147 244 GO:0000156
GO:0003677

Feature Viewer

pLDDT pTM Quality
83.83 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map