F463904
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 562 | 230 | 562 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100997594|Ga0070698_1009975942 |
| Length | 170 |
| Sequence | MTKRKIGCFNFEQIFNIMMGMKTVLAFLLITVTTITANAQLNPVSWSFSAKKIADKTYEVHLTASMQSGWHLYSQTQPDDAIAIPTGFKINNNPLLLLEGKIKEVGKMEKFHDAKLEVSANQYSEKVDFVQVVKLKANAKTNLTGSVEYQTCDDKKCLPPKTVNFTIPVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 143 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 147 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 148 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 155 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 156 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 157 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 158 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 162 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 163 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 164 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 165 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 166 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 167 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 168 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 169 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 170 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 171 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 172 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 173 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 180 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 181 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 183 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 209 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 210 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 211 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 218 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 219 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 226 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 227 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 228 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 229 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.86 |
| Metatranscriptomes | 2.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.96 |
| Nodule | 0 |
| Rhizoplane | 1.07 |
| Rhizosphere | 96.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_5087598 | 2162886011 | Bacteria | 3694 |
| 2 | MRS1b_contig_9194533 | 2162886011 | Bacteria | 2280 |
| 3 | MBSR1b_contig_3015194 | 2162886012 | Bacteria | 1241 |
| 4 | MBSR1b_contig_3057618 | 2162886012 | Bacteria | 2518 |
| 5 | CNXas_1001701 | 3300000545 | Unclassified | 1483 |
| 6 | JGI24744J21845_10005535 | 3300002077 | Bacteria | 2613 |
| 7 | JGI24033J26618_1013705 | 3300002155 | Unclassified | 987 |
| 8 | rootL2_10349925 | 3300003322 | Bacteria | 2134 |
| 9 | Ga0065704_10347901 | 3300005289 | Bacteria | 814 |
| 10 | Ga0065712_10000839 | 3300005290 | Bacteria | 11700 |
| 11 | Ga0065715_10105240 | 3300005293 | Bacteria | 2900 |
| 12 | Ga0065715_10185083 | 3300005293 | Unclassified | 1450 |
| 13 | Ga0065715_10272145 | 3300005293 | Bacteria | 1108 |
| 14 | Ga0065707_10005177 | 3300005295 | Bacteria | 3920 |
| 15 | Ga0070676_10002798 | 3300005328 | Bacteria | 9015 |
| 16 | Ga0070676_10624832 | 3300005328 | Bacteria | 779 |
| 17 | Ga0070670_100037744 | 3300005331 | Bacteria | 4155 |
| 18 | Ga0070670_100173254 | 3300005331 | Bacteria | 1872 |
| 19 | Ga0070670_100260621 | 3300005331 | Bacteria | 1511 |
| 20 | Ga0070670_100322215 | 3300005331 | Bacteria | 1354 |
| 21 | Ga0070670_100695378 | 3300005331 | Unclassified | 914 |
| 22 | Ga0070677_10023349 | 3300005333 | Bacteria | 2289 |
| 23 | Ga0068869_100005837 | 3300005334 | Bacteria | 7771 |
| 24 | Ga0068869_100006670 | 3300005334 | Bacteria | 7333 |
| 25 | Ga0068869_100057841 | 3300005334 | Unclassified | 2832 |
| 26 | Ga0068869_100080736 | 3300005334 | Bacteria | 2427 |
| 27 | Ga0068869_100120115 | 3300005334 | Unclassified | 2009 |
| 28 | Ga0068869_100349133 | 3300005334 | Bacteria | 1205 |
| 29 | Ga0070666_10117862 | 3300005335 | Bacteria | 1840 |
| 30 | Ga0070666_10245172 | 3300005335 | Bacteria | 1268 |
| 31 | Ga0068868_100002313 | 3300005338 | Bacteria | 13182 |
| 32 | Ga0068868_100748030 | 3300005338 | Bacteria | 878 |
| 33 | Ga0068868_100906180 | 3300005338 | Unclassified | 801 |
| 34 | Ga0070689_100013924 | 3300005340 | Bacteria | 5834 |
| 35 | Ga0070689_100016475 | 3300005340 | Bacteria | 5409 |
| 36 | Ga0070689_100124028 | 3300005340 | Bacteria | 2065 |
| 37 | Ga0070689_100189998 | 3300005340 | Unclassified | 1672 |
| 38 | Ga0070689_100667508 | 3300005340 | Bacteria | 905 |
| 39 | Ga0070687_100144083 | 3300005343 | Bacteria | 1391 |
| 40 | Ga0070687_100263734 | 3300005343 | Bacteria | 1076 |
| 41 | Ga0070687_100303300 | 3300005343 | Bacteria | 1014 |
| 42 | Ga0070687_100342396 | 3300005343 | Unclassified | 962 |
| 43 | Ga0070661_100816859 | 3300005344 | Bacteria | 766 |
| 44 | Ga0070692_10237881 | 3300005345 | Unclassified | 1084 |
| 45 | Ga0070668_100084137 | 3300005347 | Bacteria | 2498 |
| 46 | Ga0070669_100027944 | 3300005353 | Bacteria | 4061 |
| 47 | Ga0070669_100073476 | 3300005353 | Bacteria | 2533 |
| 48 | Ga0070669_100137520 | 3300005353 | Bacteria | 1880 |
| 49 | Ga0070669_100400808 | 3300005353 | Bacteria | 1122 |
| 50 | Ga0070669_100485856 | 3300005353 | Bacteria | 1023 |
| 51 | Ga0070669_100861139 | 3300005353 | Bacteria | 772 |
| 52 | Ga0070675_100006621 | 3300005354 | Bacteria | 8905 |
| 53 | Ga0070675_100023572 | 3300005354 | Bacteria | 4923 |
| 54 | Ga0070675_100060506 | 3300005354 | Bacteria | 3127 |
| 55 | Ga0070675_100133933 | 3300005354 | Bacteria | 2114 |
| 56 | Ga0070675_100422499 | 3300005354 | Bacteria | 1192 |
| 57 | Ga0070675_101260247 | 3300005354 | Bacteria | 681 |
| 58 | Ga0070671_100158811 | 3300005355 | Bacteria | 1911 |
| 59 | Ga0070671_101078297 | 3300005355 | Bacteria | 705 |
| 60 | Ga0070674_100165290 | 3300005356 | Bacteria | 1682 |
| 61 | Ga0070674_100838148 | 3300005356 | Bacteria | 797 |
| 62 | Ga0070674_101065979 | 3300005356 | Bacteria | 712 |
| 63 | Ga0070674_101543854 | 3300005356 | Bacteria | 598 |
| 64 | Ga0070673_100006390 | 3300005364 | Bacteria | 7659 |
| 65 | Ga0070673_100103092 | 3300005364 | Bacteria | 2353 |
| 66 | Ga0070673_100117523 | 3300005364 | Bacteria | 2213 |
| 67 | Ga0070673_100345696 | 3300005364 | Bacteria | 1319 |
| 68 | Ga0070673_100398153 | 3300005364 | Bacteria | 1231 |
| 69 | Ga0070673_100674480 | 3300005364 | Bacteria | 948 |
| 70 | Ga0070688_100004101 | 3300005365 | Bacteria | 7559 |
| 71 | Ga0070688_100142393 | 3300005365 | Bacteria | 1630 |
| 72 | Ga0070688_100176351 | 3300005365 | Bacteria | 1479 |
| 73 | Ga0070688_100178403 | 3300005365 | Bacteria | 1471 |
| 74 | Ga0070688_100539065 | 3300005365 | Bacteria | 885 |
| 75 | Ga0070688_100590900 | 3300005365 | Unclassified | 849 |
| 76 | Ga0070659_100565597 | 3300005366 | Bacteria | 974 |
| 77 | Ga0070667_100069846 | 3300005367 | Unclassified | 2990 |
| 78 | Ga0070667_100544245 | 3300005367 | Bacteria | 1067 |
| 79 | Ga0070701_10112236 | 3300005438 | Unclassified | 1525 |
| 80 | Ga0070700_100396044 | 3300005441 | Unclassified | 1037 |
| 81 | Ga0070700_100511568 | 3300005441 | Unclassified | 926 |
| 82 | Ga0068867_100017470 | 3300005459 | Bacteria | 5096 |
| 83 | Ga0068867_100084108 | 3300005459 | Bacteria | 2403 |
| 84 | Ga0068867_100310207 | 3300005459 | Bacteria | 1303 |
| 85 | Ga0068867_101245668 | 3300005459 | Bacteria | 685 |
| 86 | Ga0070685_10003294 | 3300005466 | Bacteria | 8205 |
| 87 | Ga0070685_10031299 | 3300005466 | Bacteria | 2972 |
| 88 | Ga0070685_10051327 | 3300005466 | Bacteria | 2384 |
| 89 | Ga0070685_10158664 | 3300005466 | Unclassified | 1440 |
| 90 | Ga0070685_10210268 | 3300005466 | Bacteria | 1269 |
| 91 | Ga0070685_10365115 | 3300005466 | Bacteria | 991 |
| 92 | Ga0070685_10645325 | 3300005466 | Bacteria | 766 |
| 93 | Ga0070698_100063699 | 3300005471 | Bacteria | 3718 |
| 94 | Ga0070698_100997594 | 3300005471 | Bacteria | 784 |
| 95 | Ga0070698_101697246 | 3300005471 | Bacteria | 584 |
| 96 | Ga0070684_100003115 | 3300005535 | Bacteria | 12384 |
| 97 | Ga0070684_100404354 | 3300005535 | Bacteria | 1259 |
| 98 | Ga0068853_100014221 | 3300005539 | Bacteria | 6512 |
| 99 | Ga0068853_100051862 | 3300005539 | Bacteria | 3532 |
| 100 | Ga0068853_100500323 | 3300005539 | Unclassified | 1147 |
| 101 | Ga0070672_100141359 | 3300005543 | Bacteria | 1986 |
| 102 | Ga0070672_100172398 | 3300005543 | Bacteria | 1800 |
| 103 | Ga0070672_100205057 | 3300005543 | Bacteria | 1650 |
| 104 | Ga0070672_100293814 | 3300005543 | Bacteria | 1376 |
| 105 | Ga0070672_100308648 | 3300005543 | Unclassified | 1342 |
| 106 | Ga0070672_100496967 | 3300005543 | Bacteria | 1055 |
| 107 | Ga0070686_100047270 | 3300005544 | Bacteria | 2720 |
| 108 | Ga0070686_100055575 | 3300005544 | Bacteria | 2536 |
| 109 | Ga0070686_100319185 | 3300005544 | Bacteria | 1158 |
| 110 | Ga0070665_100026771 | 3300005548 | Bacteria | 5809 |
| 111 | Ga0070665_100038466 | 3300005548 | Bacteria | 4809 |
| 112 | Ga0070704_100195564 | 3300005549 | Unclassified | 1629 |
| 113 | Ga0070664_100081185 | 3300005564 | Bacteria | 2794 |
| 114 | Ga0070664_100238860 | 3300005564 | Bacteria | 1631 |
| 115 | Ga0068857_100058130 | 3300005577 | Bacteria | 3433 |
| 116 | Ga0068857_100144949 | 3300005577 | Unclassified | 2149 |
| 117 | Ga0068857_100409161 | 3300005577 | Bacteria | 1263 |
| 118 | Ga0068854_100012895 | 3300005578 | Bacteria | 5475 |
| 119 | Ga0068854_100735274 | 3300005578 | Bacteria | 855 |
| 120 | Ga0068854_100773130 | 3300005578 | Bacteria | 835 |
| 121 | Ga0068854_100857070 | 3300005578 | Bacteria | 796 |
| 122 | Ga0068856_100778051 | 3300005614 | Bacteria | 977 |
| 123 | Ga0070702_100312496 | 3300005615 | Bacteria | 1091 |
| 124 | Ga0068852_100034369 | 3300005616 | Bacteria | 4217 |
| 125 | Ga0068852_100105798 | 3300005616 | Bacteria | 2550 |
| 126 | Ga0068852_101260180 | 3300005616 | Bacteria | 761 |
| 127 | Ga0068859_100008920 | 3300005617 | Bacteria | 10129 |
| 128 | Ga0068859_100021622 | 3300005617 | Bacteria | 6456 |
| 129 | Ga0068859_100082520 | 3300005617 | Bacteria | 3257 |
| 130 | Ga0068859_100092544 | 3300005617 | Bacteria | 3075 |
| 131 | Ga0068859_100127521 | 3300005617 | Bacteria | 2615 |
| 132 | Ga0068859_100179724 | 3300005617 | Bacteria | 2198 |
| 133 | Ga0068859_100215664 | 3300005617 | Unclassified | 2007 |
| 134 | Ga0068859_100442204 | 3300005617 | Unclassified | 1396 |
| 135 | Ga0068859_101645173 | 3300005617 | Unclassified | 709 |
| 136 | Ga0068864_100084966 | 3300005618 | Bacteria | 2781 |
| 137 | Ga0068864_100123191 | 3300005618 | Unclassified | 2320 |
| 138 | Ga0068864_101005794 | 3300005618 | Unclassified | 827 |
| 139 | Ga0068864_101747944 | 3300005618 | Unclassified | 627 |
| 140 | Ga0068866_10029579 | 3300005718 | Unclassified | 2621 |
| 141 | Ga0068866_10182261 | 3300005718 | Bacteria | 1241 |
| 142 | Ga0068866_10298507 | 3300005718 | Bacteria | 1005 |
| 143 | Ga0068861_100012180 | 3300005719 | Bacteria | 5995 |
| 144 | Ga0068861_100042253 | 3300005719 | Bacteria | 3415 |
| 145 | Ga0068861_100059967 | 3300005719 | Bacteria | 2915 |
| 146 | Ga0068861_100270121 | 3300005719 | Unclassified | 1460 |
| 147 | Ga0068861_100661429 | 3300005719 | Bacteria | 966 |
| 148 | Ga0068861_100873601 | 3300005719 | Bacteria | 849 |
| 149 | Ga0068851_10005025 | 3300005834 | Bacteria | 5997 |
| 150 | Ga0068851_10109301 | 3300005834 | Bacteria | 1475 |
| 151 | Ga0068851_10176367 | 3300005834 | Unclassified | 1182 |
| 152 | Ga0068870_10002874 | 3300005840 | Bacteria | 7247 |
| 153 | Ga0068870_10052294 | 3300005840 | Bacteria | 2166 |
| 154 | Ga0068870_10138097 | 3300005840 | Bacteria | 1423 |
| 155 | Ga0068870_10174131 | 3300005840 | Bacteria | 1286 |
| 156 | Ga0068870_10319843 | 3300005840 | Bacteria | 986 |
| 157 | Ga0068863_100075494 | 3300005841 | Bacteria | 3189 |
| 158 | Ga0068863_100119799 | 3300005841 | Bacteria | 2509 |
| 159 | Ga0068863_100386484 | 3300005841 | Bacteria | 1367 |
| 160 | Ga0068863_100529403 | 3300005841 | Bacteria | 1162 |
| 161 | Ga0068863_100712880 | 3300005841 | Archaea | 998 |
| 162 | Ga0068858_100444115 | 3300005842 | Unclassified | 1249 |
| 163 | Ga0068858_101717458 | 3300005842 | Bacteria | 620 |
| 164 | Ga0068860_100013054 | 3300005843 | Bacteria | 8154 |
| 165 | Ga0068860_100021634 | 3300005843 | Bacteria | 6227 |
| 166 | Ga0068860_100094883 | 3300005843 | Unclassified | 2843 |
| 167 | Ga0068860_100130883 | 3300005843 | Bacteria | 2407 |
| 168 | Ga0068862_100035100 | 3300005844 | Bacteria | 4244 |
| 169 | Ga0068862_100039350 | 3300005844 | Bacteria | 4015 |
| 170 | Ga0068862_100278401 | 3300005844 | Bacteria | 1532 |
| 171 | Ga0068862_100301648 | 3300005844 | Bacteria | 1474 |
| 172 | Ga0068862_100796241 | 3300005844 | Bacteria | 923 |
| 173 | Ga0070715_10367218 | 3300006163 | Bacteria | 791 |
| 174 | Ga0075366_10174505 | 3300006195 | Bacteria | 1305 |
| 175 | Ga0075366_10487889 | 3300006195 | Bacteria | 761 |
| 176 | Ga0097621_100028195 | 3300006237 | Bacteria | 4425 |
| 177 | Ga0097621_100132172 | 3300006237 | Bacteria | 2125 |
| 178 | Ga0097621_100187367 | 3300006237 | Unclassified | 1790 |
| 179 | Ga0097621_100592309 | 3300006237 | Unclassified | 1013 |
| 180 | Ga0097621_100785940 | 3300006237 | Bacteria | 881 |
| 181 | Ga0075370_10301306 | 3300006353 | Bacteria | 953 |
| 182 | Ga0068871_100046293 | 3300006358 | Bacteria | 3503 |
| 183 | Ga0068871_100061687 | 3300006358 | Bacteria | 3063 |
| 184 | Ga0068871_100141121 | 3300006358 | Bacteria | 2049 |
| 185 | Ga0068871_100993816 | 3300006358 | Unclassified | 781 |
| 186 | Ga0075428_100064504 | 3300006844 | Bacteria | 4011 |
| 187 | Ga0075428_100373899 | 3300006844 | Bacteria | 1528 |
| 188 | Ga0075430_100040211 | 3300006846 | Bacteria | 3958 |
| 189 | Ga0075431_100007533 | 3300006847 | Bacteria | 10836 |
| 190 | Ga0075434_100280972 | 3300006871 | Unclassified | 1684 |
| 191 | Ga0075429_100602584 | 3300006880 | Bacteria | 962 |
| 192 | Ga0068865_100097657 | 3300006881 | Bacteria | 2144 |
| 193 | Ga0068865_100243673 | 3300006881 | Unclassified | 1415 |
| 194 | Ga0068865_100608205 | 3300006881 | Unclassified | 924 |
| 195 | Ga0097620_100008921 | 3300006931 | Bacteria | 10129 |
| 196 | Ga0097620_100021622 | 3300006931 | Bacteria | 6456 |
| 197 | Ga0097620_100082520 | 3300006931 | Bacteria | 3257 |
| 198 | Ga0097620_100092539 | 3300006931 | Bacteria | 3075 |
| 199 | Ga0097620_100127517 | 3300006931 | Bacteria | 2615 |
| 200 | Ga0097620_100179724 | 3300006931 | Bacteria | 2198 |
| 201 | Ga0097620_100215668 | 3300006931 | Unclassified | 2007 |
| 202 | Ga0097620_100442224 | 3300006931 | Unclassified | 1396 |
| 203 | Ga0097620_101644762 | 3300006931 | Unclassified | 709 |
| 204 | Ga0105251_10075659 | 3300009011 | Bacteria | 1563 |
| 205 | Ga0105251_10082619 | 3300009011 | Unclassified | 1483 |
| 206 | Ga0105251_10192332 | 3300009011 | Bacteria | 919 |
| 207 | Ga0111539_10002057 | 3300009094 | Bacteria | 26904 |
| 208 | Ga0111539_10074003 | 3300009094 | Bacteria | 4015 |
| 209 | Ga0111539_10657996 | 3300009094 | Bacteria | 1220 |
| 210 | Ga0111539_10747439 | 3300009094 | Bacteria | 1138 |
| 211 | Ga0105247_10010935 | 3300009101 | Bacteria | 5479 |
| 212 | Ga0105247_10111736 | 3300009101 | Bacteria | 1759 |
| 213 | Ga0105247_10138653 | 3300009101 | Bacteria | 1592 |
| 214 | Ga0114129_10016983 | 3300009147 | Bacteria | 10361 |
| 215 | Ga0114129_10044941 | 3300009147 | Bacteria | 6211 |
| 216 | Ga0105243_10315584 | 3300009148 | Bacteria | 1422 |
| 217 | Ga0105243_11820607 | 3300009148 | Unclassified | 640 |
| 218 | Ga0105241_10618263 | 3300009174 | Bacteria | 980 |
| 219 | Ga0105241_10878340 | 3300009174 | Bacteria | 831 |
| 220 | Ga0105241_10912484 | 3300009174 | Bacteria | 816 |
| 221 | Ga0105242_10021120 | 3300009176 | Bacteria | 5109 |
| 222 | Ga0105242_10045438 | 3300009176 | Bacteria | 3560 |
| 223 | Ga0105242_10047631 | 3300009176 | Bacteria | 3481 |
| 224 | Ga0105242_10082116 | 3300009176 | Bacteria | 2696 |
| 225 | Ga0105242_11904435 | 3300009176 | Bacteria | 635 |
| 226 | Ga0105248_10264267 | 3300009177 | Unclassified | 1937 |
| 227 | Ga0105248_11314942 | 3300009177 | Bacteria | 818 |
| 228 | Ga0105248_11605788 | 3300009177 | Bacteria | 737 |
| 229 | Ga0105237_10002986 | 3300009545 | Bacteria | 20444 |
| 230 | Ga0105237_11146714 | 3300009545 | Bacteria | 784 |
| 231 | Ga0105237_11356340 | 3300009545 | Bacteria | 717 |
| 232 | Ga0105249_10002214 | 3300009553 | Bacteria | 16849 |
| 233 | Ga0105249_10004609 | 3300009553 | Bacteria | 11903 |
| 234 | Ga0105249_10004989 | 3300009553 | Bacteria | 11452 |
| 235 | Ga0105249_10115888 | 3300009553 | Bacteria | 2539 |
| 236 | Ga0105249_10175390 | 3300009553 | Bacteria | 2082 |
| 237 | Ga0105249_10189091 | 3300009553 | Bacteria | 2008 |
| 238 | Ga0105249_10228291 | 3300009553 | Bacteria | 1835 |
| 239 | Ga0105249_10501110 | 3300009553 | Bacteria | 1259 |
| 240 | Ga0105249_10672874 | 3300009553 | Bacteria | 1094 |
| 241 | Ga0105249_10748743 | 3300009553 | Unclassified | 1039 |
| 242 | Ga0105249_10976982 | 3300009553 | Bacteria | 915 |
| 243 | Ga0105239_10507864 | 3300010375 | Bacteria | 1371 |
| 244 | Ga0105246_10030651 | 3300011119 | Bacteria | 3554 |
| 245 | Ga0105246_10705068 | 3300011119 | Bacteria | 885 |
| 246 | Ga0157371_10013093 | 3300013102 | Bacteria | 6315 |
| 247 | Ga0157371_10133716 | 3300013102 | Bacteria | 1765 |
| 248 | Ga0157371_11228560 | 3300013102 | Bacteria | 578 |
| 249 | Ga0157370_10907739 | 3300013104 | Bacteria | 799 |
| 250 | Ga0157369_11577012 | 3300013105 | Bacteria | 668 |
| 251 | Ga0157374_10013695 | 3300013296 | Bacteria | 7085 |
| 252 | Ga0157374_10135011 | 3300013296 | Bacteria | 2391 |
| 253 | Ga0157374_10135399 | 3300013296 | Bacteria | 2388 |
| 254 | Ga0157378_10028401 | 3300013297 | Bacteria | 4936 |
| 255 | Ga0157378_10125389 | 3300013297 | Bacteria | 2371 |
| 256 | Ga0157378_11280963 | 3300013297 | Bacteria | 774 |
| 257 | Ga0163162_10008971 | 3300013306 | Bacteria | 9724 |
| 258 | Ga0163162_10026684 | 3300013306 | Bacteria | 5710 |
| 259 | Ga0163162_10040726 | 3300013306 | Bacteria | 4647 |
| 260 | Ga0163162_10494447 | 3300013306 | Bacteria | 1354 |
| 261 | Ga0157372_10049281 | 3300013307 | Bacteria | 4683 |
| 262 | Ga0157372_10052300 | 3300013307 | Bacteria | 4547 |
| 263 | Ga0157372_10324467 | 3300013307 | Unclassified | 1793 |
| 264 | Ga0157372_10436339 | 3300013307 | Bacteria | 1527 |
| 265 | Ga0157372_10604826 | 3300013307 | Bacteria | 1278 |
| 266 | Ga0157375_10017430 | 3300013308 | Bacteria | 6481 |
| 267 | Ga0157375_10020065 | 3300013308 | Bacteria | 6098 |
| 268 | Ga0157375_10217601 | 3300013308 | Bacteria | 2068 |
| 269 | Ga0157375_10230377 | 3300013308 | Bacteria | 2011 |
| 270 | Ga0157375_10336503 | 3300013308 | Bacteria | 1675 |
| 271 | Ga0157375_11791665 | 3300013308 | Bacteria | 728 |
| 272 | Ga0163163_10013411 | 3300014325 | Bacteria | 7504 |
| 273 | Ga0163163_10742996 | 3300014325 | Bacteria | 1044 |
| 274 | Ga0163163_10863819 | 3300014325 | Bacteria | 968 |
| 275 | Ga0163163_11422338 | 3300014325 | Bacteria | 755 |
| 276 | Ga0157380_10006849 | 3300014326 | Bacteria | 8054 |
| 277 | Ga0157380_10047715 | 3300014326 | Bacteria | 3370 |
| 278 | Ga0157380_10394090 | 3300014326 | Bacteria | 1311 |
| 279 | Ga0157380_10532229 | 3300014326 | Bacteria | 1149 |
| 280 | Ga0157380_10633672 | 3300014326 | Bacteria | 1063 |
| 281 | Ga0157380_11476426 | 3300014326 | Bacteria | 732 |
| 282 | Ga0157380_11553935 | 3300014326 | Unclassified | 716 |
| 283 | Ga0157380_11564468 | 3300014326 | Bacteria | 714 |
| 284 | Ga0157380_11801925 | 3300014326 | Bacteria | 671 |
| 285 | Ga0157380_11841469 | 3300014326 | Bacteria | 665 |
| 286 | Ga0157377_10000417 | 3300014745 | Bacteria | 18428 |
| 287 | Ga0157377_10005859 | 3300014745 | Bacteria | 5812 |
| 288 | Ga0157377_10089561 | 3300014745 | Bacteria | 1814 |
| 289 | Ga0157377_10238574 | 3300014745 | Bacteria | 1172 |
| 290 | Ga0157377_10314801 | 3300014745 | Unclassified | 1038 |
| 291 | Ga0157379_10013647 | 3300014968 | Bacteria | 7120 |
| 292 | Ga0157379_10188717 | 3300014968 | Bacteria | 1863 |
| 293 | Ga0157376_10124467 | 3300014969 | Bacteria | 2290 |
| 294 | Ga0157376_10926707 | 3300014969 | Bacteria | 890 |
| 295 | Ga0163161_10032192 | 3300017792 | Bacteria | 3743 |
| 296 | Ga0163161_10782601 | 3300017792 | Bacteria | 800 |
| 297 | Ga0163161_11521957 | 3300017792 | Bacteria | 588 |
| 298 | Ga0207666_1021785 | 3300025271 | Bacteria | 947 |
| 299 | Ga0207697_10039214 | 3300025315 | Bacteria | 1943 |
| 300 | Ga0207697_10141557 | 3300025315 | Unclassified | 1043 |
| 301 | Ga0207656_10007116 | 3300025321 | Bacteria | 4065 |
| 302 | Ga0207656_10170344 | 3300025321 | Bacteria | 1041 |
| 303 | Ga0207713_1085405 | 3300025735 | Bacteria | 1124 |
| 304 | Ga0207713_1167837 | 3300025735 | Bacteria | 694 |
| 305 | Ga0207682_10006610 | 3300025893 | Bacteria | 4664 |
| 306 | Ga0207682_10057252 | 3300025893 | Bacteria | 1625 |
| 307 | Ga0207642_10336257 | 3300025899 | Bacteria | 886 |
| 308 | Ga0207642_10507549 | 3300025899 | Bacteria | 739 |
| 309 | Ga0207710_10137711 | 3300025900 | Bacteria | 1177 |
| 310 | Ga0207688_10046604 | 3300025901 | Bacteria | 2421 |
| 311 | Ga0207680_10034057 | 3300025903 | Bacteria | 2911 |
| 312 | Ga0207680_10041039 | 3300025903 | Bacteria | 2697 |
| 313 | Ga0207645_10003340 | 3300025907 | Bacteria | 12232 |
| 314 | Ga0207645_10003952 | 3300025907 | Bacteria | 11063 |
| 315 | Ga0207645_10045411 | 3300025907 | Bacteria | 2808 |
| 316 | Ga0207645_10113368 | 3300025907 | Bacteria | 1756 |
| 317 | Ga0207645_10180050 | 3300025907 | Unclassified | 1387 |
| 318 | Ga0207643_10009563 | 3300025908 | Bacteria | 5208 |
| 319 | Ga0207643_10125381 | 3300025908 | Bacteria | 1524 |
| 320 | Ga0207643_10607248 | 3300025908 | Bacteria | 704 |
| 321 | Ga0207671_10001751 | 3300025914 | Bacteria | 24414 |
| 322 | Ga0207662_10130670 | 3300025918 | Bacteria | 1583 |
| 323 | Ga0207662_10184122 | 3300025918 | Unclassified | 1345 |
| 324 | Ga0207681_10032255 | 3300025923 | Bacteria | 3428 |
| 325 | Ga0207681_10037893 | 3300025923 | Bacteria | 3190 |
| 326 | Ga0207681_10176108 | 3300025923 | Bacteria | 1625 |
| 327 | Ga0207681_10404371 | 3300025923 | Bacteria | 1103 |
| 328 | Ga0207681_10423297 | 3300025923 | Bacteria | 1079 |
| 329 | Ga0207681_10938128 | 3300025923 | Bacteria | 725 |
| 330 | Ga0207650_10059889 | 3300025925 | Bacteria | 2840 |
| 331 | Ga0207650_10177823 | 3300025925 | Bacteria | 1694 |
| 332 | Ga0207650_10270694 | 3300025925 | Unclassified | 1380 |
| 333 | Ga0207650_10313892 | 3300025925 | Bacteria | 1283 |
| 334 | Ga0207650_10392058 | 3300025925 | Bacteria | 1148 |
| 335 | Ga0207650_10413557 | 3300025925 | Bacteria | 1118 |
| 336 | Ga0207659_10012142 | 3300025926 | Bacteria | 5465 |
| 337 | Ga0207659_10075844 | 3300025926 | Bacteria | 2469 |
| 338 | Ga0207659_10110600 | 3300025926 | Bacteria | 2088 |
| 339 | Ga0207659_10176470 | 3300025926 | Bacteria | 1689 |
| 340 | Ga0207659_10498417 | 3300025926 | Bacteria | 1031 |
| 341 | Ga0207644_10417589 | 3300025931 | Bacteria | 1099 |
| 342 | Ga0207706_11083693 | 3300025933 | Bacteria | 670 |
| 343 | Ga0207686_10000722 | 3300025934 | Bacteria | 20514 |
| 344 | Ga0207686_10080936 | 3300025934 | Unclassified | 2118 |
| 345 | Ga0207686_10277776 | 3300025934 | Bacteria | 1235 |
| 346 | Ga0207670_10008086 | 3300025936 | Bacteria | 5916 |
| 347 | Ga0207670_10016892 | 3300025936 | Bacteria | 4399 |
| 348 | Ga0207670_10109596 | 3300025936 | Bacteria | 1987 |
| 349 | Ga0207670_10200327 | 3300025936 | Bacteria | 1516 |
| 350 | Ga0207670_10349645 | 3300025936 | Unclassified | 1170 |
| 351 | Ga0207704_10044261 | 3300025938 | Bacteria | 2636 |
| 352 | Ga0207704_10156205 | 3300025938 | Bacteria | 1617 |
| 353 | Ga0207704_10507604 | 3300025938 | Unclassified | 973 |
| 354 | Ga0207665_10599053 | 3300025939 | Bacteria | 860 |
| 355 | Ga0207691_10021502 | 3300025940 | Bacteria | 6091 |
| 356 | Ga0207691_10039336 | 3300025940 | Bacteria | 4375 |
| 357 | Ga0207691_10040446 | 3300025940 | Bacteria | 4306 |
| 358 | Ga0207691_10102874 | 3300025940 | Bacteria | 2547 |
| 359 | Ga0207691_10196204 | 3300025940 | Bacteria | 1759 |
| 360 | Ga0207691_10278337 | 3300025940 | Bacteria | 1440 |
| 361 | Ga0207691_10876468 | 3300025940 | Bacteria | 752 |
| 362 | Ga0207711_10170561 | 3300025941 | Bacteria | 1974 |
| 363 | Ga0207689_10011440 | 3300025942 | Bacteria | 7605 |
| 364 | Ga0207689_10014019 | 3300025942 | Bacteria | 6823 |
| 365 | Ga0207689_10020156 | 3300025942 | Bacteria | 5617 |
| 366 | Ga0207689_10021437 | 3300025942 | Bacteria | 5431 |
| 367 | Ga0207689_10024277 | 3300025942 | Bacteria | 5087 |
| 368 | Ga0207689_10058574 | 3300025942 | Bacteria | 3168 |
| 369 | Ga0207689_11229467 | 3300025942 | Unclassified | 630 |
| 370 | Ga0207661_10124296 | 3300025944 | Bacteria | 2201 |
| 371 | Ga0207661_10476134 | 3300025944 | Bacteria | 1139 |
| 372 | Ga0207679_10382728 | 3300025945 | Bacteria | 1234 |
| 373 | Ga0207679_10464318 | 3300025945 | Archaea | 1125 |
| 374 | Ga0207679_10945361 | 3300025945 | Bacteria | 789 |
| 375 | Ga0207651_10006951 | 3300025960 | Bacteria | 5986 |
| 376 | Ga0207651_10251465 | 3300025960 | Bacteria | 1446 |
| 377 | Ga0207651_10257945 | 3300025960 | Bacteria | 1430 |
| 378 | Ga0207651_10310158 | 3300025960 | Bacteria | 1315 |
| 379 | Ga0207651_10338956 | 3300025960 | Bacteria | 1262 |
| 380 | Ga0207651_10411228 | 3300025960 | Bacteria | 1153 |
| 381 | Ga0207712_10000776 | 3300025961 | Bacteria | 23799 |
| 382 | Ga0207712_10008510 | 3300025961 | Bacteria | 6485 |
| 383 | Ga0207712_10021376 | 3300025961 | Bacteria | 4249 |
| 384 | Ga0207712_10089220 | 3300025961 | Bacteria | 2266 |
| 385 | Ga0207712_10099531 | 3300025961 | Bacteria | 2159 |
| 386 | Ga0207712_10163547 | 3300025961 | Bacteria | 1732 |
| 387 | Ga0207712_10905645 | 3300025961 | Bacteria | 780 |
| 388 | Ga0207712_11193576 | 3300025961 | Unclassified | 679 |
| 389 | Ga0207668_10173520 | 3300025972 | Bacteria | 1693 |
| 390 | Ga0207668_10190013 | 3300025972 | Bacteria | 1627 |
| 391 | Ga0207668_11332115 | 3300025972 | Unclassified | 647 |
| 392 | Ga0207640_10009494 | 3300025981 | Bacteria | 5449 |
| 393 | Ga0207640_10531280 | 3300025981 | Bacteria | 985 |
| 394 | Ga0207640_10831202 | 3300025981 | Unclassified | 802 |
| 395 | Ga0207658_10027460 | 3300025986 | Bacteria | 4000 |
| 396 | Ga0207658_10032899 | 3300025986 | Bacteria | 3695 |
| 397 | Ga0207658_10302544 | 3300025986 | Bacteria | 1378 |
| 398 | Ga0207658_10509744 | 3300025986 | Bacteria | 1073 |
| 399 | Ga0207677_10013428 | 3300026023 | Bacteria | 4747 |
| 400 | Ga0207677_10159328 | 3300026023 | Bacteria | 1751 |
| 401 | Ga0207677_10256970 | 3300026023 | Unclassified | 1422 |
| 402 | Ga0207677_10852677 | 3300026023 | Bacteria | 819 |
| 403 | Ga0207703_10143535 | 3300026035 | Bacteria | 2074 |
| 404 | Ga0207703_10382334 | 3300026035 | Unclassified | 1302 |
| 405 | Ga0207639_10125932 | 3300026041 | Bacteria | 2113 |
| 406 | Ga0207639_10287859 | 3300026041 | Unclassified | 1447 |
| 407 | Ga0207639_10436379 | 3300026041 | Unclassified | 1187 |
| 408 | Ga0207639_10737969 | 3300026041 | Bacteria | 915 |
| 409 | Ga0207708_10265251 | 3300026075 | Bacteria | 1387 |
| 410 | Ga0207708_11228791 | 3300026075 | Bacteria | 655 |
| 411 | Ga0207641_10000783 | 3300026088 | Bacteria | 33947 |
| 412 | Ga0207641_10035434 | 3300026088 | Bacteria | 4158 |
| 413 | Ga0207641_10128616 | 3300026088 | Bacteria | 2271 |
| 414 | Ga0207641_12110460 | 3300026088 | Bacteria | 564 |
| 415 | Ga0207648_10001120 | 3300026089 | Bacteria | 30104 |
| 416 | Ga0207648_10007711 | 3300026089 | Bacteria | 10527 |
| 417 | Ga0207648_10030947 | 3300026089 | Bacteria | 4734 |
| 418 | Ga0207648_10035005 | 3300026089 | Bacteria | 4427 |
| 419 | Ga0207648_10356924 | 3300026089 | Bacteria | 1318 |
| 420 | Ga0207648_10589373 | 3300026089 | Bacteria | 1024 |
| 421 | Ga0207648_10631296 | 3300026089 | Unclassified | 989 |
| 422 | Ga0207676_10015323 | 3300026095 | Bacteria | 5528 |
| 423 | Ga0207676_10087015 | 3300026095 | Bacteria | 2554 |
| 424 | Ga0207676_10111161 | 3300026095 | Unclassified | 2293 |
| 425 | Ga0207676_10898382 | 3300026095 | Unclassified | 869 |
| 426 | Ga0207674_10011127 | 3300026116 | Bacteria | 10118 |
| 427 | Ga0207674_10167713 | 3300026116 | Bacteria | 2149 |
| 428 | Ga0207674_10207475 | 3300026116 | Unclassified | 1909 |
| 429 | Ga0207674_10275746 | 3300026116 | Bacteria | 1629 |
| 430 | Ga0207674_10284341 | 3300026116 | Bacteria | 1602 |
| 431 | Ga0207674_10789794 | 3300026116 | Bacteria | 916 |
| 432 | Ga0207675_100003924 | 3300026118 | Bacteria | 14439 |
| 433 | Ga0207675_100010149 | 3300026118 | Bacteria | 8827 |
| 434 | Ga0207675_100088702 | 3300026118 | Bacteria | 2906 |
| 435 | Ga0207675_100164020 | 3300026118 | Bacteria | 2121 |
| 436 | Ga0207675_100330241 | 3300026118 | Bacteria | 1491 |
| 437 | Ga0207675_100441012 | 3300026118 | Bacteria | 1289 |
| 438 | Ga0207675_100479667 | 3300026118 | Bacteria | 1236 |
| 439 | Ga0207683_10020177 | 3300026121 | Bacteria | 5697 |
| 440 | Ga0207683_10060813 | 3300026121 | Bacteria | 3321 |
| 441 | Ga0207698_10040580 | 3300026142 | Bacteria | 3460 |
| 442 | Ga0207698_10767814 | 3300026142 | Unclassified | 964 |
| 443 | Ga0207428_10016019 | 3300027907 | Bacteria | 6461 |
| 444 | Ga0207428_10769113 | 3300027907 | Bacteria | 686 |
| 445 | Ga0268266_10043665 | 3300028379 | Bacteria | 3832 |
| 446 | Ga0268266_10924967 | 3300028379 | Unclassified | 843 |
| 447 | Ga0268265_10010677 | 3300028380 | Bacteria | 6202 |
| 448 | Ga0268265_10103200 | 3300028380 | Bacteria | 2309 |
| 449 | Ga0268265_10117654 | 3300028380 | Unclassified | 2183 |
| 450 | Ga0268265_10320306 | 3300028380 | Bacteria | 1404 |
| 451 | Ga0268265_10334421 | 3300028380 | Bacteria | 1377 |
| 452 | Ga0268265_10398696 | 3300028380 | Bacteria | 1271 |
| 453 | Ga0268264_10010462 | 3300028381 | Bacteria | 7670 |
| 454 | Ga0268264_10157632 | 3300028381 | Unclassified | 2041 |
| 455 | Ga0316177_1112842 | 3300030731 | Bacteria | 758 |
| 456 | Ga0307406_10308520 | 3300031901 | Unclassified | 1219 |
| 457 | Ga0307407_10290197 | 3300031903 | Bacteria | 1137 |
| 458 | Ga0307407_11600365 | 3300031903 | Bacteria | 517 |
| 459 | Ga0307412_10544248 | 3300031911 | Bacteria | 974 |
| 460 | Ga0307414_11862694 | 3300032004 | Bacteria | 561 |
| 461 | Ga0307411_10036675 | 3300032005 | Bacteria | 3075 |
| 462 | Ga0307411_10776280 | 3300032005 | Unclassified | 842 |
| 463 | Ga0307411_11889139 | 3300032005 | Bacteria | 556 |
| 464 | Ga0373952_0053709 | 3300035092 | Bacteria | 967 |
| 465 | Ga0395899_0162494 | 3300037312 | Bacteria | 1577 |
| 466 | Ga0395900_0061706 | 3300037418 | Bacteria | 3854 |
| 467 | Ga0395898_0753634 | 3300037466 | Bacteria | 915 |
| 468 | Ga0395905_0000424 | 3300037471 | Bacteria | 58940 |
| 469 | Ga0395905_0046490 | 3300037471 | Bacteria | 4070 |
| 470 | Ga0395901_0443612 | 3300038443 | Bacteria | 1328 |
| 471 | Ga0439436_0062920 | 3300041404 | Unclassified | 1037 |
| 472 | Ga0439439_0047255 | 3300041406 | Unclassified | 1125 |
| 473 | Ga0439461_0015853 | 3300041410 | Bacteria | 1448 |
| 474 | Ga0439465_0015661 | 3300041413 | Bacteria | 2365 |
| 475 | Ga0439465_0169551 | 3300041413 | Unclassified | 786 |
| 476 | Ga0451789_1159392 | 3300041443 | Unclassified | 544 |
| 477 | Ga0451791_1183411 | 3300041451 | Unclassified | 623 |
| 478 | Ga0451791_1216885 | 3300041451 | Bacteria | 1036 |
| 479 | Ga0451800_1177867 | 3300041459 | Bacteria | 1017 |
| 480 | Ga0439431_0083991 | 3300041997 | Bacteria | 861 |
| 481 | Ga0439433_0140196 | 3300041999 | Unclassified | 618 |
| 482 | Ga0439441_003147 | 3300042001 | Bacteria | 2400 |
| 483 | Ga0439442_011768 | 3300042002 | Bacteria | 1784 |
| 484 | Ga0439445_0026632 | 3300042004 | Unclassified | 1481 |
| 485 | Ga0439445_0112974 | 3300042004 | Unclassified | 776 |
| 486 | Ga0439449_0001461 | 3300042007 | Bacteria | 9256 |
| 487 | Ga0439454_055359 | 3300042011 | Bacteria | 678 |
| 488 | Ga0450898_005533 | 3300042134 | Bacteria | 1912 |
| 489 | Ga0450899_008881 | 3300042135 | Bacteria | 1104 |
| 490 | Ga0439434_0019373 | 3300042435 | Unclassified | 2041 |
| 491 | Ga0439435_0271473 | 3300042436 | Bacteria | 575 |
| 492 | Ga0439444_0033635 | 3300042437 | Bacteria | 975 |
| 493 | Ga0495585_0338330 | 3300046492 | Bacteria | 733 |
| 494 | Ga0495643_0063329 | 3300046522 | Bacteria | 1956 |
| 495 | Ga0495621_0001378 | 3300046539 | Bacteria | 6296 |
| 496 | Ga0495668_0000106 | 3300046616 | Bacteria | 133476 |
| 497 | Ga0495625_0060697 | 3300046660 | Bacteria | 2678 |
| 498 | Ga0495672_0007070 | 3300047320 | Bacteria | 8515 |
| 499 | Ga0495672_0010538 | 3300047320 | Bacteria | 6577 |
| 500 | Ga0496110_0223340 | 3300048913 | Unclassified | 1713 |
| 501 | Ga0496113_1260966 | 3300048916 | Bacteria | 576 |
| 502 | Ga0501305_052219 | 3300049161 | Unclassified | 688 |
| 503 | Ga0501305_059199 | 3300049161 | Unclassified | 656 |
| 504 | Ga0501290_017577 | 3300049513 | Bacteria | 959 |
| 505 | Ga0501312_011907 | 3300049528 | Unclassified | 1189 |
| 506 | Ga0501315_004199 | 3300049531 | Bacteria | 1491 |
| 507 | Ga0501315_015699 | 3300049531 | Unclassified | 973 |
| 508 | Ga0501316_025438 | 3300049532 | Unclassified | 769 |
| 509 | Ga0501317_025489 | 3300049533 | Unclassified | 829 |
| 510 | Ga0501321_021937 | 3300049537 | Unclassified | 800 |
| 511 | Ga0501322_009925 | 3300049538 | Unclassified | 727 |
| 512 | Ga0501325_032545 | 3300049541 | Unclassified | 604 |
| 513 | Ga0501327_15172 | 3300049543 | Bacteria | 543 |
| 514 | Ga0501335_026410 | 3300049551 | Unclassified | 640 |
| 515 | Ga0501031_0034538 | 3300049568 | Bacteria | 3300 |
| 516 | Ga0501032_0010226 | 3300049569 | Bacteria | 6771 |
| 517 | Ga0501034_0007266 | 3300049571 | Bacteria | 11817 |
| 518 | Ga0501036_0011069 | 3300049572 | Bacteria | 7459 |
| 519 | Ga0501036_0034183 | 3300049572 | Bacteria | 4300 |
| 520 | Ga0501037_0048313 | 3300049573 | Bacteria | 3119 |
| 521 | Ga0501037_0431021 | 3300049573 | Bacteria | 901 |
| 522 | Ga0501039_0001372 | 3300049575 | Bacteria | 17881 |
| 523 | Ga0501042_0065928 | 3300049578 | Bacteria | 2588 |
| 524 | Ga0501043_0009418 | 3300049579 | Bacteria | 7667 |
| 525 | Ga0501046_0033128 | 3300049580 | Bacteria | 4178 |
| 526 | Ga0501046_0356833 | 3300049580 | Bacteria | 1060 |
| 527 | Ga0501047_0044953 | 3300049581 | Bacteria | 4268 |
| 528 | Ga0501048_0145326 | 3300049582 | Bacteria | 1677 |
| 529 | Ga0501067_0060114 | 3300049583 | Bacteria | 2103 |
| 530 | Ga0501068_0346208 | 3300049584 | Bacteria | 955 |
| 531 | Ga0501068_0760274 | 3300049584 | Bacteria | 635 |
| 532 | Ga0501073_0004832 | 3300049589 | Bacteria | 10112 |
| 533 | Ga0501074_0001779 | 3300049590 | Bacteria | 14729 |
| 534 | Ga0501075_1222825 | 3300049591 | Bacteria | 570 |
| 535 | Ga0501249_110678 | 3300049679 | Bacteria | 664 |
| 536 | Ga0501257_242908 | 3300049686 | Bacteria | 531 |
| 537 | Ga0501245_001491 | 3300049708 | Bacteria | 3040 |
| 538 | Ga0501079_0239029 | 3300049741 | Bacteria | 1419 |
| 539 | Ga0501080_0097369 | 3300049742 | Bacteria | 2731 |
| 540 | Ga0501083_0005688 | 3300049744 | Bacteria | 8822 |
| 541 | Ga0501035_0012125 | 3300049822 | Bacteria | 7970 |
| 542 | Ga0501035_0013079 | 3300049822 | Bacteria | 7659 |
| 543 | Ga0501044_0003510 | 3300049823 | Bacteria | 17649 |
| 544 | Ga0501044_0013204 | 3300049823 | Bacteria | 8945 |
| 545 | Ga0501045_0136884 | 3300049824 | Bacteria | 1821 |
| 546 | nmdc:mga0k408_148375_c1 | 3300050493 | Bacteria | 1396 |
| 547 | nmdc:mga0k408_703386_c1 | 3300050493 | Bacteria | 592 |
| 548 | nmdc:mga07m45_98179_c1 | 3300050496 | Bacteria | 966 |
| 549 | nmdc:mga05p37_353212_c1 | 3300050507 | Bacteria | 1730 |
| 550 | nmdc:mga0qj67_134675_c1 | 3300050509 | Bacteria | 2002 |
| 551 | nmdc:mga06r32_15655_c1 | 3300050510 | Bacteria | 6889 |
| 552 | nmdc:mga08y16_17537_c1 | 3300050511 | Bacteria | 7540 |
| 553 | nmdc:mga08y16_39528_c1 | 3300050511 | Bacteria | 4949 |
| 554 | nmdc:mga08y16_499530_c1 | 3300050511 | Bacteria | 1236 |
| 555 | nmdc:mga0n895_280971_c1 | 3300050512 | Unclassified | 1688 |
| 556 | nmdc:mga08x19_681498_c1 | 3300050514 | Bacteria | 729 |
| 557 | Ga0500628_061838 | 3300053129 | Bacteria | 917 |
| 558 | Ga0500568_0000325 | 3300053139 | Bacteria | 37538 |
| 559 | Ga0500616_0047079 | 3300053153 | Bacteria | 2291 |
| 560 | Ga0500622_0000480 | 3300053156 | Bacteria | 37450 |
| 561 | Ga0500611_000029 | 3300053727 | Bacteria | 89288 |
| 562 | Ga0501084_0586477 | 3300054114 | Bacteria | 942 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041999 | Ga0439433_0140196 | Ga0439433_0140196_26_448 | 139 |
| 2 | 3300042001 | Ga0439441_003147 | Ga0439441_003147_963_1388 | 141 |
| 3 | 3300042437 | Ga0439444_0033635 | Ga0439444_0033635_343_768 | 141 |
| 4 | 3300005293 | Ga0065715_10272145 | Ga0065715_102721452 | 147 |
| 5 | 3300005354 | Ga0070675_100023572 | Ga0070675_1000235723 | 147 |
| 6 | 3300005364 | Ga0070673_100398153 | Ga0070673_1003981532 | 147 |
| 7 | 3300005466 | Ga0070685_10003294 | Ga0070685_100032943 | 147 |
| 8 | 3300014326 | Ga0157380_10394090 | Ga0157380_103940902 | 147 |
| 9 | 3300025926 | Ga0207659_10110600 | Ga0207659_101106003 | 147 |
| 10 | 3300025942 | Ga0207689_11229467 | Ga0207689_112294672 | 147 |
| 11 | 3300002077 | JGI24744J21845_10005535 | JGI24744J21845_100055352 | 148 |
| 12 | 3300005293 | Ga0065715_10105240 | Ga0065715_101052404 | 148 |
| 13 | 3300005334 | Ga0068869_100080736 | Ga0068869_1000807361 | 148 |
| 14 | 3300005338 | Ga0068868_100906180 | Ga0068868_1009061802 | 148 |
| 15 | 3300005340 | Ga0070689_100124028 | Ga0070689_1001240281 | 148 |
| 16 | 3300005340 | Ga0070689_100667508 | Ga0070689_1006675081 | 148 |
| 17 | 3300005345 | Ga0070692_10237881 | Ga0070692_102378812 | 148 |
| 18 | 3300005353 | Ga0070669_100027944 | Ga0070669_1000279442 | 148 |
| 19 | 3300005353 | Ga0070669_100485856 | Ga0070669_1004858562 | 148 |
| 20 | 3300005353 | Ga0070669_100861139 | Ga0070669_1008611391 | 148 |
| 21 | 3300005354 | Ga0070675_100060506 | Ga0070675_1000605062 | 148 |
| 22 | 3300005355 | Ga0070671_101078297 | Ga0070671_1010782971 | 148 |
| 23 | 3300005356 | Ga0070674_100838148 | Ga0070674_1008381482 | 148 |
| 24 | 3300005356 | Ga0070674_101543854 | Ga0070674_1015438541 | 148 |
| 25 | 3300005364 | Ga0070673_100103092 | Ga0070673_1001030922 | 148 |
| 26 | 3300005364 | Ga0070673_100117523 | Ga0070673_1001175232 | 148 |
| 27 | 3300005364 | Ga0070673_100674480 | Ga0070673_1006744802 | 148 |
| 28 | 3300005365 | Ga0070688_100142393 | Ga0070688_1001423932 | 148 |
| 29 | 3300005365 | Ga0070688_100178403 | Ga0070688_1001784031 | 148 |
| 30 | 3300005365 | Ga0070688_100539065 | Ga0070688_1005390652 | 148 |
| 31 | 3300005366 | Ga0070659_100565597 | Ga0070659_1005655971 | 148 |
| 32 | 3300005367 | Ga0070667_100544245 | Ga0070667_1005442452 | 148 |
| 33 | 3300005438 | Ga0070701_10112236 | Ga0070701_101122362 | 148 |
| 34 | 3300005441 | Ga0070700_100396044 | Ga0070700_1003960442 | 148 |
| 35 | 3300005441 | Ga0070700_100511568 | Ga0070700_1005115682 | 148 |
| 36 | 3300005459 | Ga0068867_101245668 | Ga0068867_1012456681 | 148 |
| 37 | 3300005466 | Ga0070685_10051327 | Ga0070685_100513274 | 148 |
| 38 | 3300005466 | Ga0070685_10210268 | Ga0070685_102102681 | 148 |
| 39 | 3300005466 | Ga0070685_10645325 | Ga0070685_106453251 | 148 |
| 40 | 3300005471 | Ga0070698_100063699 | Ga0070698_1000636993 | 148 |
| 41 | 3300005471 | Ga0070698_101697246 | Ga0070698_1016972461 | 148 |
| 42 | 3300005539 | Ga0068853_100051862 | Ga0068853_1000518623 | 148 |
| 43 | 3300005543 | Ga0070672_100141359 | Ga0070672_1001413592 | 148 |
| 44 | 3300005543 | Ga0070672_100172398 | Ga0070672_1001723982 | 148 |
| 45 | 3300005543 | Ga0070672_100308648 | Ga0070672_1003086482 | 148 |
| 46 | 3300005543 | Ga0070672_100496967 | Ga0070672_1004969672 | 148 |
| 47 | 3300005544 | Ga0070686_100047270 | Ga0070686_1000472702 | 148 |
| 48 | 3300005544 | Ga0070686_100055575 | Ga0070686_1000555752 | 148 |
| 49 | 3300005549 | Ga0070704_100195564 | Ga0070704_1001955642 | 148 |
| 50 | 3300005615 | Ga0070702_100312496 | Ga0070702_1003124962 | 148 |
| 51 | 3300005616 | Ga0068852_100034369 | Ga0068852_1000343692 | 148 |
| 52 | 3300005617 | Ga0068859_100179724 | Ga0068859_1001797242 | 148 |
| 53 | 3300005617 | Ga0068859_100442204 | Ga0068859_1004422042 | 148 |
| 54 | 3300005618 | Ga0068864_100084966 | Ga0068864_1000849662 | 148 |
| 55 | 3300005618 | Ga0068864_101747944 | Ga0068864_1017479441 | 148 |
| 56 | 3300005719 | Ga0068861_100042253 | Ga0068861_1000422534 | 148 |
| 57 | 3300005834 | Ga0068851_10005025 | Ga0068851_100050252 | 148 |
| 58 | 3300005834 | Ga0068851_10176367 | Ga0068851_101763672 | 148 |
| 59 | 3300005840 | Ga0068870_10174131 | Ga0068870_101741312 | 148 |
| 60 | 3300005840 | Ga0068870_10319843 | Ga0068870_103198432 | 148 |
| 61 | 3300005841 | Ga0068863_100075494 | Ga0068863_1000754943 | 148 |
| 62 | 3300005841 | Ga0068863_100529403 | Ga0068863_1005294032 | 148 |
| 63 | 3300005842 | Ga0068858_100444115 | Ga0068858_1004441152 | 148 |
| 64 | 3300005843 | Ga0068860_100130883 | Ga0068860_1001308833 | 148 |
| 65 | 3300005844 | Ga0068862_100039350 | Ga0068862_1000393503 | 148 |
| 66 | 3300005844 | Ga0068862_100278401 | Ga0068862_1002784012 | 148 |
| 67 | 3300006163 | Ga0070715_10367218 | Ga0070715_103672182 | 148 |
| 68 | 3300006237 | Ga0097621_100187367 | Ga0097621_1001873672 | 148 |
| 69 | 3300006237 | Ga0097621_100592309 | Ga0097621_1005923092 | 148 |
| 70 | 3300006358 | Ga0068871_100046293 | Ga0068871_1000462932 | 148 |
| 71 | 3300006844 | Ga0075428_100064504 | Ga0075428_1000645042 | 148 |
| 72 | 3300006844 | Ga0075428_100373899 | Ga0075428_1003738992 | 148 |
| 73 | 3300006881 | Ga0068865_100243673 | Ga0068865_1002436731 | 148 |
| 74 | 3300006881 | Ga0068865_100608205 | Ga0068865_1006082052 | 148 |
| 75 | 3300006931 | Ga0097620_100179724 | Ga0097620_1001797242 | 148 |
| 76 | 3300006931 | Ga0097620_100442224 | Ga0097620_1004422242 | 148 |
| 77 | 3300009011 | Ga0105251_10192332 | Ga0105251_101923322 | 148 |
| 78 | 3300009094 | Ga0111539_10074003 | Ga0111539_100740033 | 148 |
| 79 | 3300009094 | Ga0111539_10657996 | Ga0111539_106579963 | 148 |
| 80 | 3300009094 | Ga0111539_10747439 | Ga0111539_107474391 | 148 |
| 81 | 3300009101 | Ga0105247_10138653 | Ga0105247_101386532 | 148 |
| 82 | 3300009147 | Ga0114129_10016983 | Ga0114129_100169834 | 148 |
| 83 | 3300009176 | Ga0105242_10082116 | Ga0105242_100821161 | 148 |
| 84 | 3300009176 | Ga0105242_11904435 | Ga0105242_119044351 | 148 |
| 85 | 3300009177 | Ga0105248_10264267 | Ga0105248_102642672 | 148 |
| 86 | 3300009553 | Ga0105249_10004609 | Ga0105249_100046093 | 148 |
| 87 | 3300009553 | Ga0105249_10115888 | Ga0105249_101158882 | 148 |
| 88 | 3300009553 | Ga0105249_10672874 | Ga0105249_106728741 | 148 |
| 89 | 3300013104 | Ga0157370_10907739 | Ga0157370_109077391 | 148 |
| 90 | 3300013105 | Ga0157369_11577012 | Ga0157369_115770121 | 148 |
| 91 | 3300013306 | Ga0163162_10040726 | Ga0163162_100407264 | 148 |
| 92 | 3300013306 | Ga0163162_10494447 | Ga0163162_104944472 | 148 |
| 93 | 3300013307 | Ga0157372_10052300 | Ga0157372_100523005 | 148 |
| 94 | 3300013308 | Ga0157375_10336503 | Ga0157375_103365032 | 148 |
| 95 | 3300013308 | Ga0157375_11791665 | Ga0157375_117916651 | 148 |
| 96 | 3300014325 | Ga0163163_10742996 | Ga0163163_107429962 | 148 |
| 97 | 3300014325 | Ga0163163_10863819 | Ga0163163_108638192 | 148 |
| 98 | 3300014326 | Ga0157380_10633672 | Ga0157380_106336721 | 148 |
| 99 | 3300014326 | Ga0157380_11476426 | Ga0157380_114764262 | 148 |
| 100 | 3300014326 | Ga0157380_11553935 | Ga0157380_115539352 | 148 |
| 101 | 3300014326 | Ga0157380_11564468 | Ga0157380_115644682 | 148 |
| 102 | 3300014326 | Ga0157380_11801925 | Ga0157380_118019251 | 148 |
| 103 | 3300014326 | Ga0157380_11841469 | Ga0157380_118414691 | 148 |
| 104 | 3300014745 | Ga0157377_10005859 | Ga0157377_100058592 | 148 |
| 105 | 3300014969 | Ga0157376_10124467 | Ga0157376_101244672 | 148 |
| 106 | 3300017792 | Ga0163161_11521957 | Ga0163161_115219571 | 148 |
| 107 | 3300025315 | Ga0207697_10141557 | Ga0207697_101415572 | 148 |
| 108 | 3300025321 | Ga0207656_10007116 | Ga0207656_100071164 | 148 |
| 109 | 3300025893 | Ga0207682_10006610 | Ga0207682_100066101 | 148 |
| 110 | 3300025899 | Ga0207642_10507549 | Ga0207642_105075492 | 148 |
| 111 | 3300025908 | Ga0207643_10125381 | Ga0207643_101253812 | 148 |
| 112 | 3300025908 | Ga0207643_10607248 | Ga0207643_106072481 | 148 |
| 113 | 3300025918 | Ga0207662_10130670 | Ga0207662_101306703 | 148 |
| 114 | 3300025918 | Ga0207662_10184122 | Ga0207662_101841222 | 148 |
| 115 | 3300025923 | Ga0207681_10037893 | Ga0207681_100378932 | 148 |
| 116 | 3300025923 | Ga0207681_10176108 | Ga0207681_101761082 | 148 |
| 117 | 3300025925 | Ga0207650_10059889 | Ga0207650_100598893 | 148 |
| 118 | 3300025925 | Ga0207650_10270694 | Ga0207650_102706942 | 148 |
| 119 | 3300025925 | Ga0207650_10413557 | Ga0207650_104135572 | 148 |
| 120 | 3300025926 | Ga0207659_10012142 | Ga0207659_100121423 | 148 |
| 121 | 3300025931 | Ga0207644_10417589 | Ga0207644_104175892 | 148 |
| 122 | 3300025934 | Ga0207686_10000722 | Ga0207686_100007223 | 148 |
| 123 | 3300025936 | Ga0207670_10008086 | Ga0207670_100080862 | 148 |
| 124 | 3300025936 | Ga0207670_10016892 | Ga0207670_100168923 | 148 |
| 125 | 3300025936 | Ga0207670_10349645 | Ga0207670_103496452 | 148 |
| 126 | 3300025938 | Ga0207704_10044261 | Ga0207704_100442613 | 148 |
| 127 | 3300025940 | Ga0207691_10021502 | Ga0207691_100215022 | 148 |
| 128 | 3300025940 | Ga0207691_10102874 | Ga0207691_101028741 | 148 |
| 129 | 3300025940 | Ga0207691_10278337 | Ga0207691_102783372 | 148 |
| 130 | 3300025941 | Ga0207711_10170561 | Ga0207711_101705612 | 148 |
| 131 | 3300025942 | Ga0207689_10058574 | Ga0207689_100585743 | 148 |
| 132 | 3300025960 | Ga0207651_10006951 | Ga0207651_100069514 | 148 |
| 133 | 3300025960 | Ga0207651_10251465 | Ga0207651_102514651 | 148 |
| 134 | 3300025960 | Ga0207651_10310158 | Ga0207651_103101582 | 148 |
| 135 | 3300025961 | Ga0207712_10008510 | Ga0207712_100085103 | 148 |
| 136 | 3300025961 | Ga0207712_10021376 | Ga0207712_100213764 | 148 |
| 137 | 3300025972 | Ga0207668_10190013 | Ga0207668_101900132 | 148 |
| 138 | 3300025986 | Ga0207658_10509744 | Ga0207658_105097442 | 148 |
| 139 | 3300026023 | Ga0207677_10256970 | Ga0207677_102569702 | 148 |
| 140 | 3300026035 | Ga0207703_10382334 | Ga0207703_103823342 | 148 |
| 141 | 3300026041 | Ga0207639_10287859 | Ga0207639_102878591 | 148 |
| 142 | 3300026041 | Ga0207639_10436379 | Ga0207639_104363792 | 148 |
| 143 | 3300026075 | Ga0207708_10265251 | Ga0207708_102652512 | 148 |
| 144 | 3300026075 | Ga0207708_11228791 | Ga0207708_112287912 | 148 |
| 145 | 3300026088 | Ga0207641_10000783 | Ga0207641_1000078325 | 148 |
| 146 | 3300026088 | Ga0207641_10128616 | Ga0207641_101286162 | 148 |
| 147 | 3300026095 | Ga0207676_10898382 | Ga0207676_108983822 | 148 |
| 148 | 3300026118 | Ga0207675_100010149 | Ga0207675_1000101497 | 148 |
| 149 | 3300026118 | Ga0207675_100330241 | Ga0207675_1003302412 | 148 |
| 150 | 3300026118 | Ga0207675_100441012 | Ga0207675_1004410122 | 148 |
| 151 | 3300026121 | Ga0207683_10060813 | Ga0207683_100608132 | 148 |
| 152 | 3300026142 | Ga0207698_10040580 | Ga0207698_100405802 | 148 |
| 153 | 3300027907 | Ga0207428_10769113 | Ga0207428_107691131 | 148 |
| 154 | 3300028380 | Ga0268265_10117654 | Ga0268265_101176542 | 148 |
| 155 | 3300028380 | Ga0268265_10398696 | Ga0268265_103986961 | 148 |
| 156 | 3300028381 | Ga0268264_10157632 | Ga0268264_101576322 | 148 |
| 157 | 3300031903 | Ga0307407_11600365 | Ga0307407_116003651 | 148 |
| 158 | 3300041451 | Ga0451791_1216885 | Ga0451791_1216885_16_471 | 148 |
| 159 | 3300041459 | Ga0451800_1177867 | Ga0451800_1177867_515_961 | 148 |
| 160 | 3300042007 | Ga0439449_0001461 | Ga0439449_0001461_8169_8618 | 148 |
| 161 | 3300046492 | Ga0495585_0338330 | Ga0495585_0338330_149_595 | 148 |
| 162 | 3300046539 | Ga0495621_0001378 | Ga0495621_0001378_2415_2861 | 148 |
| 163 | 3300046616 | Ga0495668_0000106 | Ga0495668_0000106_56566_57024 | 148 |
| 164 | 3300046660 | Ga0495625_0060697 | Ga0495625_0060697_1668_2120 | 148 |
| 165 | 3300049161 | Ga0501305_059199 | Ga0501305_059199_167_616 | 148 |
| 166 | 3300049528 | Ga0501312_011907 | Ga0501312_011907_147_596 | 148 |
| 167 | 3300049531 | Ga0501315_015699 | Ga0501315_015699_105_554 | 148 |
| 168 | 3300049532 | Ga0501316_025438 | Ga0501316_025438_37_486 | 148 |
| 169 | 3300049538 | Ga0501322_009925 | Ga0501322_009925_153_602 | 148 |
| 170 | 3300049551 | Ga0501335_026410 | Ga0501335_026410_159_608 | 148 |
| 171 | 3300050511 | nmdc:mga08y16_39528_c1 | nmdc:mga08y16_39528_c1_1904_2350 | 148 |
| 172 | 3300050511 | nmdc:mga08y16_499530_c1 | nmdc:mga08y16_499530_c1_674_1120 | 148 |
| 173 | 3300053129 | Ga0500628_061838 | Ga0500628_061838_303_773 | 148 |
| 174 | 3300053156 | Ga0500622_0000480 | Ga0500622_0000480_17387_17839 | 148 |
| 175 | 2162886011 | MRS1b_contig_9194533 | MRS1b_0449.00000830 | 149 |
| 176 | 3300003322 | rootL2_10349925 | rootL2_103499252 | 149 |
| 177 | 3300005328 | Ga0070676_10002798 | Ga0070676_100027984 | 149 |
| 178 | 3300005331 | Ga0070670_100173254 | Ga0070670_1001732542 | 149 |
| 179 | 3300005331 | Ga0070670_100260621 | Ga0070670_1002606212 | 149 |
| 180 | 3300005331 | Ga0070670_100322215 | Ga0070670_1003222152 | 149 |
| 181 | 3300005331 | Ga0070670_100695378 | Ga0070670_1006953782 | 149 |
| 182 | 3300005333 | Ga0070677_10023349 | Ga0070677_100233492 | 149 |
| 183 | 3300005334 | Ga0068869_100006670 | Ga0068869_1000066704 | 149 |
| 184 | 3300005334 | Ga0068869_100057841 | Ga0068869_1000578414 | 149 |
| 185 | 3300005334 | Ga0068869_100120115 | Ga0068869_1001201152 | 149 |
| 186 | 3300005334 | Ga0068869_100349133 | Ga0068869_1003491331 | 149 |
| 187 | 3300005335 | Ga0070666_10117862 | Ga0070666_101178622 | 149 |
| 188 | 3300005338 | Ga0068868_100002313 | Ga0068868_1000023138 | 149 |
| 189 | 3300005343 | Ga0070687_100263734 | Ga0070687_1002637342 | 149 |
| 190 | 3300005343 | Ga0070687_100342396 | Ga0070687_1003423961 | 149 |
| 191 | 3300005344 | Ga0070661_100816859 | Ga0070661_1008168591 | 149 |
| 192 | 3300005347 | Ga0070668_100084137 | Ga0070668_1000841372 | 149 |
| 193 | 3300005353 | Ga0070669_100137520 | Ga0070669_1001375201 | 149 |
| 194 | 3300005353 | Ga0070669_100400808 | Ga0070669_1004008082 | 149 |
| 195 | 3300005354 | Ga0070675_100133933 | Ga0070675_1001339332 | 149 |
| 196 | 3300005354 | Ga0070675_100422499 | Ga0070675_1004224992 | 149 |
| 197 | 3300005354 | Ga0070675_101260247 | Ga0070675_1012602472 | 149 |
| 198 | 3300005356 | Ga0070674_100165290 | Ga0070674_1001652902 | 149 |
| 199 | 3300005356 | Ga0070674_101065979 | Ga0070674_1010659791 | 149 |
| 200 | 3300005364 | Ga0070673_100345696 | Ga0070673_1003456962 | 149 |
| 201 | 3300005365 | Ga0070688_100176351 | Ga0070688_1001763512 | 149 |
| 202 | 3300005367 | Ga0070667_100069846 | Ga0070667_1000698462 | 149 |
| 203 | 3300005459 | Ga0068867_100084108 | Ga0068867_1000841082 | 149 |
| 204 | 3300005459 | Ga0068867_100310207 | Ga0068867_1003102072 | 149 |
| 205 | 3300005466 | Ga0070685_10365115 | Ga0070685_103651151 | 149 |
| 206 | 3300005535 | Ga0070684_100003115 | Ga0070684_1000031155 | 149 |
| 207 | 3300005535 | Ga0070684_100404354 | Ga0070684_1004043541 | 149 |
| 208 | 3300005539 | Ga0068853_100014221 | Ga0068853_1000142212 | 149 |
| 209 | 3300005543 | Ga0070672_100205057 | Ga0070672_1002050572 | 149 |
| 210 | 3300005543 | Ga0070672_100293814 | Ga0070672_1002938142 | 149 |
| 211 | 3300005548 | Ga0070665_100038466 | Ga0070665_1000384662 | 149 |
| 212 | 3300005564 | Ga0070664_100238860 | Ga0070664_1002388602 | 149 |
| 213 | 3300005577 | Ga0068857_100144949 | Ga0068857_1001449492 | 149 |
| 214 | 3300005577 | Ga0068857_100409161 | Ga0068857_1004091611 | 149 |
| 215 | 3300005578 | Ga0068854_100012895 | Ga0068854_1000128955 | 149 |
| 216 | 3300005578 | Ga0068854_100735274 | Ga0068854_1007352741 | 149 |
| 217 | 3300005578 | Ga0068854_100857070 | Ga0068854_1008570701 | 149 |
| 218 | 3300005614 | Ga0068856_100778051 | Ga0068856_1007780511 | 149 |
| 219 | 3300005616 | Ga0068852_101260180 | Ga0068852_1012601802 | 149 |
| 220 | 3300005617 | Ga0068859_100021622 | Ga0068859_1000216224 | 149 |
| 221 | 3300005617 | Ga0068859_100092544 | Ga0068859_1000925441 | 149 |
| 222 | 3300005617 | Ga0068859_100215664 | Ga0068859_1002156642 | 149 |
| 223 | 3300005617 | Ga0068859_101645173 | Ga0068859_1016451732 | 149 |
| 224 | 3300005618 | Ga0068864_101005794 | Ga0068864_1010057942 | 149 |
| 225 | 3300005718 | Ga0068866_10029579 | Ga0068866_100295792 | 149 |
| 226 | 3300005718 | Ga0068866_10182261 | Ga0068866_101822611 | 149 |
| 227 | 3300005718 | Ga0068866_10298507 | Ga0068866_102985072 | 149 |
| 228 | 3300005719 | Ga0068861_100059967 | Ga0068861_1000599672 | 149 |
| 229 | 3300005719 | Ga0068861_100661429 | Ga0068861_1006614292 | 149 |
| 230 | 3300005719 | Ga0068861_100873601 | Ga0068861_1008736012 | 149 |
| 231 | 3300005834 | Ga0068851_10109301 | Ga0068851_101093012 | 149 |
| 232 | 3300005840 | Ga0068870_10052294 | Ga0068870_100522942 | 149 |
| 233 | 3300005840 | Ga0068870_10138097 | Ga0068870_101380972 | 149 |
| 234 | 3300005841 | Ga0068863_100386484 | Ga0068863_1003864842 | 149 |
| 235 | 3300005841 | Ga0068863_100712880 | Ga0068863_1007128802 | 149 |
| 236 | 3300005842 | Ga0068858_101717458 | Ga0068858_1017174582 | 149 |
| 237 | 3300005843 | Ga0068860_100021634 | Ga0068860_1000216345 | 149 |
| 238 | 3300005843 | Ga0068860_100094883 | Ga0068860_1000948832 | 149 |
| 239 | 3300005844 | Ga0068862_100301648 | Ga0068862_1003016482 | 149 |
| 240 | 3300005844 | Ga0068862_100796241 | Ga0068862_1007962411 | 149 |
| 241 | 3300006195 | Ga0075366_10174505 | Ga0075366_101745052 | 149 |
| 242 | 3300006237 | Ga0097621_100132172 | Ga0097621_1001321721 | 149 |
| 243 | 3300006237 | Ga0097621_100785940 | Ga0097621_1007859402 | 149 |
| 244 | 3300006353 | Ga0075370_10301306 | Ga0075370_103013062 | 149 |
| 245 | 3300006358 | Ga0068871_100061687 | Ga0068871_1000616872 | 149 |
| 246 | 3300006358 | Ga0068871_100993816 | Ga0068871_1009938162 | 149 |
| 247 | 3300006846 | Ga0075430_100040211 | Ga0075430_1000402115 | 149 |
| 248 | 3300006847 | Ga0075431_100007533 | Ga0075431_1000075332 | 149 |
| 249 | 3300006871 | Ga0075434_100280972 | Ga0075434_1002809722 | 149 |
| 250 | 3300006880 | Ga0075429_100602584 | Ga0075429_1006025842 | 149 |
| 251 | 3300006881 | Ga0068865_100097657 | Ga0068865_1000976572 | 149 |
| 252 | 3300006931 | Ga0097620_100021622 | Ga0097620_1000216222 | 149 |
| 253 | 3300006931 | Ga0097620_100092539 | Ga0097620_1000925393 | 149 |
| 254 | 3300006931 | Ga0097620_100215668 | Ga0097620_1002156682 | 149 |
| 255 | 3300006931 | Ga0097620_101644762 | Ga0097620_1016447622 | 149 |
| 256 | 3300009011 | Ga0105251_10082619 | Ga0105251_100826192 | 149 |
| 257 | 3300009147 | Ga0114129_10044941 | Ga0114129_100449414 | 149 |
| 258 | 3300009148 | Ga0105243_10315584 | Ga0105243_103155842 | 149 |
| 259 | 3300009148 | Ga0105243_11820607 | Ga0105243_118206071 | 149 |
| 260 | 3300009174 | Ga0105241_10912484 | Ga0105241_109124841 | 149 |
| 261 | 3300009176 | Ga0105242_10021120 | Ga0105242_100211204 | 149 |
| 262 | 3300009176 | Ga0105242_10045438 | Ga0105242_100454382 | 149 |
| 263 | 3300009176 | Ga0105242_10047631 | Ga0105242_100476315 | 149 |
| 264 | 3300009177 | Ga0105248_11314942 | Ga0105248_113149422 | 149 |
| 265 | 3300009177 | Ga0105248_11605788 | Ga0105248_116057881 | 149 |
| 266 | 3300009545 | Ga0105237_10002986 | Ga0105237_100029868 | 149 |
| 267 | 3300009545 | Ga0105237_11146714 | Ga0105237_111467142 | 149 |
| 268 | 3300009553 | Ga0105249_10002214 | Ga0105249_100022149 | 149 |
| 269 | 3300009553 | Ga0105249_10501110 | Ga0105249_105011102 | 149 |
| 270 | 3300009553 | Ga0105249_10748743 | Ga0105249_107487432 | 149 |
| 271 | 3300009553 | Ga0105249_10976982 | Ga0105249_109769822 | 149 |
| 272 | 3300011119 | Ga0105246_10030651 | Ga0105246_100306513 | 149 |
| 273 | 3300011119 | Ga0105246_10705068 | Ga0105246_107050682 | 149 |
| 274 | 3300013102 | Ga0157371_10133716 | Ga0157371_101337162 | 149 |
| 275 | 3300013102 | Ga0157371_11228560 | Ga0157371_112285601 | 149 |
| 276 | 3300013296 | Ga0157374_10013695 | Ga0157374_100136955 | 149 |
| 277 | 3300013296 | Ga0157374_10135011 | Ga0157374_101350112 | 149 |
| 278 | 3300013296 | Ga0157374_10135399 | Ga0157374_101353993 | 149 |
| 279 | 3300013297 | Ga0157378_10028401 | Ga0157378_100284012 | 149 |
| 280 | 3300013297 | Ga0157378_10125389 | Ga0157378_101253892 | 149 |
| 281 | 3300013297 | Ga0157378_11280963 | Ga0157378_112809631 | 149 |
| 282 | 3300013306 | Ga0163162_10008971 | Ga0163162_100089717 | 149 |
| 283 | 3300013307 | Ga0157372_10436339 | Ga0157372_104363392 | 149 |
| 284 | 3300013307 | Ga0157372_10604826 | Ga0157372_106048262 | 149 |
| 285 | 3300013308 | Ga0157375_10020065 | Ga0157375_100200655 | 149 |
| 286 | 3300013308 | Ga0157375_10217601 | Ga0157375_102176012 | 149 |
| 287 | 3300014326 | Ga0157380_10047715 | Ga0157380_100477153 | 149 |
| 288 | 3300014745 | Ga0157377_10089561 | Ga0157377_100895612 | 149 |
| 289 | 3300014745 | Ga0157377_10238574 | Ga0157377_102385741 | 149 |
| 290 | 3300014745 | Ga0157377_10314801 | Ga0157377_103148012 | 149 |
| 291 | 3300014968 | Ga0157379_10188717 | Ga0157379_101887172 | 149 |
| 292 | 3300014969 | Ga0157376_10926707 | Ga0157376_109267072 | 149 |
| 293 | 3300017792 | Ga0163161_10032192 | Ga0163161_100321923 | 149 |
| 294 | 3300025321 | Ga0207656_10170344 | Ga0207656_101703441 | 149 |
| 295 | 3300025893 | Ga0207682_10057252 | Ga0207682_100572522 | 149 |
| 296 | 3300025899 | Ga0207642_10336257 | Ga0207642_103362572 | 149 |
| 297 | 3300025901 | Ga0207688_10046604 | Ga0207688_100466041 | 149 |
| 298 | 3300025903 | Ga0207680_10041039 | Ga0207680_100410391 | 149 |
| 299 | 3300025907 | Ga0207645_10003340 | Ga0207645_100033408 | 149 |
| 300 | 3300025907 | Ga0207645_10003952 | Ga0207645_100039525 | 149 |
| 301 | 3300025907 | Ga0207645_10045411 | Ga0207645_100454115 | 149 |
| 302 | 3300025907 | Ga0207645_10180050 | Ga0207645_101800502 | 149 |
| 303 | 3300025914 | Ga0207671_10001751 | Ga0207671_1000175111 | 149 |
| 304 | 3300025923 | Ga0207681_10423297 | Ga0207681_104232972 | 149 |
| 305 | 3300025923 | Ga0207681_10938128 | Ga0207681_109381282 | 149 |
| 306 | 3300025925 | Ga0207650_10177823 | Ga0207650_101778232 | 149 |
| 307 | 3300025925 | Ga0207650_10313892 | Ga0207650_103138922 | 149 |
| 308 | 3300025926 | Ga0207659_10075844 | Ga0207659_100758442 | 149 |
| 309 | 3300025926 | Ga0207659_10498417 | Ga0207659_104984172 | 149 |
| 310 | 3300025933 | Ga0207706_11083693 | Ga0207706_110836932 | 149 |
| 311 | 3300025934 | Ga0207686_10080936 | Ga0207686_100809362 | 149 |
| 312 | 3300025934 | Ga0207686_10277776 | Ga0207686_102777761 | 149 |
| 313 | 3300025938 | Ga0207704_10156205 | Ga0207704_101562052 | 149 |
| 314 | 3300025938 | Ga0207704_10507604 | Ga0207704_105076042 | 149 |
| 315 | 3300025939 | Ga0207665_10599053 | Ga0207665_105990531 | 149 |
| 316 | 3300025940 | Ga0207691_10040446 | Ga0207691_100404463 | 149 |
| 317 | 3300025940 | Ga0207691_10196204 | Ga0207691_101962042 | 149 |
| 318 | 3300025942 | Ga0207689_10011440 | Ga0207689_100114404 | 149 |
| 319 | 3300025942 | Ga0207689_10014019 | Ga0207689_100140194 | 149 |
| 320 | 3300025942 | Ga0207689_10021437 | Ga0207689_100214372 | 149 |
| 321 | 3300025942 | Ga0207689_10024277 | Ga0207689_100242772 | 149 |
| 322 | 3300025944 | Ga0207661_10124296 | Ga0207661_101242961 | 149 |
| 323 | 3300025945 | Ga0207679_10382728 | Ga0207679_103827281 | 149 |
| 324 | 3300025945 | Ga0207679_10464318 | Ga0207679_104643182 | 149 |
| 325 | 3300025945 | Ga0207679_10945361 | Ga0207679_109453612 | 149 |
| 326 | 3300025960 | Ga0207651_10257945 | Ga0207651_102579452 | 149 |
| 327 | 3300025960 | Ga0207651_10338956 | Ga0207651_103389561 | 149 |
| 328 | 3300025960 | Ga0207651_10411228 | Ga0207651_104112282 | 149 |
| 329 | 3300025961 | Ga0207712_10089220 | Ga0207712_100892202 | 149 |
| 330 | 3300025961 | Ga0207712_11193576 | Ga0207712_111935762 | 149 |
| 331 | 3300025972 | Ga0207668_11332115 | Ga0207668_113321151 | 149 |
| 332 | 3300025981 | Ga0207640_10009494 | Ga0207640_100094942 | 149 |
| 333 | 3300025981 | Ga0207640_10531280 | Ga0207640_105312801 | 149 |
| 334 | 3300025981 | Ga0207640_10831202 | Ga0207640_108312022 | 149 |
| 335 | 3300025986 | Ga0207658_10027460 | Ga0207658_100274602 | 149 |
| 336 | 3300026023 | Ga0207677_10013428 | Ga0207677_100134284 | 149 |
| 337 | 3300026023 | Ga0207677_10159328 | Ga0207677_101593282 | 149 |
| 338 | 3300026041 | Ga0207639_10125932 | Ga0207639_101259323 | 149 |
| 339 | 3300026041 | Ga0207639_10737969 | Ga0207639_107379692 | 149 |
| 340 | 3300026088 | Ga0207641_12110460 | Ga0207641_121104601 | 149 |
| 341 | 3300026089 | Ga0207648_10001120 | Ga0207648_100011204 | 149 |
| 342 | 3300026089 | Ga0207648_10007711 | Ga0207648_100077112 | 149 |
| 343 | 3300026089 | Ga0207648_10030947 | Ga0207648_100309474 | 149 |
| 344 | 3300026089 | Ga0207648_10356924 | Ga0207648_103569242 | 149 |
| 345 | 3300026089 | Ga0207648_10631296 | Ga0207648_106312962 | 149 |
| 346 | 3300026095 | Ga0207676_10087015 | Ga0207676_100870154 | 149 |
| 347 | 3300026116 | Ga0207674_10167713 | Ga0207674_101677132 | 149 |
| 348 | 3300026116 | Ga0207674_10207475 | Ga0207674_102074752 | 149 |
| 349 | 3300026116 | Ga0207674_10284341 | Ga0207674_102843412 | 149 |
| 350 | 3300026116 | Ga0207674_10789794 | Ga0207674_107897942 | 149 |
| 351 | 3300026118 | Ga0207675_100164020 | Ga0207675_1001640202 | 149 |
| 352 | 3300026118 | Ga0207675_100479667 | Ga0207675_1004796671 | 149 |
| 353 | 3300026121 | Ga0207683_10020177 | Ga0207683_100201774 | 149 |
| 354 | 3300026142 | Ga0207698_10767814 | Ga0207698_107678141 | 149 |
| 355 | 3300028379 | Ga0268266_10924967 | Ga0268266_109249671 | 149 |
| 356 | 3300028380 | Ga0268265_10103200 | Ga0268265_101032002 | 149 |
| 357 | 3300028380 | Ga0268265_10320306 | Ga0268265_103203062 | 149 |
| 358 | 3300028380 | Ga0268265_10334421 | Ga0268265_103344212 | 149 |
| 359 | 3300031901 | Ga0307406_10308520 | Ga0307406_103085202 | 149 |
| 360 | 3300031903 | Ga0307407_10290197 | Ga0307407_102901972 | 149 |
| 361 | 3300032004 | Ga0307414_11862694 | Ga0307414_118626941 | 149 |
| 362 | 3300032005 | Ga0307411_10776280 | Ga0307411_107762802 | 149 |
| 363 | 3300035092 | Ga0373952_0053709 | Ga0373952_0053709_462_911 | 149 |
| 364 | 3300037312 | Ga0395899_0162494 | Ga0395899_0162494_142_636 | 149 |
| 365 | 3300037418 | Ga0395900_0061706 | Ga0395900_0061706_1128_1580 | 149 |
| 366 | 3300037466 | Ga0395898_0753634 | Ga0395898_0753634_238_690 | 149 |
| 367 | 3300037471 | Ga0395905_0000424 | Ga0395905_0000424_48306_48758 | 149 |
| 368 | 3300037471 | Ga0395905_0046490 | Ga0395905_0046490_68_520 | 149 |
| 369 | 3300038443 | Ga0395901_0443612 | Ga0395901_0443612_620_1114 | 149 |
| 370 | 3300041443 | Ga0451789_1159392 | Ga0451789_1159392_55_507 | 149 |
| 371 | 3300041451 | Ga0451791_1183411 | Ga0451791_1183411_38_487 | 149 |
| 372 | 3300042004 | Ga0439445_0112974 | Ga0439445_0112974_125_577 | 149 |
| 373 | 3300047320 | Ga0495672_0010538 | Ga0495672_0010538_5961_6410 | 149 |
| 374 | 3300049513 | Ga0501290_017577 | Ga0501290_017577_240_692 | 149 |
| 375 | 3300049541 | Ga0501325_032545 | Ga0501325_032545_72_524 | 149 |
| 376 | 3300049568 | Ga0501031_0034538 | Ga0501031_0034538_2283_2744 | 149 |
| 377 | 3300049572 | Ga0501036_0011069 | Ga0501036_0011069_6818_7279 | 149 |
| 378 | 3300049573 | Ga0501037_0431021 | Ga0501037_0431021_131_592 | 149 |
| 379 | 3300049575 | Ga0501039_0001372 | Ga0501039_0001372_16313_16774 | 149 |
| 380 | 3300049580 | Ga0501046_0033128 | Ga0501046_0033128_3492_3953 | 149 |
| 381 | 3300049584 | Ga0501068_0760274 | Ga0501068_0760274_37_498 | 149 |
| 382 | 3300049686 | Ga0501257_242908 | Ga0501257_242908_24_476 | 149 |
| 383 | 3300049708 | Ga0501245_001491 | Ga0501245_001491_2420_2872 | 149 |
| 384 | 3300049822 | Ga0501035_0013079 | Ga0501035_0013079_510_971 | 149 |
| 385 | 3300049823 | Ga0501044_0013204 | Ga0501044_0013204_3560_4021 | 149 |
| 386 | 3300050493 | nmdc:mga0k408_148375_c1 | nmdc:mga0k408_148375_c1_672_1121 | 149 |
| 387 | 3300050496 | nmdc:mga07m45_98179_c1 | nmdc:mga07m45_98179_c1_446_895 | 149 |
| 388 | 3300050507 | nmdc:mga05p37_353212_c1 | nmdc:mga05p37_353212_c1_208_657 | 149 |
| 389 | 3300050509 | nmdc:mga0qj67_134675_c1 | nmdc:mga0qj67_134675_c1_1521_1970 | 149 |
| 390 | 3300050510 | nmdc:mga06r32_15655_c1 | nmdc:mga06r32_15655_c1_440_889 | 149 |
| 391 | 3300050512 | nmdc:mga0n895_280971_c1 | nmdc:mga0n895_280971_c1_326_775 | 149 |
| 392 | 3300050514 | nmdc:mga08x19_681498_c1 | nmdc:mga08x19_681498_c1_59_508 | 149 |
| 393 | 3300053139 | Ga0500568_0000325 | Ga0500568_0000325_8270_8719 | 149 |
| 394 | 3300053727 | Ga0500611_000029 | Ga0500611_000029_35924_36373 | 149 |
| 395 | 3300000545 | CNXas_1001701 | CNXas_10017012 | 150 |
| 396 | 3300005328 | Ga0070676_10624832 | Ga0070676_106248321 | 150 |
| 397 | 3300005335 | Ga0070666_10245172 | Ga0070666_102451722 | 150 |
| 398 | 3300005340 | Ga0070689_100013924 | Ga0070689_1000139245 | 150 |
| 399 | 3300005340 | Ga0070689_100189998 | Ga0070689_1001899982 | 150 |
| 400 | 3300005343 | Ga0070687_100303300 | Ga0070687_1003033001 | 150 |
| 401 | 3300005353 | Ga0070669_100073476 | Ga0070669_1000734762 | 150 |
| 402 | 3300005355 | Ga0070671_100158811 | Ga0070671_1001588112 | 150 |
| 403 | 3300005365 | Ga0070688_100590900 | Ga0070688_1005909001 | 150 |
| 404 | 3300005466 | Ga0070685_10031299 | Ga0070685_100312994 | 150 |
| 405 | 3300005466 | Ga0070685_10158664 | Ga0070685_101586642 | 150 |
| 406 | 3300005471 | Ga0070698_100997594 | Ga0070698_1009975942 | 150 |
| 407 | 3300005539 | Ga0068853_100500323 | Ga0068853_1005003231 | 150 |
| 408 | 3300005544 | Ga0070686_100319185 | Ga0070686_1003191852 | 150 |
| 409 | 3300005548 | Ga0070665_100026771 | Ga0070665_1000267715 | 150 |
| 410 | 3300005564 | Ga0070664_100081185 | Ga0070664_1000811853 | 150 |
| 411 | 3300005578 | Ga0068854_100773130 | Ga0068854_1007731302 | 150 |
| 412 | 3300005616 | Ga0068852_100105798 | Ga0068852_1001057982 | 150 |
| 413 | 3300005617 | Ga0068859_100008920 | Ga0068859_1000089204 | 150 |
| 414 | 3300005617 | Ga0068859_100127521 | Ga0068859_1001275213 | 150 |
| 415 | 3300005618 | Ga0068864_100123191 | Ga0068864_1001231912 | 150 |
| 416 | 3300005719 | Ga0068861_100270121 | Ga0068861_1002701212 | 150 |
| 417 | 3300005841 | Ga0068863_100119799 | Ga0068863_1001197992 | 150 |
| 418 | 3300005843 | Ga0068860_100013054 | Ga0068860_1000130542 | 150 |
| 419 | 3300006195 | Ga0075366_10487889 | Ga0075366_104878892 | 150 |
| 420 | 3300006237 | Ga0097621_100028195 | Ga0097621_1000281953 | 150 |
| 421 | 3300006358 | Ga0068871_100141121 | Ga0068871_1001411212 | 150 |
| 422 | 3300006931 | Ga0097620_100008921 | Ga0097620_1000089216 | 150 |
| 423 | 3300006931 | Ga0097620_100127517 | Ga0097620_1001275172 | 150 |
| 424 | 3300009011 | Ga0105251_10075659 | Ga0105251_100756591 | 150 |
| 425 | 3300009101 | Ga0105247_10010935 | Ga0105247_100109352 | 150 |
| 426 | 3300009101 | Ga0105247_10111736 | Ga0105247_101117362 | 150 |
| 427 | 3300009174 | Ga0105241_10878340 | Ga0105241_108783402 | 150 |
| 428 | 3300009545 | Ga0105237_11356340 | Ga0105237_113563401 | 150 |
| 429 | 3300009553 | Ga0105249_10004989 | Ga0105249_100049894 | 150 |
| 430 | 3300009553 | Ga0105249_10189091 | Ga0105249_101890912 | 150 |
| 431 | 3300009553 | Ga0105249_10228291 | Ga0105249_102282912 | 150 |
| 432 | 3300010375 | Ga0105239_10507864 | Ga0105239_105078642 | 150 |
| 433 | 3300013102 | Ga0157371_10013093 | Ga0157371_100130932 | 150 |
| 434 | 3300013306 | Ga0163162_10026684 | Ga0163162_100266844 | 150 |
| 435 | 3300013307 | Ga0157372_10049281 | Ga0157372_100492812 | 150 |
| 436 | 3300013307 | Ga0157372_10324467 | Ga0157372_103244672 | 150 |
| 437 | 3300013308 | Ga0157375_10230377 | Ga0157375_102303772 | 150 |
| 438 | 3300014325 | Ga0163163_10013411 | Ga0163163_100134114 | 150 |
| 439 | 3300014326 | Ga0157380_10532229 | Ga0157380_105322292 | 150 |
| 440 | 3300014968 | Ga0157379_10013647 | Ga0157379_100136475 | 150 |
| 441 | 3300017792 | Ga0163161_10782601 | Ga0163161_107826011 | 150 |
| 442 | 3300025735 | Ga0207713_1085405 | Ga0207713_10854052 | 150 |
| 443 | 3300025735 | Ga0207713_1167837 | Ga0207713_11678371 | 150 |
| 444 | 3300025900 | Ga0207710_10137711 | Ga0207710_101377112 | 150 |
| 445 | 3300025903 | Ga0207680_10034057 | Ga0207680_100340572 | 150 |
| 446 | 3300025923 | Ga0207681_10404371 | Ga0207681_104043711 | 150 |
| 447 | 3300025936 | Ga0207670_10200327 | Ga0207670_102003272 | 150 |
| 448 | 3300025940 | Ga0207691_10876468 | Ga0207691_108764682 | 150 |
| 449 | 3300025944 | Ga0207661_10476134 | Ga0207661_104761342 | 150 |
| 450 | 3300025961 | Ga0207712_10000776 | Ga0207712_100007766 | 150 |
| 451 | 3300025961 | Ga0207712_10163547 | Ga0207712_101635472 | 150 |
| 452 | 3300025961 | Ga0207712_10905645 | Ga0207712_109056452 | 150 |
| 453 | 3300025986 | Ga0207658_10032899 | Ga0207658_100328992 | 150 |
| 454 | 3300025986 | Ga0207658_10302544 | Ga0207658_103025441 | 150 |
| 455 | 3300026035 | Ga0207703_10143535 | Ga0207703_101435351 | 150 |
| 456 | 3300026088 | Ga0207641_10035434 | Ga0207641_100354344 | 150 |
| 457 | 3300026089 | Ga0207648_10589373 | Ga0207648_105893732 | 150 |
| 458 | 3300026095 | Ga0207676_10015323 | Ga0207676_100153232 | 150 |
| 459 | 3300026095 | Ga0207676_10111161 | Ga0207676_101111612 | 150 |
| 460 | 3300026116 | Ga0207674_10275746 | Ga0207674_102757462 | 150 |
| 461 | 3300026118 | Ga0207675_100088702 | Ga0207675_1000887023 | 150 |
| 462 | 3300028379 | Ga0268266_10043665 | Ga0268266_100436654 | 150 |
| 463 | 3300028381 | Ga0268264_10010462 | Ga0268264_100104626 | 150 |
| 464 | 3300030731 | Ga0316177_1112842 | Ga0316177_11128421 | 150 |
| 465 | 3300031911 | Ga0307412_10544248 | Ga0307412_105442482 | 150 |
| 466 | 3300032005 | Ga0307411_10036675 | Ga0307411_100366753 | 150 |
| 467 | 3300032005 | Ga0307411_11889139 | Ga0307411_118891391 | 150 |
| 468 | 3300041404 | Ga0439436_0062920 | Ga0439436_0062920_245_742 | 150 |
| 469 | 3300041406 | Ga0439439_0047255 | Ga0439439_0047255_397_894 | 150 |
| 470 | 3300041410 | Ga0439461_0015853 | Ga0439461_0015853_693_1190 | 150 |
| 471 | 3300041413 | Ga0439465_0015661 | Ga0439465_0015661_798_1295 | 150 |
| 472 | 3300041413 | Ga0439465_0169551 | Ga0439465_0169551_28_483 | 150 |
| 473 | 3300041997 | Ga0439431_0083991 | Ga0439431_0083991_281_778 | 150 |
| 474 | 3300042002 | Ga0439442_011768 | Ga0439442_011768_1133_1630 | 150 |
| 475 | 3300042004 | Ga0439445_0026632 | Ga0439445_0026632_604_1101 | 150 |
| 476 | 3300042011 | Ga0439454_055359 | Ga0439454_055359_63_515 | 150 |
| 477 | 3300042134 | Ga0450898_005533 | Ga0450898_005533_1243_1740 | 150 |
| 478 | 3300042135 | Ga0450899_008881 | Ga0450899_008881_619_1077 | 150 |
| 479 | 3300042435 | Ga0439434_0019373 | Ga0439434_0019373_192_689 | 150 |
| 480 | 3300042436 | Ga0439435_0271473 | Ga0439435_0271473_23_520 | 150 |
| 481 | 3300046522 | Ga0495643_0063329 | Ga0495643_0063329_219_671 | 150 |
| 482 | 3300047320 | Ga0495672_0007070 | Ga0495672_0007070_5917_6369 | 150 |
| 483 | 3300048913 | Ga0496110_0223340 | Ga0496110_0223340_1125_1580 | 150 |
| 484 | 3300048916 | Ga0496113_1260966 | Ga0496113_1260966_48_503 | 150 |
| 485 | 3300049161 | Ga0501305_052219 | Ga0501305_052219_128_580 | 150 |
| 486 | 3300049531 | Ga0501315_004199 | Ga0501315_004199_295_750 | 150 |
| 487 | 3300049533 | Ga0501317_025489 | Ga0501317_025489_251_706 | 150 |
| 488 | 3300049537 | Ga0501321_021937 | Ga0501321_021937_131_586 | 150 |
| 489 | 3300049543 | Ga0501327_15172 | Ga0501327_15172_78_533 | 150 |
| 490 | 3300049569 | Ga0501032_0010226 | Ga0501032_0010226_5653_6117 | 150 |
| 491 | 3300049571 | Ga0501034_0007266 | Ga0501034_0007266_3327_3791 | 150 |
| 492 | 3300049572 | Ga0501036_0034183 | Ga0501036_0034183_1342_1806 | 150 |
| 493 | 3300049573 | Ga0501037_0048313 | Ga0501037_0048313_47_511 | 150 |
| 494 | 3300049578 | Ga0501042_0065928 | Ga0501042_0065928_1455_1919 | 150 |
| 495 | 3300049579 | Ga0501043_0009418 | Ga0501043_0009418_4070_4534 | 150 |
| 496 | 3300049580 | Ga0501046_0356833 | Ga0501046_0356833_47_502 | 150 |
| 497 | 3300049581 | Ga0501047_0044953 | Ga0501047_0044953_2004_2468 | 150 |
| 498 | 3300049582 | Ga0501048_0145326 | Ga0501048_0145326_540_1004 | 150 |
| 499 | 3300049583 | Ga0501067_0060114 | Ga0501067_0060114_678_1142 | 150 |
| 500 | 3300049584 | Ga0501068_0346208 | Ga0501068_0346208_256_720 | 150 |
| 501 | 3300049589 | Ga0501073_0004832 | Ga0501073_0004832_8027_8491 | 150 |
| 502 | 3300049590 | Ga0501074_0001779 | Ga0501074_0001779_1659_2123 | 150 |
| 503 | 3300049591 | Ga0501075_1222825 | Ga0501075_1222825_61_525 | 150 |
| 504 | 3300049679 | Ga0501249_110678 | Ga0501249_110678_70_525 | 150 |
| 505 | 3300049741 | Ga0501079_0239029 | Ga0501079_0239029_76_540 | 150 |
| 506 | 3300049742 | Ga0501080_0097369 | Ga0501080_0097369_1494_1958 | 150 |
| 507 | 3300049744 | Ga0501083_0005688 | Ga0501083_0005688_3145_3609 | 150 |
| 508 | 3300049822 | Ga0501035_0012125 | Ga0501035_0012125_6109_6573 | 150 |
| 509 | 3300049823 | Ga0501044_0003510 | Ga0501044_0003510_6105_6569 | 150 |
| 510 | 3300049824 | Ga0501045_0136884 | Ga0501045_0136884_651_1115 | 150 |
| 511 | 3300050493 | nmdc:mga0k408_703386_c1 | nmdc:mga0k408_703386_c1_29_490 | 150 |
| 512 | 3300053153 | Ga0500616_0047079 | Ga0500616_0047079_1067_1519 | 150 |
| 513 | 3300054114 | Ga0501084_0586477 | Ga0501084_0586477_195_659 | 150 |
| 514 | 2162886011 | MRS1b_contig_5087598 | MRS1b_0360.00002850 | 151 |
| 515 | 2162886012 | MBSR1b_contig_3015194 | MBSR1b_0866.00004730 | 151 |
| 516 | 2162886012 | MBSR1b_contig_3057618 | MBSR1b_0677.00007170 | 151 |
| 517 | 3300002155 | JGI24033J26618_1013705 | JGI24033J26618_10137052 | 151 |
| 518 | 3300005289 | Ga0065704_10347901 | Ga0065704_103479011 | 151 |
| 519 | 3300005290 | Ga0065712_10000839 | Ga0065712_100008394 | 151 |
| 520 | 3300005293 | Ga0065715_10185083 | Ga0065715_101850832 | 151 |
| 521 | 3300005295 | Ga0065707_10005177 | Ga0065707_100051773 | 151 |
| 522 | 3300005331 | Ga0070670_100037744 | Ga0070670_1000377443 | 151 |
| 523 | 3300005334 | Ga0068869_100005837 | Ga0068869_1000058374 | 151 |
| 524 | 3300005338 | Ga0068868_100748030 | Ga0068868_1007480302 | 151 |
| 525 | 3300005340 | Ga0070689_100016475 | Ga0070689_1000164755 | 151 |
| 526 | 3300005343 | Ga0070687_100144083 | Ga0070687_1001440832 | 151 |
| 527 | 3300005354 | Ga0070675_100006621 | Ga0070675_1000066212 | 151 |
| 528 | 3300005364 | Ga0070673_100006390 | Ga0070673_1000063902 | 151 |
| 529 | 3300005365 | Ga0070688_100004101 | Ga0070688_1000041012 | 151 |
| 530 | 3300005459 | Ga0068867_100017470 | Ga0068867_1000174702 | 151 |
| 531 | 3300005577 | Ga0068857_100058130 | Ga0068857_1000581302 | 151 |
| 532 | 3300005617 | Ga0068859_100082520 | Ga0068859_1000825202 | 151 |
| 533 | 3300005719 | Ga0068861_100012180 | Ga0068861_1000121802 | 151 |
| 534 | 3300005840 | Ga0068870_10002874 | Ga0068870_100028742 | 151 |
| 535 | 3300005844 | Ga0068862_100035100 | Ga0068862_1000351004 | 151 |
| 536 | 3300006931 | Ga0097620_100082520 | Ga0097620_1000825203 | 151 |
| 537 | 3300009094 | Ga0111539_10002057 | Ga0111539_100020575 | 151 |
| 538 | 3300009174 | Ga0105241_10618263 | Ga0105241_106182631 | 151 |
| 539 | 3300009553 | Ga0105249_10175390 | Ga0105249_101753902 | 151 |
| 540 | 3300013308 | Ga0157375_10017430 | Ga0157375_100174304 | 151 |
| 541 | 3300014325 | Ga0163163_11422338 | Ga0163163_114223381 | 151 |
| 542 | 3300014326 | Ga0157380_10006849 | Ga0157380_100068493 | 151 |
| 543 | 3300014745 | Ga0157377_10000417 | Ga0157377_1000041710 | 151 |
| 544 | 3300025271 | Ga0207666_1021785 | Ga0207666_10217852 | 151 |
| 545 | 3300025315 | Ga0207697_10039214 | Ga0207697_100392142 | 151 |
| 546 | 3300025907 | Ga0207645_10113368 | Ga0207645_101133682 | 151 |
| 547 | 3300025908 | Ga0207643_10009563 | Ga0207643_100095634 | 151 |
| 548 | 3300025923 | Ga0207681_10032255 | Ga0207681_100322552 | 151 |
| 549 | 3300025925 | Ga0207650_10392058 | Ga0207650_103920581 | 151 |
| 550 | 3300025926 | Ga0207659_10176470 | Ga0207659_101764702 | 151 |
| 551 | 3300025936 | Ga0207670_10109596 | Ga0207670_101095962 | 151 |
| 552 | 3300025940 | Ga0207691_10039336 | Ga0207691_100393362 | 151 |
| 553 | 3300025942 | Ga0207689_10020156 | Ga0207689_100201562 | 151 |
| 554 | 3300025961 | Ga0207712_10099531 | Ga0207712_100995313 | 151 |
| 555 | 3300025972 | Ga0207668_10173520 | Ga0207668_101735201 | 151 |
| 556 | 3300026023 | Ga0207677_10852677 | Ga0207677_108526772 | 151 |
| 557 | 3300026089 | Ga0207648_10035005 | Ga0207648_100350054 | 151 |
| 558 | 3300026116 | Ga0207674_10011127 | Ga0207674_100111274 | 151 |
| 559 | 3300026118 | Ga0207675_100003924 | Ga0207675_1000039246 | 151 |
| 560 | 3300027907 | Ga0207428_10016019 | Ga0207428_100160193 | 151 |
| 561 | 3300028380 | Ga0268265_10010677 | Ga0268265_100106774 | 151 |
| 562 | 3300050511 | nmdc:mga08y16_17537_c1 | nmdc:mga08y16_17537_c1_5900_6364 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dnv-assembly2.cif.gz_B | crystal structure of neisseria meningitidis dsbd n-terminal domain in the reduced form | 0.6952 | 18 | 148 |
| 2e9g-assembly1.cif.gz_A | solution structure of the alpha adaptinc2 domain from human adapter-related protein complex 1 gamma 2 subunit | 0.6887 | 21 | 147 |
| 6c29-assembly3.cif.gz_C | crystal structure of the n-terminal periplasmic domain of scsb from proteus mirabilis | 0.6756 | 25 | 150 |
| 2k9f-assembly1.cif.gz_B | structural features of the complex between the dsbd n-terminal and the pilb n-terminal domains from neisseria meningitidis | 0.6749 | 19 | 147 |
| 3mnm-assembly1.cif.gz_A | crystal structure of gae domain of gga2p from saccharomyces cerevisiae | 0.6572 | 21 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6dnvB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Thiol:disulfide interchange protein DsbD, N-terminal domain | 0.6952 | 18 | 148 | 2.60.40.1250 |
| af_Q8I4W9_644_772_2.60.40.1230 | Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain | 0.6952 | 24 | 146 | 2.60.40.1230 |
| af_Q86KI1_749_872_2.60.40.1230 | Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain | 0.6813 | 25 | 151 | 2.60.40.1230 |
| af_B0R024_667_786_2.60.40.1230 | Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain | 0.6655 | 23 | 146 | 2.60.40.1230 |
| 5cn1C00 | Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain | 0.6518 | 21 | 149 | 2.60.40.1230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3HLL6-F1-model_v4 | Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein | 0.9608 | 19 | 150 |
|
| AF-A0A1Q3TG54-F1-model_v4 | Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein | 0.9581 | 24 | 151 |
|
| AF-A0A2P8DCC0-F1-model_v4 | Thiol:disulfide interchange protein DsbD | 0.9546 | 25 | 151 |
GO:0005886
GO:0015035 GO:0017004 GO:0045454 |
| AF-A0A644UDE8-F1-model_v4 | Thiol:disulfide interchange protein DsbD (EC 1.8.1.8) | 0.9477 | 24 | 151 |
GO:0016020
GO:0017004 GO:0045454 GO:0047134 |
| AF-A0A7T9QQ28-F1-model_v4 | deleted | 0.9427 | 23 | 150 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar