F463904

General Info

Members Datasets Scaffolds Average Seq Length
562 230 562 150

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100997594|Ga0070698_1009975942
Length 170
Sequence MTKRKIGCFNFEQIFNIMMGMKTVLAFLLITVTTITANAQLNPVSWSFSAKKIADKTYEVHLTASMQSGWHLYSQTQPDDAIAIPTGFKINNNPLLLLEGKIKEVGKMEKFHDAKLEVSANQYSEKVDFVQVVKLKANAKTNLTGSVEYQTCDDKKCLPPKTVNFTIPVK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
155 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
161 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
162 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
163 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
164 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
165 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
168 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
169 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
183 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 2.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0
Rhizoplane 1.07
Rhizosphere 96.8
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_5087598 2162886011 Bacteria 3694
2 MRS1b_contig_9194533 2162886011 Bacteria 2280
3 MBSR1b_contig_3015194 2162886012 Bacteria 1241
4 MBSR1b_contig_3057618 2162886012 Bacteria 2518
5 CNXas_1001701 3300000545 Unclassified 1483
6 JGI24744J21845_10005535 3300002077 Bacteria 2613
7 JGI24033J26618_1013705 3300002155 Unclassified 987
8 rootL2_10349925 3300003322 Bacteria 2134
9 Ga0065704_10347901 3300005289 Bacteria 814
10 Ga0065712_10000839 3300005290 Bacteria 11700
11 Ga0065715_10105240 3300005293 Bacteria 2900
12 Ga0065715_10185083 3300005293 Unclassified 1450
13 Ga0065715_10272145 3300005293 Bacteria 1108
14 Ga0065707_10005177 3300005295 Bacteria 3920
15 Ga0070676_10002798 3300005328 Bacteria 9015
16 Ga0070676_10624832 3300005328 Bacteria 779
17 Ga0070670_100037744 3300005331 Bacteria 4155
18 Ga0070670_100173254 3300005331 Bacteria 1872
19 Ga0070670_100260621 3300005331 Bacteria 1511
20 Ga0070670_100322215 3300005331 Bacteria 1354
21 Ga0070670_100695378 3300005331 Unclassified 914
22 Ga0070677_10023349 3300005333 Bacteria 2289
23 Ga0068869_100005837 3300005334 Bacteria 7771
24 Ga0068869_100006670 3300005334 Bacteria 7333
25 Ga0068869_100057841 3300005334 Unclassified 2832
26 Ga0068869_100080736 3300005334 Bacteria 2427
27 Ga0068869_100120115 3300005334 Unclassified 2009
28 Ga0068869_100349133 3300005334 Bacteria 1205
29 Ga0070666_10117862 3300005335 Bacteria 1840
30 Ga0070666_10245172 3300005335 Bacteria 1268
31 Ga0068868_100002313 3300005338 Bacteria 13182
32 Ga0068868_100748030 3300005338 Bacteria 878
33 Ga0068868_100906180 3300005338 Unclassified 801
34 Ga0070689_100013924 3300005340 Bacteria 5834
35 Ga0070689_100016475 3300005340 Bacteria 5409
36 Ga0070689_100124028 3300005340 Bacteria 2065
37 Ga0070689_100189998 3300005340 Unclassified 1672
38 Ga0070689_100667508 3300005340 Bacteria 905
39 Ga0070687_100144083 3300005343 Bacteria 1391
40 Ga0070687_100263734 3300005343 Bacteria 1076
41 Ga0070687_100303300 3300005343 Bacteria 1014
42 Ga0070687_100342396 3300005343 Unclassified 962
43 Ga0070661_100816859 3300005344 Bacteria 766
44 Ga0070692_10237881 3300005345 Unclassified 1084
45 Ga0070668_100084137 3300005347 Bacteria 2498
46 Ga0070669_100027944 3300005353 Bacteria 4061
47 Ga0070669_100073476 3300005353 Bacteria 2533
48 Ga0070669_100137520 3300005353 Bacteria 1880
49 Ga0070669_100400808 3300005353 Bacteria 1122
50 Ga0070669_100485856 3300005353 Bacteria 1023
51 Ga0070669_100861139 3300005353 Bacteria 772
52 Ga0070675_100006621 3300005354 Bacteria 8905
53 Ga0070675_100023572 3300005354 Bacteria 4923
54 Ga0070675_100060506 3300005354 Bacteria 3127
55 Ga0070675_100133933 3300005354 Bacteria 2114
56 Ga0070675_100422499 3300005354 Bacteria 1192
57 Ga0070675_101260247 3300005354 Bacteria 681
58 Ga0070671_100158811 3300005355 Bacteria 1911
59 Ga0070671_101078297 3300005355 Bacteria 705
60 Ga0070674_100165290 3300005356 Bacteria 1682
61 Ga0070674_100838148 3300005356 Bacteria 797
62 Ga0070674_101065979 3300005356 Bacteria 712
63 Ga0070674_101543854 3300005356 Bacteria 598
64 Ga0070673_100006390 3300005364 Bacteria 7659
65 Ga0070673_100103092 3300005364 Bacteria 2353
66 Ga0070673_100117523 3300005364 Bacteria 2213
67 Ga0070673_100345696 3300005364 Bacteria 1319
68 Ga0070673_100398153 3300005364 Bacteria 1231
69 Ga0070673_100674480 3300005364 Bacteria 948
70 Ga0070688_100004101 3300005365 Bacteria 7559
71 Ga0070688_100142393 3300005365 Bacteria 1630
72 Ga0070688_100176351 3300005365 Bacteria 1479
73 Ga0070688_100178403 3300005365 Bacteria 1471
74 Ga0070688_100539065 3300005365 Bacteria 885
75 Ga0070688_100590900 3300005365 Unclassified 849
76 Ga0070659_100565597 3300005366 Bacteria 974
77 Ga0070667_100069846 3300005367 Unclassified 2990
78 Ga0070667_100544245 3300005367 Bacteria 1067
79 Ga0070701_10112236 3300005438 Unclassified 1525
80 Ga0070700_100396044 3300005441 Unclassified 1037
81 Ga0070700_100511568 3300005441 Unclassified 926
82 Ga0068867_100017470 3300005459 Bacteria 5096
83 Ga0068867_100084108 3300005459 Bacteria 2403
84 Ga0068867_100310207 3300005459 Bacteria 1303
85 Ga0068867_101245668 3300005459 Bacteria 685
86 Ga0070685_10003294 3300005466 Bacteria 8205
87 Ga0070685_10031299 3300005466 Bacteria 2972
88 Ga0070685_10051327 3300005466 Bacteria 2384
89 Ga0070685_10158664 3300005466 Unclassified 1440
90 Ga0070685_10210268 3300005466 Bacteria 1269
91 Ga0070685_10365115 3300005466 Bacteria 991
92 Ga0070685_10645325 3300005466 Bacteria 766
93 Ga0070698_100063699 3300005471 Bacteria 3718
94 Ga0070698_100997594 3300005471 Bacteria 784
95 Ga0070698_101697246 3300005471 Bacteria 584
96 Ga0070684_100003115 3300005535 Bacteria 12384
97 Ga0070684_100404354 3300005535 Bacteria 1259
98 Ga0068853_100014221 3300005539 Bacteria 6512
99 Ga0068853_100051862 3300005539 Bacteria 3532
100 Ga0068853_100500323 3300005539 Unclassified 1147
101 Ga0070672_100141359 3300005543 Bacteria 1986
102 Ga0070672_100172398 3300005543 Bacteria 1800
103 Ga0070672_100205057 3300005543 Bacteria 1650
104 Ga0070672_100293814 3300005543 Bacteria 1376
105 Ga0070672_100308648 3300005543 Unclassified 1342
106 Ga0070672_100496967 3300005543 Bacteria 1055
107 Ga0070686_100047270 3300005544 Bacteria 2720
108 Ga0070686_100055575 3300005544 Bacteria 2536
109 Ga0070686_100319185 3300005544 Bacteria 1158
110 Ga0070665_100026771 3300005548 Bacteria 5809
111 Ga0070665_100038466 3300005548 Bacteria 4809
112 Ga0070704_100195564 3300005549 Unclassified 1629
113 Ga0070664_100081185 3300005564 Bacteria 2794
114 Ga0070664_100238860 3300005564 Bacteria 1631
115 Ga0068857_100058130 3300005577 Bacteria 3433
116 Ga0068857_100144949 3300005577 Unclassified 2149
117 Ga0068857_100409161 3300005577 Bacteria 1263
118 Ga0068854_100012895 3300005578 Bacteria 5475
119 Ga0068854_100735274 3300005578 Bacteria 855
120 Ga0068854_100773130 3300005578 Bacteria 835
121 Ga0068854_100857070 3300005578 Bacteria 796
122 Ga0068856_100778051 3300005614 Bacteria 977
123 Ga0070702_100312496 3300005615 Bacteria 1091
124 Ga0068852_100034369 3300005616 Bacteria 4217
125 Ga0068852_100105798 3300005616 Bacteria 2550
126 Ga0068852_101260180 3300005616 Bacteria 761
127 Ga0068859_100008920 3300005617 Bacteria 10129
128 Ga0068859_100021622 3300005617 Bacteria 6456
129 Ga0068859_100082520 3300005617 Bacteria 3257
130 Ga0068859_100092544 3300005617 Bacteria 3075
131 Ga0068859_100127521 3300005617 Bacteria 2615
132 Ga0068859_100179724 3300005617 Bacteria 2198
133 Ga0068859_100215664 3300005617 Unclassified 2007
134 Ga0068859_100442204 3300005617 Unclassified 1396
135 Ga0068859_101645173 3300005617 Unclassified 709
136 Ga0068864_100084966 3300005618 Bacteria 2781
137 Ga0068864_100123191 3300005618 Unclassified 2320
138 Ga0068864_101005794 3300005618 Unclassified 827
139 Ga0068864_101747944 3300005618 Unclassified 627
140 Ga0068866_10029579 3300005718 Unclassified 2621
141 Ga0068866_10182261 3300005718 Bacteria 1241
142 Ga0068866_10298507 3300005718 Bacteria 1005
143 Ga0068861_100012180 3300005719 Bacteria 5995
144 Ga0068861_100042253 3300005719 Bacteria 3415
145 Ga0068861_100059967 3300005719 Bacteria 2915
146 Ga0068861_100270121 3300005719 Unclassified 1460
147 Ga0068861_100661429 3300005719 Bacteria 966
148 Ga0068861_100873601 3300005719 Bacteria 849
149 Ga0068851_10005025 3300005834 Bacteria 5997
150 Ga0068851_10109301 3300005834 Bacteria 1475
151 Ga0068851_10176367 3300005834 Unclassified 1182
152 Ga0068870_10002874 3300005840 Bacteria 7247
153 Ga0068870_10052294 3300005840 Bacteria 2166
154 Ga0068870_10138097 3300005840 Bacteria 1423
155 Ga0068870_10174131 3300005840 Bacteria 1286
156 Ga0068870_10319843 3300005840 Bacteria 986
157 Ga0068863_100075494 3300005841 Bacteria 3189
158 Ga0068863_100119799 3300005841 Bacteria 2509
159 Ga0068863_100386484 3300005841 Bacteria 1367
160 Ga0068863_100529403 3300005841 Bacteria 1162
161 Ga0068863_100712880 3300005841 Archaea 998
162 Ga0068858_100444115 3300005842 Unclassified 1249
163 Ga0068858_101717458 3300005842 Bacteria 620
164 Ga0068860_100013054 3300005843 Bacteria 8154
165 Ga0068860_100021634 3300005843 Bacteria 6227
166 Ga0068860_100094883 3300005843 Unclassified 2843
167 Ga0068860_100130883 3300005843 Bacteria 2407
168 Ga0068862_100035100 3300005844 Bacteria 4244
169 Ga0068862_100039350 3300005844 Bacteria 4015
170 Ga0068862_100278401 3300005844 Bacteria 1532
171 Ga0068862_100301648 3300005844 Bacteria 1474
172 Ga0068862_100796241 3300005844 Bacteria 923
173 Ga0070715_10367218 3300006163 Bacteria 791
174 Ga0075366_10174505 3300006195 Bacteria 1305
175 Ga0075366_10487889 3300006195 Bacteria 761
176 Ga0097621_100028195 3300006237 Bacteria 4425
177 Ga0097621_100132172 3300006237 Bacteria 2125
178 Ga0097621_100187367 3300006237 Unclassified 1790
179 Ga0097621_100592309 3300006237 Unclassified 1013
180 Ga0097621_100785940 3300006237 Bacteria 881
181 Ga0075370_10301306 3300006353 Bacteria 953
182 Ga0068871_100046293 3300006358 Bacteria 3503
183 Ga0068871_100061687 3300006358 Bacteria 3063
184 Ga0068871_100141121 3300006358 Bacteria 2049
185 Ga0068871_100993816 3300006358 Unclassified 781
186 Ga0075428_100064504 3300006844 Bacteria 4011
187 Ga0075428_100373899 3300006844 Bacteria 1528
188 Ga0075430_100040211 3300006846 Bacteria 3958
189 Ga0075431_100007533 3300006847 Bacteria 10836
190 Ga0075434_100280972 3300006871 Unclassified 1684
191 Ga0075429_100602584 3300006880 Bacteria 962
192 Ga0068865_100097657 3300006881 Bacteria 2144
193 Ga0068865_100243673 3300006881 Unclassified 1415
194 Ga0068865_100608205 3300006881 Unclassified 924
195 Ga0097620_100008921 3300006931 Bacteria 10129
196 Ga0097620_100021622 3300006931 Bacteria 6456
197 Ga0097620_100082520 3300006931 Bacteria 3257
198 Ga0097620_100092539 3300006931 Bacteria 3075
199 Ga0097620_100127517 3300006931 Bacteria 2615
200 Ga0097620_100179724 3300006931 Bacteria 2198
201 Ga0097620_100215668 3300006931 Unclassified 2007
202 Ga0097620_100442224 3300006931 Unclassified 1396
203 Ga0097620_101644762 3300006931 Unclassified 709
204 Ga0105251_10075659 3300009011 Bacteria 1563
205 Ga0105251_10082619 3300009011 Unclassified 1483
206 Ga0105251_10192332 3300009011 Bacteria 919
207 Ga0111539_10002057 3300009094 Bacteria 26904
208 Ga0111539_10074003 3300009094 Bacteria 4015
209 Ga0111539_10657996 3300009094 Bacteria 1220
210 Ga0111539_10747439 3300009094 Bacteria 1138
211 Ga0105247_10010935 3300009101 Bacteria 5479
212 Ga0105247_10111736 3300009101 Bacteria 1759
213 Ga0105247_10138653 3300009101 Bacteria 1592
214 Ga0114129_10016983 3300009147 Bacteria 10361
215 Ga0114129_10044941 3300009147 Bacteria 6211
216 Ga0105243_10315584 3300009148 Bacteria 1422
217 Ga0105243_11820607 3300009148 Unclassified 640
218 Ga0105241_10618263 3300009174 Bacteria 980
219 Ga0105241_10878340 3300009174 Bacteria 831
220 Ga0105241_10912484 3300009174 Bacteria 816
221 Ga0105242_10021120 3300009176 Bacteria 5109
222 Ga0105242_10045438 3300009176 Bacteria 3560
223 Ga0105242_10047631 3300009176 Bacteria 3481
224 Ga0105242_10082116 3300009176 Bacteria 2696
225 Ga0105242_11904435 3300009176 Bacteria 635
226 Ga0105248_10264267 3300009177 Unclassified 1937
227 Ga0105248_11314942 3300009177 Bacteria 818
228 Ga0105248_11605788 3300009177 Bacteria 737
229 Ga0105237_10002986 3300009545 Bacteria 20444
230 Ga0105237_11146714 3300009545 Bacteria 784
231 Ga0105237_11356340 3300009545 Bacteria 717
232 Ga0105249_10002214 3300009553 Bacteria 16849
233 Ga0105249_10004609 3300009553 Bacteria 11903
234 Ga0105249_10004989 3300009553 Bacteria 11452
235 Ga0105249_10115888 3300009553 Bacteria 2539
236 Ga0105249_10175390 3300009553 Bacteria 2082
237 Ga0105249_10189091 3300009553 Bacteria 2008
238 Ga0105249_10228291 3300009553 Bacteria 1835
239 Ga0105249_10501110 3300009553 Bacteria 1259
240 Ga0105249_10672874 3300009553 Bacteria 1094
241 Ga0105249_10748743 3300009553 Unclassified 1039
242 Ga0105249_10976982 3300009553 Bacteria 915
243 Ga0105239_10507864 3300010375 Bacteria 1371
244 Ga0105246_10030651 3300011119 Bacteria 3554
245 Ga0105246_10705068 3300011119 Bacteria 885
246 Ga0157371_10013093 3300013102 Bacteria 6315
247 Ga0157371_10133716 3300013102 Bacteria 1765
248 Ga0157371_11228560 3300013102 Bacteria 578
249 Ga0157370_10907739 3300013104 Bacteria 799
250 Ga0157369_11577012 3300013105 Bacteria 668
251 Ga0157374_10013695 3300013296 Bacteria 7085
252 Ga0157374_10135011 3300013296 Bacteria 2391
253 Ga0157374_10135399 3300013296 Bacteria 2388
254 Ga0157378_10028401 3300013297 Bacteria 4936
255 Ga0157378_10125389 3300013297 Bacteria 2371
256 Ga0157378_11280963 3300013297 Bacteria 774
257 Ga0163162_10008971 3300013306 Bacteria 9724
258 Ga0163162_10026684 3300013306 Bacteria 5710
259 Ga0163162_10040726 3300013306 Bacteria 4647
260 Ga0163162_10494447 3300013306 Bacteria 1354
261 Ga0157372_10049281 3300013307 Bacteria 4683
262 Ga0157372_10052300 3300013307 Bacteria 4547
263 Ga0157372_10324467 3300013307 Unclassified 1793
264 Ga0157372_10436339 3300013307 Bacteria 1527
265 Ga0157372_10604826 3300013307 Bacteria 1278
266 Ga0157375_10017430 3300013308 Bacteria 6481
267 Ga0157375_10020065 3300013308 Bacteria 6098
268 Ga0157375_10217601 3300013308 Bacteria 2068
269 Ga0157375_10230377 3300013308 Bacteria 2011
270 Ga0157375_10336503 3300013308 Bacteria 1675
271 Ga0157375_11791665 3300013308 Bacteria 728
272 Ga0163163_10013411 3300014325 Bacteria 7504
273 Ga0163163_10742996 3300014325 Bacteria 1044
274 Ga0163163_10863819 3300014325 Bacteria 968
275 Ga0163163_11422338 3300014325 Bacteria 755
276 Ga0157380_10006849 3300014326 Bacteria 8054
277 Ga0157380_10047715 3300014326 Bacteria 3370
278 Ga0157380_10394090 3300014326 Bacteria 1311
279 Ga0157380_10532229 3300014326 Bacteria 1149
280 Ga0157380_10633672 3300014326 Bacteria 1063
281 Ga0157380_11476426 3300014326 Bacteria 732
282 Ga0157380_11553935 3300014326 Unclassified 716
283 Ga0157380_11564468 3300014326 Bacteria 714
284 Ga0157380_11801925 3300014326 Bacteria 671
285 Ga0157380_11841469 3300014326 Bacteria 665
286 Ga0157377_10000417 3300014745 Bacteria 18428
287 Ga0157377_10005859 3300014745 Bacteria 5812
288 Ga0157377_10089561 3300014745 Bacteria 1814
289 Ga0157377_10238574 3300014745 Bacteria 1172
290 Ga0157377_10314801 3300014745 Unclassified 1038
291 Ga0157379_10013647 3300014968 Bacteria 7120
292 Ga0157379_10188717 3300014968 Bacteria 1863
293 Ga0157376_10124467 3300014969 Bacteria 2290
294 Ga0157376_10926707 3300014969 Bacteria 890
295 Ga0163161_10032192 3300017792 Bacteria 3743
296 Ga0163161_10782601 3300017792 Bacteria 800
297 Ga0163161_11521957 3300017792 Bacteria 588
298 Ga0207666_1021785 3300025271 Bacteria 947
299 Ga0207697_10039214 3300025315 Bacteria 1943
300 Ga0207697_10141557 3300025315 Unclassified 1043
301 Ga0207656_10007116 3300025321 Bacteria 4065
302 Ga0207656_10170344 3300025321 Bacteria 1041
303 Ga0207713_1085405 3300025735 Bacteria 1124
304 Ga0207713_1167837 3300025735 Bacteria 694
305 Ga0207682_10006610 3300025893 Bacteria 4664
306 Ga0207682_10057252 3300025893 Bacteria 1625
307 Ga0207642_10336257 3300025899 Bacteria 886
308 Ga0207642_10507549 3300025899 Bacteria 739
309 Ga0207710_10137711 3300025900 Bacteria 1177
310 Ga0207688_10046604 3300025901 Bacteria 2421
311 Ga0207680_10034057 3300025903 Bacteria 2911
312 Ga0207680_10041039 3300025903 Bacteria 2697
313 Ga0207645_10003340 3300025907 Bacteria 12232
314 Ga0207645_10003952 3300025907 Bacteria 11063
315 Ga0207645_10045411 3300025907 Bacteria 2808
316 Ga0207645_10113368 3300025907 Bacteria 1756
317 Ga0207645_10180050 3300025907 Unclassified 1387
318 Ga0207643_10009563 3300025908 Bacteria 5208
319 Ga0207643_10125381 3300025908 Bacteria 1524
320 Ga0207643_10607248 3300025908 Bacteria 704
321 Ga0207671_10001751 3300025914 Bacteria 24414
322 Ga0207662_10130670 3300025918 Bacteria 1583
323 Ga0207662_10184122 3300025918 Unclassified 1345
324 Ga0207681_10032255 3300025923 Bacteria 3428
325 Ga0207681_10037893 3300025923 Bacteria 3190
326 Ga0207681_10176108 3300025923 Bacteria 1625
327 Ga0207681_10404371 3300025923 Bacteria 1103
328 Ga0207681_10423297 3300025923 Bacteria 1079
329 Ga0207681_10938128 3300025923 Bacteria 725
330 Ga0207650_10059889 3300025925 Bacteria 2840
331 Ga0207650_10177823 3300025925 Bacteria 1694
332 Ga0207650_10270694 3300025925 Unclassified 1380
333 Ga0207650_10313892 3300025925 Bacteria 1283
334 Ga0207650_10392058 3300025925 Bacteria 1148
335 Ga0207650_10413557 3300025925 Bacteria 1118
336 Ga0207659_10012142 3300025926 Bacteria 5465
337 Ga0207659_10075844 3300025926 Bacteria 2469
338 Ga0207659_10110600 3300025926 Bacteria 2088
339 Ga0207659_10176470 3300025926 Bacteria 1689
340 Ga0207659_10498417 3300025926 Bacteria 1031
341 Ga0207644_10417589 3300025931 Bacteria 1099
342 Ga0207706_11083693 3300025933 Bacteria 670
343 Ga0207686_10000722 3300025934 Bacteria 20514
344 Ga0207686_10080936 3300025934 Unclassified 2118
345 Ga0207686_10277776 3300025934 Bacteria 1235
346 Ga0207670_10008086 3300025936 Bacteria 5916
347 Ga0207670_10016892 3300025936 Bacteria 4399
348 Ga0207670_10109596 3300025936 Bacteria 1987
349 Ga0207670_10200327 3300025936 Bacteria 1516
350 Ga0207670_10349645 3300025936 Unclassified 1170
351 Ga0207704_10044261 3300025938 Bacteria 2636
352 Ga0207704_10156205 3300025938 Bacteria 1617
353 Ga0207704_10507604 3300025938 Unclassified 973
354 Ga0207665_10599053 3300025939 Bacteria 860
355 Ga0207691_10021502 3300025940 Bacteria 6091
356 Ga0207691_10039336 3300025940 Bacteria 4375
357 Ga0207691_10040446 3300025940 Bacteria 4306
358 Ga0207691_10102874 3300025940 Bacteria 2547
359 Ga0207691_10196204 3300025940 Bacteria 1759
360 Ga0207691_10278337 3300025940 Bacteria 1440
361 Ga0207691_10876468 3300025940 Bacteria 752
362 Ga0207711_10170561 3300025941 Bacteria 1974
363 Ga0207689_10011440 3300025942 Bacteria 7605
364 Ga0207689_10014019 3300025942 Bacteria 6823
365 Ga0207689_10020156 3300025942 Bacteria 5617
366 Ga0207689_10021437 3300025942 Bacteria 5431
367 Ga0207689_10024277 3300025942 Bacteria 5087
368 Ga0207689_10058574 3300025942 Bacteria 3168
369 Ga0207689_11229467 3300025942 Unclassified 630
370 Ga0207661_10124296 3300025944 Bacteria 2201
371 Ga0207661_10476134 3300025944 Bacteria 1139
372 Ga0207679_10382728 3300025945 Bacteria 1234
373 Ga0207679_10464318 3300025945 Archaea 1125
374 Ga0207679_10945361 3300025945 Bacteria 789
375 Ga0207651_10006951 3300025960 Bacteria 5986
376 Ga0207651_10251465 3300025960 Bacteria 1446
377 Ga0207651_10257945 3300025960 Bacteria 1430
378 Ga0207651_10310158 3300025960 Bacteria 1315
379 Ga0207651_10338956 3300025960 Bacteria 1262
380 Ga0207651_10411228 3300025960 Bacteria 1153
381 Ga0207712_10000776 3300025961 Bacteria 23799
382 Ga0207712_10008510 3300025961 Bacteria 6485
383 Ga0207712_10021376 3300025961 Bacteria 4249
384 Ga0207712_10089220 3300025961 Bacteria 2266
385 Ga0207712_10099531 3300025961 Bacteria 2159
386 Ga0207712_10163547 3300025961 Bacteria 1732
387 Ga0207712_10905645 3300025961 Bacteria 780
388 Ga0207712_11193576 3300025961 Unclassified 679
389 Ga0207668_10173520 3300025972 Bacteria 1693
390 Ga0207668_10190013 3300025972 Bacteria 1627
391 Ga0207668_11332115 3300025972 Unclassified 647
392 Ga0207640_10009494 3300025981 Bacteria 5449
393 Ga0207640_10531280 3300025981 Bacteria 985
394 Ga0207640_10831202 3300025981 Unclassified 802
395 Ga0207658_10027460 3300025986 Bacteria 4000
396 Ga0207658_10032899 3300025986 Bacteria 3695
397 Ga0207658_10302544 3300025986 Bacteria 1378
398 Ga0207658_10509744 3300025986 Bacteria 1073
399 Ga0207677_10013428 3300026023 Bacteria 4747
400 Ga0207677_10159328 3300026023 Bacteria 1751
401 Ga0207677_10256970 3300026023 Unclassified 1422
402 Ga0207677_10852677 3300026023 Bacteria 819
403 Ga0207703_10143535 3300026035 Bacteria 2074
404 Ga0207703_10382334 3300026035 Unclassified 1302
405 Ga0207639_10125932 3300026041 Bacteria 2113
406 Ga0207639_10287859 3300026041 Unclassified 1447
407 Ga0207639_10436379 3300026041 Unclassified 1187
408 Ga0207639_10737969 3300026041 Bacteria 915
409 Ga0207708_10265251 3300026075 Bacteria 1387
410 Ga0207708_11228791 3300026075 Bacteria 655
411 Ga0207641_10000783 3300026088 Bacteria 33947
412 Ga0207641_10035434 3300026088 Bacteria 4158
413 Ga0207641_10128616 3300026088 Bacteria 2271
414 Ga0207641_12110460 3300026088 Bacteria 564
415 Ga0207648_10001120 3300026089 Bacteria 30104
416 Ga0207648_10007711 3300026089 Bacteria 10527
417 Ga0207648_10030947 3300026089 Bacteria 4734
418 Ga0207648_10035005 3300026089 Bacteria 4427
419 Ga0207648_10356924 3300026089 Bacteria 1318
420 Ga0207648_10589373 3300026089 Bacteria 1024
421 Ga0207648_10631296 3300026089 Unclassified 989
422 Ga0207676_10015323 3300026095 Bacteria 5528
423 Ga0207676_10087015 3300026095 Bacteria 2554
424 Ga0207676_10111161 3300026095 Unclassified 2293
425 Ga0207676_10898382 3300026095 Unclassified 869
426 Ga0207674_10011127 3300026116 Bacteria 10118
427 Ga0207674_10167713 3300026116 Bacteria 2149
428 Ga0207674_10207475 3300026116 Unclassified 1909
429 Ga0207674_10275746 3300026116 Bacteria 1629
430 Ga0207674_10284341 3300026116 Bacteria 1602
431 Ga0207674_10789794 3300026116 Bacteria 916
432 Ga0207675_100003924 3300026118 Bacteria 14439
433 Ga0207675_100010149 3300026118 Bacteria 8827
434 Ga0207675_100088702 3300026118 Bacteria 2906
435 Ga0207675_100164020 3300026118 Bacteria 2121
436 Ga0207675_100330241 3300026118 Bacteria 1491
437 Ga0207675_100441012 3300026118 Bacteria 1289
438 Ga0207675_100479667 3300026118 Bacteria 1236
439 Ga0207683_10020177 3300026121 Bacteria 5697
440 Ga0207683_10060813 3300026121 Bacteria 3321
441 Ga0207698_10040580 3300026142 Bacteria 3460
442 Ga0207698_10767814 3300026142 Unclassified 964
443 Ga0207428_10016019 3300027907 Bacteria 6461
444 Ga0207428_10769113 3300027907 Bacteria 686
445 Ga0268266_10043665 3300028379 Bacteria 3832
446 Ga0268266_10924967 3300028379 Unclassified 843
447 Ga0268265_10010677 3300028380 Bacteria 6202
448 Ga0268265_10103200 3300028380 Bacteria 2309
449 Ga0268265_10117654 3300028380 Unclassified 2183
450 Ga0268265_10320306 3300028380 Bacteria 1404
451 Ga0268265_10334421 3300028380 Bacteria 1377
452 Ga0268265_10398696 3300028380 Bacteria 1271
453 Ga0268264_10010462 3300028381 Bacteria 7670
454 Ga0268264_10157632 3300028381 Unclassified 2041
455 Ga0316177_1112842 3300030731 Bacteria 758
456 Ga0307406_10308520 3300031901 Unclassified 1219
457 Ga0307407_10290197 3300031903 Bacteria 1137
458 Ga0307407_11600365 3300031903 Bacteria 517
459 Ga0307412_10544248 3300031911 Bacteria 974
460 Ga0307414_11862694 3300032004 Bacteria 561
461 Ga0307411_10036675 3300032005 Bacteria 3075
462 Ga0307411_10776280 3300032005 Unclassified 842
463 Ga0307411_11889139 3300032005 Bacteria 556
464 Ga0373952_0053709 3300035092 Bacteria 967
465 Ga0395899_0162494 3300037312 Bacteria 1577
466 Ga0395900_0061706 3300037418 Bacteria 3854
467 Ga0395898_0753634 3300037466 Bacteria 915
468 Ga0395905_0000424 3300037471 Bacteria 58940
469 Ga0395905_0046490 3300037471 Bacteria 4070
470 Ga0395901_0443612 3300038443 Bacteria 1328
471 Ga0439436_0062920 3300041404 Unclassified 1037
472 Ga0439439_0047255 3300041406 Unclassified 1125
473 Ga0439461_0015853 3300041410 Bacteria 1448
474 Ga0439465_0015661 3300041413 Bacteria 2365
475 Ga0439465_0169551 3300041413 Unclassified 786
476 Ga0451789_1159392 3300041443 Unclassified 544
477 Ga0451791_1183411 3300041451 Unclassified 623
478 Ga0451791_1216885 3300041451 Bacteria 1036
479 Ga0451800_1177867 3300041459 Bacteria 1017
480 Ga0439431_0083991 3300041997 Bacteria 861
481 Ga0439433_0140196 3300041999 Unclassified 618
482 Ga0439441_003147 3300042001 Bacteria 2400
483 Ga0439442_011768 3300042002 Bacteria 1784
484 Ga0439445_0026632 3300042004 Unclassified 1481
485 Ga0439445_0112974 3300042004 Unclassified 776
486 Ga0439449_0001461 3300042007 Bacteria 9256
487 Ga0439454_055359 3300042011 Bacteria 678
488 Ga0450898_005533 3300042134 Bacteria 1912
489 Ga0450899_008881 3300042135 Bacteria 1104
490 Ga0439434_0019373 3300042435 Unclassified 2041
491 Ga0439435_0271473 3300042436 Bacteria 575
492 Ga0439444_0033635 3300042437 Bacteria 975
493 Ga0495585_0338330 3300046492 Bacteria 733
494 Ga0495643_0063329 3300046522 Bacteria 1956
495 Ga0495621_0001378 3300046539 Bacteria 6296
496 Ga0495668_0000106 3300046616 Bacteria 133476
497 Ga0495625_0060697 3300046660 Bacteria 2678
498 Ga0495672_0007070 3300047320 Bacteria 8515
499 Ga0495672_0010538 3300047320 Bacteria 6577
500 Ga0496110_0223340 3300048913 Unclassified 1713
501 Ga0496113_1260966 3300048916 Bacteria 576
502 Ga0501305_052219 3300049161 Unclassified 688
503 Ga0501305_059199 3300049161 Unclassified 656
504 Ga0501290_017577 3300049513 Bacteria 959
505 Ga0501312_011907 3300049528 Unclassified 1189
506 Ga0501315_004199 3300049531 Bacteria 1491
507 Ga0501315_015699 3300049531 Unclassified 973
508 Ga0501316_025438 3300049532 Unclassified 769
509 Ga0501317_025489 3300049533 Unclassified 829
510 Ga0501321_021937 3300049537 Unclassified 800
511 Ga0501322_009925 3300049538 Unclassified 727
512 Ga0501325_032545 3300049541 Unclassified 604
513 Ga0501327_15172 3300049543 Bacteria 543
514 Ga0501335_026410 3300049551 Unclassified 640
515 Ga0501031_0034538 3300049568 Bacteria 3300
516 Ga0501032_0010226 3300049569 Bacteria 6771
517 Ga0501034_0007266 3300049571 Bacteria 11817
518 Ga0501036_0011069 3300049572 Bacteria 7459
519 Ga0501036_0034183 3300049572 Bacteria 4300
520 Ga0501037_0048313 3300049573 Bacteria 3119
521 Ga0501037_0431021 3300049573 Bacteria 901
522 Ga0501039_0001372 3300049575 Bacteria 17881
523 Ga0501042_0065928 3300049578 Bacteria 2588
524 Ga0501043_0009418 3300049579 Bacteria 7667
525 Ga0501046_0033128 3300049580 Bacteria 4178
526 Ga0501046_0356833 3300049580 Bacteria 1060
527 Ga0501047_0044953 3300049581 Bacteria 4268
528 Ga0501048_0145326 3300049582 Bacteria 1677
529 Ga0501067_0060114 3300049583 Bacteria 2103
530 Ga0501068_0346208 3300049584 Bacteria 955
531 Ga0501068_0760274 3300049584 Bacteria 635
532 Ga0501073_0004832 3300049589 Bacteria 10112
533 Ga0501074_0001779 3300049590 Bacteria 14729
534 Ga0501075_1222825 3300049591 Bacteria 570
535 Ga0501249_110678 3300049679 Bacteria 664
536 Ga0501257_242908 3300049686 Bacteria 531
537 Ga0501245_001491 3300049708 Bacteria 3040
538 Ga0501079_0239029 3300049741 Bacteria 1419
539 Ga0501080_0097369 3300049742 Bacteria 2731
540 Ga0501083_0005688 3300049744 Bacteria 8822
541 Ga0501035_0012125 3300049822 Bacteria 7970
542 Ga0501035_0013079 3300049822 Bacteria 7659
543 Ga0501044_0003510 3300049823 Bacteria 17649
544 Ga0501044_0013204 3300049823 Bacteria 8945
545 Ga0501045_0136884 3300049824 Bacteria 1821
546 nmdc:mga0k408_148375_c1 3300050493 Bacteria 1396
547 nmdc:mga0k408_703386_c1 3300050493 Bacteria 592
548 nmdc:mga07m45_98179_c1 3300050496 Bacteria 966
549 nmdc:mga05p37_353212_c1 3300050507 Bacteria 1730
550 nmdc:mga0qj67_134675_c1 3300050509 Bacteria 2002
551 nmdc:mga06r32_15655_c1 3300050510 Bacteria 6889
552 nmdc:mga08y16_17537_c1 3300050511 Bacteria 7540
553 nmdc:mga08y16_39528_c1 3300050511 Bacteria 4949
554 nmdc:mga08y16_499530_c1 3300050511 Bacteria 1236
555 nmdc:mga0n895_280971_c1 3300050512 Unclassified 1688
556 nmdc:mga08x19_681498_c1 3300050514 Bacteria 729
557 Ga0500628_061838 3300053129 Bacteria 917
558 Ga0500568_0000325 3300053139 Bacteria 37538
559 Ga0500616_0047079 3300053153 Bacteria 2291
560 Ga0500622_0000480 3300053156 Bacteria 37450
561 Ga0500611_000029 3300053727 Bacteria 89288
562 Ga0501084_0586477 3300054114 Bacteria 942

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041999 Ga0439433_0140196 Ga0439433_0140196_26_448 139
2 3300042001 Ga0439441_003147 Ga0439441_003147_963_1388 141
3 3300042437 Ga0439444_0033635 Ga0439444_0033635_343_768 141
4 3300005293 Ga0065715_10272145 Ga0065715_102721452 147
5 3300005354 Ga0070675_100023572 Ga0070675_1000235723 147
6 3300005364 Ga0070673_100398153 Ga0070673_1003981532 147
7 3300005466 Ga0070685_10003294 Ga0070685_100032943 147
8 3300014326 Ga0157380_10394090 Ga0157380_103940902 147
9 3300025926 Ga0207659_10110600 Ga0207659_101106003 147
10 3300025942 Ga0207689_11229467 Ga0207689_112294672 147
11 3300002077 JGI24744J21845_10005535 JGI24744J21845_100055352 148
12 3300005293 Ga0065715_10105240 Ga0065715_101052404 148
13 3300005334 Ga0068869_100080736 Ga0068869_1000807361 148
14 3300005338 Ga0068868_100906180 Ga0068868_1009061802 148
15 3300005340 Ga0070689_100124028 Ga0070689_1001240281 148
16 3300005340 Ga0070689_100667508 Ga0070689_1006675081 148
17 3300005345 Ga0070692_10237881 Ga0070692_102378812 148
18 3300005353 Ga0070669_100027944 Ga0070669_1000279442 148
19 3300005353 Ga0070669_100485856 Ga0070669_1004858562 148
20 3300005353 Ga0070669_100861139 Ga0070669_1008611391 148
21 3300005354 Ga0070675_100060506 Ga0070675_1000605062 148
22 3300005355 Ga0070671_101078297 Ga0070671_1010782971 148
23 3300005356 Ga0070674_100838148 Ga0070674_1008381482 148
24 3300005356 Ga0070674_101543854 Ga0070674_1015438541 148
25 3300005364 Ga0070673_100103092 Ga0070673_1001030922 148
26 3300005364 Ga0070673_100117523 Ga0070673_1001175232 148
27 3300005364 Ga0070673_100674480 Ga0070673_1006744802 148
28 3300005365 Ga0070688_100142393 Ga0070688_1001423932 148
29 3300005365 Ga0070688_100178403 Ga0070688_1001784031 148
30 3300005365 Ga0070688_100539065 Ga0070688_1005390652 148
31 3300005366 Ga0070659_100565597 Ga0070659_1005655971 148
32 3300005367 Ga0070667_100544245 Ga0070667_1005442452 148
33 3300005438 Ga0070701_10112236 Ga0070701_101122362 148
34 3300005441 Ga0070700_100396044 Ga0070700_1003960442 148
35 3300005441 Ga0070700_100511568 Ga0070700_1005115682 148
36 3300005459 Ga0068867_101245668 Ga0068867_1012456681 148
37 3300005466 Ga0070685_10051327 Ga0070685_100513274 148
38 3300005466 Ga0070685_10210268 Ga0070685_102102681 148
39 3300005466 Ga0070685_10645325 Ga0070685_106453251 148
40 3300005471 Ga0070698_100063699 Ga0070698_1000636993 148
41 3300005471 Ga0070698_101697246 Ga0070698_1016972461 148
42 3300005539 Ga0068853_100051862 Ga0068853_1000518623 148
43 3300005543 Ga0070672_100141359 Ga0070672_1001413592 148
44 3300005543 Ga0070672_100172398 Ga0070672_1001723982 148
45 3300005543 Ga0070672_100308648 Ga0070672_1003086482 148
46 3300005543 Ga0070672_100496967 Ga0070672_1004969672 148
47 3300005544 Ga0070686_100047270 Ga0070686_1000472702 148
48 3300005544 Ga0070686_100055575 Ga0070686_1000555752 148
49 3300005549 Ga0070704_100195564 Ga0070704_1001955642 148
50 3300005615 Ga0070702_100312496 Ga0070702_1003124962 148
51 3300005616 Ga0068852_100034369 Ga0068852_1000343692 148
52 3300005617 Ga0068859_100179724 Ga0068859_1001797242 148
53 3300005617 Ga0068859_100442204 Ga0068859_1004422042 148
54 3300005618 Ga0068864_100084966 Ga0068864_1000849662 148
55 3300005618 Ga0068864_101747944 Ga0068864_1017479441 148
56 3300005719 Ga0068861_100042253 Ga0068861_1000422534 148
57 3300005834 Ga0068851_10005025 Ga0068851_100050252 148
58 3300005834 Ga0068851_10176367 Ga0068851_101763672 148
59 3300005840 Ga0068870_10174131 Ga0068870_101741312 148
60 3300005840 Ga0068870_10319843 Ga0068870_103198432 148
61 3300005841 Ga0068863_100075494 Ga0068863_1000754943 148
62 3300005841 Ga0068863_100529403 Ga0068863_1005294032 148
63 3300005842 Ga0068858_100444115 Ga0068858_1004441152 148
64 3300005843 Ga0068860_100130883 Ga0068860_1001308833 148
65 3300005844 Ga0068862_100039350 Ga0068862_1000393503 148
66 3300005844 Ga0068862_100278401 Ga0068862_1002784012 148
67 3300006163 Ga0070715_10367218 Ga0070715_103672182 148
68 3300006237 Ga0097621_100187367 Ga0097621_1001873672 148
69 3300006237 Ga0097621_100592309 Ga0097621_1005923092 148
70 3300006358 Ga0068871_100046293 Ga0068871_1000462932 148
71 3300006844 Ga0075428_100064504 Ga0075428_1000645042 148
72 3300006844 Ga0075428_100373899 Ga0075428_1003738992 148
73 3300006881 Ga0068865_100243673 Ga0068865_1002436731 148
74 3300006881 Ga0068865_100608205 Ga0068865_1006082052 148
75 3300006931 Ga0097620_100179724 Ga0097620_1001797242 148
76 3300006931 Ga0097620_100442224 Ga0097620_1004422242 148
77 3300009011 Ga0105251_10192332 Ga0105251_101923322 148
78 3300009094 Ga0111539_10074003 Ga0111539_100740033 148
79 3300009094 Ga0111539_10657996 Ga0111539_106579963 148
80 3300009094 Ga0111539_10747439 Ga0111539_107474391 148
81 3300009101 Ga0105247_10138653 Ga0105247_101386532 148
82 3300009147 Ga0114129_10016983 Ga0114129_100169834 148
83 3300009176 Ga0105242_10082116 Ga0105242_100821161 148
84 3300009176 Ga0105242_11904435 Ga0105242_119044351 148
85 3300009177 Ga0105248_10264267 Ga0105248_102642672 148
86 3300009553 Ga0105249_10004609 Ga0105249_100046093 148
87 3300009553 Ga0105249_10115888 Ga0105249_101158882 148
88 3300009553 Ga0105249_10672874 Ga0105249_106728741 148
89 3300013104 Ga0157370_10907739 Ga0157370_109077391 148
90 3300013105 Ga0157369_11577012 Ga0157369_115770121 148
91 3300013306 Ga0163162_10040726 Ga0163162_100407264 148
92 3300013306 Ga0163162_10494447 Ga0163162_104944472 148
93 3300013307 Ga0157372_10052300 Ga0157372_100523005 148
94 3300013308 Ga0157375_10336503 Ga0157375_103365032 148
95 3300013308 Ga0157375_11791665 Ga0157375_117916651 148
96 3300014325 Ga0163163_10742996 Ga0163163_107429962 148
97 3300014325 Ga0163163_10863819 Ga0163163_108638192 148
98 3300014326 Ga0157380_10633672 Ga0157380_106336721 148
99 3300014326 Ga0157380_11476426 Ga0157380_114764262 148
100 3300014326 Ga0157380_11553935 Ga0157380_115539352 148
101 3300014326 Ga0157380_11564468 Ga0157380_115644682 148
102 3300014326 Ga0157380_11801925 Ga0157380_118019251 148
103 3300014326 Ga0157380_11841469 Ga0157380_118414691 148
104 3300014745 Ga0157377_10005859 Ga0157377_100058592 148
105 3300014969 Ga0157376_10124467 Ga0157376_101244672 148
106 3300017792 Ga0163161_11521957 Ga0163161_115219571 148
107 3300025315 Ga0207697_10141557 Ga0207697_101415572 148
108 3300025321 Ga0207656_10007116 Ga0207656_100071164 148
109 3300025893 Ga0207682_10006610 Ga0207682_100066101 148
110 3300025899 Ga0207642_10507549 Ga0207642_105075492 148
111 3300025908 Ga0207643_10125381 Ga0207643_101253812 148
112 3300025908 Ga0207643_10607248 Ga0207643_106072481 148
113 3300025918 Ga0207662_10130670 Ga0207662_101306703 148
114 3300025918 Ga0207662_10184122 Ga0207662_101841222 148
115 3300025923 Ga0207681_10037893 Ga0207681_100378932 148
116 3300025923 Ga0207681_10176108 Ga0207681_101761082 148
117 3300025925 Ga0207650_10059889 Ga0207650_100598893 148
118 3300025925 Ga0207650_10270694 Ga0207650_102706942 148
119 3300025925 Ga0207650_10413557 Ga0207650_104135572 148
120 3300025926 Ga0207659_10012142 Ga0207659_100121423 148
121 3300025931 Ga0207644_10417589 Ga0207644_104175892 148
122 3300025934 Ga0207686_10000722 Ga0207686_100007223 148
123 3300025936 Ga0207670_10008086 Ga0207670_100080862 148
124 3300025936 Ga0207670_10016892 Ga0207670_100168923 148
125 3300025936 Ga0207670_10349645 Ga0207670_103496452 148
126 3300025938 Ga0207704_10044261 Ga0207704_100442613 148
127 3300025940 Ga0207691_10021502 Ga0207691_100215022 148
128 3300025940 Ga0207691_10102874 Ga0207691_101028741 148
129 3300025940 Ga0207691_10278337 Ga0207691_102783372 148
130 3300025941 Ga0207711_10170561 Ga0207711_101705612 148
131 3300025942 Ga0207689_10058574 Ga0207689_100585743 148
132 3300025960 Ga0207651_10006951 Ga0207651_100069514 148
133 3300025960 Ga0207651_10251465 Ga0207651_102514651 148
134 3300025960 Ga0207651_10310158 Ga0207651_103101582 148
135 3300025961 Ga0207712_10008510 Ga0207712_100085103 148
136 3300025961 Ga0207712_10021376 Ga0207712_100213764 148
137 3300025972 Ga0207668_10190013 Ga0207668_101900132 148
138 3300025986 Ga0207658_10509744 Ga0207658_105097442 148
139 3300026023 Ga0207677_10256970 Ga0207677_102569702 148
140 3300026035 Ga0207703_10382334 Ga0207703_103823342 148
141 3300026041 Ga0207639_10287859 Ga0207639_102878591 148
142 3300026041 Ga0207639_10436379 Ga0207639_104363792 148
143 3300026075 Ga0207708_10265251 Ga0207708_102652512 148
144 3300026075 Ga0207708_11228791 Ga0207708_112287912 148
145 3300026088 Ga0207641_10000783 Ga0207641_1000078325 148
146 3300026088 Ga0207641_10128616 Ga0207641_101286162 148
147 3300026095 Ga0207676_10898382 Ga0207676_108983822 148
148 3300026118 Ga0207675_100010149 Ga0207675_1000101497 148
149 3300026118 Ga0207675_100330241 Ga0207675_1003302412 148
150 3300026118 Ga0207675_100441012 Ga0207675_1004410122 148
151 3300026121 Ga0207683_10060813 Ga0207683_100608132 148
152 3300026142 Ga0207698_10040580 Ga0207698_100405802 148
153 3300027907 Ga0207428_10769113 Ga0207428_107691131 148
154 3300028380 Ga0268265_10117654 Ga0268265_101176542 148
155 3300028380 Ga0268265_10398696 Ga0268265_103986961 148
156 3300028381 Ga0268264_10157632 Ga0268264_101576322 148
157 3300031903 Ga0307407_11600365 Ga0307407_116003651 148
158 3300041451 Ga0451791_1216885 Ga0451791_1216885_16_471 148
159 3300041459 Ga0451800_1177867 Ga0451800_1177867_515_961 148
160 3300042007 Ga0439449_0001461 Ga0439449_0001461_8169_8618 148
161 3300046492 Ga0495585_0338330 Ga0495585_0338330_149_595 148
162 3300046539 Ga0495621_0001378 Ga0495621_0001378_2415_2861 148
163 3300046616 Ga0495668_0000106 Ga0495668_0000106_56566_57024 148
164 3300046660 Ga0495625_0060697 Ga0495625_0060697_1668_2120 148
165 3300049161 Ga0501305_059199 Ga0501305_059199_167_616 148
166 3300049528 Ga0501312_011907 Ga0501312_011907_147_596 148
167 3300049531 Ga0501315_015699 Ga0501315_015699_105_554 148
168 3300049532 Ga0501316_025438 Ga0501316_025438_37_486 148
169 3300049538 Ga0501322_009925 Ga0501322_009925_153_602 148
170 3300049551 Ga0501335_026410 Ga0501335_026410_159_608 148
171 3300050511 nmdc:mga08y16_39528_c1 nmdc:mga08y16_39528_c1_1904_2350 148
172 3300050511 nmdc:mga08y16_499530_c1 nmdc:mga08y16_499530_c1_674_1120 148
173 3300053129 Ga0500628_061838 Ga0500628_061838_303_773 148
174 3300053156 Ga0500622_0000480 Ga0500622_0000480_17387_17839 148
175 2162886011 MRS1b_contig_9194533 MRS1b_0449.00000830 149
176 3300003322 rootL2_10349925 rootL2_103499252 149
177 3300005328 Ga0070676_10002798 Ga0070676_100027984 149
178 3300005331 Ga0070670_100173254 Ga0070670_1001732542 149
179 3300005331 Ga0070670_100260621 Ga0070670_1002606212 149
180 3300005331 Ga0070670_100322215 Ga0070670_1003222152 149
181 3300005331 Ga0070670_100695378 Ga0070670_1006953782 149
182 3300005333 Ga0070677_10023349 Ga0070677_100233492 149
183 3300005334 Ga0068869_100006670 Ga0068869_1000066704 149
184 3300005334 Ga0068869_100057841 Ga0068869_1000578414 149
185 3300005334 Ga0068869_100120115 Ga0068869_1001201152 149
186 3300005334 Ga0068869_100349133 Ga0068869_1003491331 149
187 3300005335 Ga0070666_10117862 Ga0070666_101178622 149
188 3300005338 Ga0068868_100002313 Ga0068868_1000023138 149
189 3300005343 Ga0070687_100263734 Ga0070687_1002637342 149
190 3300005343 Ga0070687_100342396 Ga0070687_1003423961 149
191 3300005344 Ga0070661_100816859 Ga0070661_1008168591 149
192 3300005347 Ga0070668_100084137 Ga0070668_1000841372 149
193 3300005353 Ga0070669_100137520 Ga0070669_1001375201 149
194 3300005353 Ga0070669_100400808 Ga0070669_1004008082 149
195 3300005354 Ga0070675_100133933 Ga0070675_1001339332 149
196 3300005354 Ga0070675_100422499 Ga0070675_1004224992 149
197 3300005354 Ga0070675_101260247 Ga0070675_1012602472 149
198 3300005356 Ga0070674_100165290 Ga0070674_1001652902 149
199 3300005356 Ga0070674_101065979 Ga0070674_1010659791 149
200 3300005364 Ga0070673_100345696 Ga0070673_1003456962 149
201 3300005365 Ga0070688_100176351 Ga0070688_1001763512 149
202 3300005367 Ga0070667_100069846 Ga0070667_1000698462 149
203 3300005459 Ga0068867_100084108 Ga0068867_1000841082 149
204 3300005459 Ga0068867_100310207 Ga0068867_1003102072 149
205 3300005466 Ga0070685_10365115 Ga0070685_103651151 149
206 3300005535 Ga0070684_100003115 Ga0070684_1000031155 149
207 3300005535 Ga0070684_100404354 Ga0070684_1004043541 149
208 3300005539 Ga0068853_100014221 Ga0068853_1000142212 149
209 3300005543 Ga0070672_100205057 Ga0070672_1002050572 149
210 3300005543 Ga0070672_100293814 Ga0070672_1002938142 149
211 3300005548 Ga0070665_100038466 Ga0070665_1000384662 149
212 3300005564 Ga0070664_100238860 Ga0070664_1002388602 149
213 3300005577 Ga0068857_100144949 Ga0068857_1001449492 149
214 3300005577 Ga0068857_100409161 Ga0068857_1004091611 149
215 3300005578 Ga0068854_100012895 Ga0068854_1000128955 149
216 3300005578 Ga0068854_100735274 Ga0068854_1007352741 149
217 3300005578 Ga0068854_100857070 Ga0068854_1008570701 149
218 3300005614 Ga0068856_100778051 Ga0068856_1007780511 149
219 3300005616 Ga0068852_101260180 Ga0068852_1012601802 149
220 3300005617 Ga0068859_100021622 Ga0068859_1000216224 149
221 3300005617 Ga0068859_100092544 Ga0068859_1000925441 149
222 3300005617 Ga0068859_100215664 Ga0068859_1002156642 149
223 3300005617 Ga0068859_101645173 Ga0068859_1016451732 149
224 3300005618 Ga0068864_101005794 Ga0068864_1010057942 149
225 3300005718 Ga0068866_10029579 Ga0068866_100295792 149
226 3300005718 Ga0068866_10182261 Ga0068866_101822611 149
227 3300005718 Ga0068866_10298507 Ga0068866_102985072 149
228 3300005719 Ga0068861_100059967 Ga0068861_1000599672 149
229 3300005719 Ga0068861_100661429 Ga0068861_1006614292 149
230 3300005719 Ga0068861_100873601 Ga0068861_1008736012 149
231 3300005834 Ga0068851_10109301 Ga0068851_101093012 149
232 3300005840 Ga0068870_10052294 Ga0068870_100522942 149
233 3300005840 Ga0068870_10138097 Ga0068870_101380972 149
234 3300005841 Ga0068863_100386484 Ga0068863_1003864842 149
235 3300005841 Ga0068863_100712880 Ga0068863_1007128802 149
236 3300005842 Ga0068858_101717458 Ga0068858_1017174582 149
237 3300005843 Ga0068860_100021634 Ga0068860_1000216345 149
238 3300005843 Ga0068860_100094883 Ga0068860_1000948832 149
239 3300005844 Ga0068862_100301648 Ga0068862_1003016482 149
240 3300005844 Ga0068862_100796241 Ga0068862_1007962411 149
241 3300006195 Ga0075366_10174505 Ga0075366_101745052 149
242 3300006237 Ga0097621_100132172 Ga0097621_1001321721 149
243 3300006237 Ga0097621_100785940 Ga0097621_1007859402 149
244 3300006353 Ga0075370_10301306 Ga0075370_103013062 149
245 3300006358 Ga0068871_100061687 Ga0068871_1000616872 149
246 3300006358 Ga0068871_100993816 Ga0068871_1009938162 149
247 3300006846 Ga0075430_100040211 Ga0075430_1000402115 149
248 3300006847 Ga0075431_100007533 Ga0075431_1000075332 149
249 3300006871 Ga0075434_100280972 Ga0075434_1002809722 149
250 3300006880 Ga0075429_100602584 Ga0075429_1006025842 149
251 3300006881 Ga0068865_100097657 Ga0068865_1000976572 149
252 3300006931 Ga0097620_100021622 Ga0097620_1000216222 149
253 3300006931 Ga0097620_100092539 Ga0097620_1000925393 149
254 3300006931 Ga0097620_100215668 Ga0097620_1002156682 149
255 3300006931 Ga0097620_101644762 Ga0097620_1016447622 149
256 3300009011 Ga0105251_10082619 Ga0105251_100826192 149
257 3300009147 Ga0114129_10044941 Ga0114129_100449414 149
258 3300009148 Ga0105243_10315584 Ga0105243_103155842 149
259 3300009148 Ga0105243_11820607 Ga0105243_118206071 149
260 3300009174 Ga0105241_10912484 Ga0105241_109124841 149
261 3300009176 Ga0105242_10021120 Ga0105242_100211204 149
262 3300009176 Ga0105242_10045438 Ga0105242_100454382 149
263 3300009176 Ga0105242_10047631 Ga0105242_100476315 149
264 3300009177 Ga0105248_11314942 Ga0105248_113149422 149
265 3300009177 Ga0105248_11605788 Ga0105248_116057881 149
266 3300009545 Ga0105237_10002986 Ga0105237_100029868 149
267 3300009545 Ga0105237_11146714 Ga0105237_111467142 149
268 3300009553 Ga0105249_10002214 Ga0105249_100022149 149
269 3300009553 Ga0105249_10501110 Ga0105249_105011102 149
270 3300009553 Ga0105249_10748743 Ga0105249_107487432 149
271 3300009553 Ga0105249_10976982 Ga0105249_109769822 149
272 3300011119 Ga0105246_10030651 Ga0105246_100306513 149
273 3300011119 Ga0105246_10705068 Ga0105246_107050682 149
274 3300013102 Ga0157371_10133716 Ga0157371_101337162 149
275 3300013102 Ga0157371_11228560 Ga0157371_112285601 149
276 3300013296 Ga0157374_10013695 Ga0157374_100136955 149
277 3300013296 Ga0157374_10135011 Ga0157374_101350112 149
278 3300013296 Ga0157374_10135399 Ga0157374_101353993 149
279 3300013297 Ga0157378_10028401 Ga0157378_100284012 149
280 3300013297 Ga0157378_10125389 Ga0157378_101253892 149
281 3300013297 Ga0157378_11280963 Ga0157378_112809631 149
282 3300013306 Ga0163162_10008971 Ga0163162_100089717 149
283 3300013307 Ga0157372_10436339 Ga0157372_104363392 149
284 3300013307 Ga0157372_10604826 Ga0157372_106048262 149
285 3300013308 Ga0157375_10020065 Ga0157375_100200655 149
286 3300013308 Ga0157375_10217601 Ga0157375_102176012 149
287 3300014326 Ga0157380_10047715 Ga0157380_100477153 149
288 3300014745 Ga0157377_10089561 Ga0157377_100895612 149
289 3300014745 Ga0157377_10238574 Ga0157377_102385741 149
290 3300014745 Ga0157377_10314801 Ga0157377_103148012 149
291 3300014968 Ga0157379_10188717 Ga0157379_101887172 149
292 3300014969 Ga0157376_10926707 Ga0157376_109267072 149
293 3300017792 Ga0163161_10032192 Ga0163161_100321923 149
294 3300025321 Ga0207656_10170344 Ga0207656_101703441 149
295 3300025893 Ga0207682_10057252 Ga0207682_100572522 149
296 3300025899 Ga0207642_10336257 Ga0207642_103362572 149
297 3300025901 Ga0207688_10046604 Ga0207688_100466041 149
298 3300025903 Ga0207680_10041039 Ga0207680_100410391 149
299 3300025907 Ga0207645_10003340 Ga0207645_100033408 149
300 3300025907 Ga0207645_10003952 Ga0207645_100039525 149
301 3300025907 Ga0207645_10045411 Ga0207645_100454115 149
302 3300025907 Ga0207645_10180050 Ga0207645_101800502 149
303 3300025914 Ga0207671_10001751 Ga0207671_1000175111 149
304 3300025923 Ga0207681_10423297 Ga0207681_104232972 149
305 3300025923 Ga0207681_10938128 Ga0207681_109381282 149
306 3300025925 Ga0207650_10177823 Ga0207650_101778232 149
307 3300025925 Ga0207650_10313892 Ga0207650_103138922 149
308 3300025926 Ga0207659_10075844 Ga0207659_100758442 149
309 3300025926 Ga0207659_10498417 Ga0207659_104984172 149
310 3300025933 Ga0207706_11083693 Ga0207706_110836932 149
311 3300025934 Ga0207686_10080936 Ga0207686_100809362 149
312 3300025934 Ga0207686_10277776 Ga0207686_102777761 149
313 3300025938 Ga0207704_10156205 Ga0207704_101562052 149
314 3300025938 Ga0207704_10507604 Ga0207704_105076042 149
315 3300025939 Ga0207665_10599053 Ga0207665_105990531 149
316 3300025940 Ga0207691_10040446 Ga0207691_100404463 149
317 3300025940 Ga0207691_10196204 Ga0207691_101962042 149
318 3300025942 Ga0207689_10011440 Ga0207689_100114404 149
319 3300025942 Ga0207689_10014019 Ga0207689_100140194 149
320 3300025942 Ga0207689_10021437 Ga0207689_100214372 149
321 3300025942 Ga0207689_10024277 Ga0207689_100242772 149
322 3300025944 Ga0207661_10124296 Ga0207661_101242961 149
323 3300025945 Ga0207679_10382728 Ga0207679_103827281 149
324 3300025945 Ga0207679_10464318 Ga0207679_104643182 149
325 3300025945 Ga0207679_10945361 Ga0207679_109453612 149
326 3300025960 Ga0207651_10257945 Ga0207651_102579452 149
327 3300025960 Ga0207651_10338956 Ga0207651_103389561 149
328 3300025960 Ga0207651_10411228 Ga0207651_104112282 149
329 3300025961 Ga0207712_10089220 Ga0207712_100892202 149
330 3300025961 Ga0207712_11193576 Ga0207712_111935762 149
331 3300025972 Ga0207668_11332115 Ga0207668_113321151 149
332 3300025981 Ga0207640_10009494 Ga0207640_100094942 149
333 3300025981 Ga0207640_10531280 Ga0207640_105312801 149
334 3300025981 Ga0207640_10831202 Ga0207640_108312022 149
335 3300025986 Ga0207658_10027460 Ga0207658_100274602 149
336 3300026023 Ga0207677_10013428 Ga0207677_100134284 149
337 3300026023 Ga0207677_10159328 Ga0207677_101593282 149
338 3300026041 Ga0207639_10125932 Ga0207639_101259323 149
339 3300026041 Ga0207639_10737969 Ga0207639_107379692 149
340 3300026088 Ga0207641_12110460 Ga0207641_121104601 149
341 3300026089 Ga0207648_10001120 Ga0207648_100011204 149
342 3300026089 Ga0207648_10007711 Ga0207648_100077112 149
343 3300026089 Ga0207648_10030947 Ga0207648_100309474 149
344 3300026089 Ga0207648_10356924 Ga0207648_103569242 149
345 3300026089 Ga0207648_10631296 Ga0207648_106312962 149
346 3300026095 Ga0207676_10087015 Ga0207676_100870154 149
347 3300026116 Ga0207674_10167713 Ga0207674_101677132 149
348 3300026116 Ga0207674_10207475 Ga0207674_102074752 149
349 3300026116 Ga0207674_10284341 Ga0207674_102843412 149
350 3300026116 Ga0207674_10789794 Ga0207674_107897942 149
351 3300026118 Ga0207675_100164020 Ga0207675_1001640202 149
352 3300026118 Ga0207675_100479667 Ga0207675_1004796671 149
353 3300026121 Ga0207683_10020177 Ga0207683_100201774 149
354 3300026142 Ga0207698_10767814 Ga0207698_107678141 149
355 3300028379 Ga0268266_10924967 Ga0268266_109249671 149
356 3300028380 Ga0268265_10103200 Ga0268265_101032002 149
357 3300028380 Ga0268265_10320306 Ga0268265_103203062 149
358 3300028380 Ga0268265_10334421 Ga0268265_103344212 149
359 3300031901 Ga0307406_10308520 Ga0307406_103085202 149
360 3300031903 Ga0307407_10290197 Ga0307407_102901972 149
361 3300032004 Ga0307414_11862694 Ga0307414_118626941 149
362 3300032005 Ga0307411_10776280 Ga0307411_107762802 149
363 3300035092 Ga0373952_0053709 Ga0373952_0053709_462_911 149
364 3300037312 Ga0395899_0162494 Ga0395899_0162494_142_636 149
365 3300037418 Ga0395900_0061706 Ga0395900_0061706_1128_1580 149
366 3300037466 Ga0395898_0753634 Ga0395898_0753634_238_690 149
367 3300037471 Ga0395905_0000424 Ga0395905_0000424_48306_48758 149
368 3300037471 Ga0395905_0046490 Ga0395905_0046490_68_520 149
369 3300038443 Ga0395901_0443612 Ga0395901_0443612_620_1114 149
370 3300041443 Ga0451789_1159392 Ga0451789_1159392_55_507 149
371 3300041451 Ga0451791_1183411 Ga0451791_1183411_38_487 149
372 3300042004 Ga0439445_0112974 Ga0439445_0112974_125_577 149
373 3300047320 Ga0495672_0010538 Ga0495672_0010538_5961_6410 149
374 3300049513 Ga0501290_017577 Ga0501290_017577_240_692 149
375 3300049541 Ga0501325_032545 Ga0501325_032545_72_524 149
376 3300049568 Ga0501031_0034538 Ga0501031_0034538_2283_2744 149
377 3300049572 Ga0501036_0011069 Ga0501036_0011069_6818_7279 149
378 3300049573 Ga0501037_0431021 Ga0501037_0431021_131_592 149
379 3300049575 Ga0501039_0001372 Ga0501039_0001372_16313_16774 149
380 3300049580 Ga0501046_0033128 Ga0501046_0033128_3492_3953 149
381 3300049584 Ga0501068_0760274 Ga0501068_0760274_37_498 149
382 3300049686 Ga0501257_242908 Ga0501257_242908_24_476 149
383 3300049708 Ga0501245_001491 Ga0501245_001491_2420_2872 149
384 3300049822 Ga0501035_0013079 Ga0501035_0013079_510_971 149
385 3300049823 Ga0501044_0013204 Ga0501044_0013204_3560_4021 149
386 3300050493 nmdc:mga0k408_148375_c1 nmdc:mga0k408_148375_c1_672_1121 149
387 3300050496 nmdc:mga07m45_98179_c1 nmdc:mga07m45_98179_c1_446_895 149
388 3300050507 nmdc:mga05p37_353212_c1 nmdc:mga05p37_353212_c1_208_657 149
389 3300050509 nmdc:mga0qj67_134675_c1 nmdc:mga0qj67_134675_c1_1521_1970 149
390 3300050510 nmdc:mga06r32_15655_c1 nmdc:mga06r32_15655_c1_440_889 149
391 3300050512 nmdc:mga0n895_280971_c1 nmdc:mga0n895_280971_c1_326_775 149
392 3300050514 nmdc:mga08x19_681498_c1 nmdc:mga08x19_681498_c1_59_508 149
393 3300053139 Ga0500568_0000325 Ga0500568_0000325_8270_8719 149
394 3300053727 Ga0500611_000029 Ga0500611_000029_35924_36373 149
395 3300000545 CNXas_1001701 CNXas_10017012 150
396 3300005328 Ga0070676_10624832 Ga0070676_106248321 150
397 3300005335 Ga0070666_10245172 Ga0070666_102451722 150
398 3300005340 Ga0070689_100013924 Ga0070689_1000139245 150
399 3300005340 Ga0070689_100189998 Ga0070689_1001899982 150
400 3300005343 Ga0070687_100303300 Ga0070687_1003033001 150
401 3300005353 Ga0070669_100073476 Ga0070669_1000734762 150
402 3300005355 Ga0070671_100158811 Ga0070671_1001588112 150
403 3300005365 Ga0070688_100590900 Ga0070688_1005909001 150
404 3300005466 Ga0070685_10031299 Ga0070685_100312994 150
405 3300005466 Ga0070685_10158664 Ga0070685_101586642 150
406 3300005471 Ga0070698_100997594 Ga0070698_1009975942 150
407 3300005539 Ga0068853_100500323 Ga0068853_1005003231 150
408 3300005544 Ga0070686_100319185 Ga0070686_1003191852 150
409 3300005548 Ga0070665_100026771 Ga0070665_1000267715 150
410 3300005564 Ga0070664_100081185 Ga0070664_1000811853 150
411 3300005578 Ga0068854_100773130 Ga0068854_1007731302 150
412 3300005616 Ga0068852_100105798 Ga0068852_1001057982 150
413 3300005617 Ga0068859_100008920 Ga0068859_1000089204 150
414 3300005617 Ga0068859_100127521 Ga0068859_1001275213 150
415 3300005618 Ga0068864_100123191 Ga0068864_1001231912 150
416 3300005719 Ga0068861_100270121 Ga0068861_1002701212 150
417 3300005841 Ga0068863_100119799 Ga0068863_1001197992 150
418 3300005843 Ga0068860_100013054 Ga0068860_1000130542 150
419 3300006195 Ga0075366_10487889 Ga0075366_104878892 150
420 3300006237 Ga0097621_100028195 Ga0097621_1000281953 150
421 3300006358 Ga0068871_100141121 Ga0068871_1001411212 150
422 3300006931 Ga0097620_100008921 Ga0097620_1000089216 150
423 3300006931 Ga0097620_100127517 Ga0097620_1001275172 150
424 3300009011 Ga0105251_10075659 Ga0105251_100756591 150
425 3300009101 Ga0105247_10010935 Ga0105247_100109352 150
426 3300009101 Ga0105247_10111736 Ga0105247_101117362 150
427 3300009174 Ga0105241_10878340 Ga0105241_108783402 150
428 3300009545 Ga0105237_11356340 Ga0105237_113563401 150
429 3300009553 Ga0105249_10004989 Ga0105249_100049894 150
430 3300009553 Ga0105249_10189091 Ga0105249_101890912 150
431 3300009553 Ga0105249_10228291 Ga0105249_102282912 150
432 3300010375 Ga0105239_10507864 Ga0105239_105078642 150
433 3300013102 Ga0157371_10013093 Ga0157371_100130932 150
434 3300013306 Ga0163162_10026684 Ga0163162_100266844 150
435 3300013307 Ga0157372_10049281 Ga0157372_100492812 150
436 3300013307 Ga0157372_10324467 Ga0157372_103244672 150
437 3300013308 Ga0157375_10230377 Ga0157375_102303772 150
438 3300014325 Ga0163163_10013411 Ga0163163_100134114 150
439 3300014326 Ga0157380_10532229 Ga0157380_105322292 150
440 3300014968 Ga0157379_10013647 Ga0157379_100136475 150
441 3300017792 Ga0163161_10782601 Ga0163161_107826011 150
442 3300025735 Ga0207713_1085405 Ga0207713_10854052 150
443 3300025735 Ga0207713_1167837 Ga0207713_11678371 150
444 3300025900 Ga0207710_10137711 Ga0207710_101377112 150
445 3300025903 Ga0207680_10034057 Ga0207680_100340572 150
446 3300025923 Ga0207681_10404371 Ga0207681_104043711 150
447 3300025936 Ga0207670_10200327 Ga0207670_102003272 150
448 3300025940 Ga0207691_10876468 Ga0207691_108764682 150
449 3300025944 Ga0207661_10476134 Ga0207661_104761342 150
450 3300025961 Ga0207712_10000776 Ga0207712_100007766 150
451 3300025961 Ga0207712_10163547 Ga0207712_101635472 150
452 3300025961 Ga0207712_10905645 Ga0207712_109056452 150
453 3300025986 Ga0207658_10032899 Ga0207658_100328992 150
454 3300025986 Ga0207658_10302544 Ga0207658_103025441 150
455 3300026035 Ga0207703_10143535 Ga0207703_101435351 150
456 3300026088 Ga0207641_10035434 Ga0207641_100354344 150
457 3300026089 Ga0207648_10589373 Ga0207648_105893732 150
458 3300026095 Ga0207676_10015323 Ga0207676_100153232 150
459 3300026095 Ga0207676_10111161 Ga0207676_101111612 150
460 3300026116 Ga0207674_10275746 Ga0207674_102757462 150
461 3300026118 Ga0207675_100088702 Ga0207675_1000887023 150
462 3300028379 Ga0268266_10043665 Ga0268266_100436654 150
463 3300028381 Ga0268264_10010462 Ga0268264_100104626 150
464 3300030731 Ga0316177_1112842 Ga0316177_11128421 150
465 3300031911 Ga0307412_10544248 Ga0307412_105442482 150
466 3300032005 Ga0307411_10036675 Ga0307411_100366753 150
467 3300032005 Ga0307411_11889139 Ga0307411_118891391 150
468 3300041404 Ga0439436_0062920 Ga0439436_0062920_245_742 150
469 3300041406 Ga0439439_0047255 Ga0439439_0047255_397_894 150
470 3300041410 Ga0439461_0015853 Ga0439461_0015853_693_1190 150
471 3300041413 Ga0439465_0015661 Ga0439465_0015661_798_1295 150
472 3300041413 Ga0439465_0169551 Ga0439465_0169551_28_483 150
473 3300041997 Ga0439431_0083991 Ga0439431_0083991_281_778 150
474 3300042002 Ga0439442_011768 Ga0439442_011768_1133_1630 150
475 3300042004 Ga0439445_0026632 Ga0439445_0026632_604_1101 150
476 3300042011 Ga0439454_055359 Ga0439454_055359_63_515 150
477 3300042134 Ga0450898_005533 Ga0450898_005533_1243_1740 150
478 3300042135 Ga0450899_008881 Ga0450899_008881_619_1077 150
479 3300042435 Ga0439434_0019373 Ga0439434_0019373_192_689 150
480 3300042436 Ga0439435_0271473 Ga0439435_0271473_23_520 150
481 3300046522 Ga0495643_0063329 Ga0495643_0063329_219_671 150
482 3300047320 Ga0495672_0007070 Ga0495672_0007070_5917_6369 150
483 3300048913 Ga0496110_0223340 Ga0496110_0223340_1125_1580 150
484 3300048916 Ga0496113_1260966 Ga0496113_1260966_48_503 150
485 3300049161 Ga0501305_052219 Ga0501305_052219_128_580 150
486 3300049531 Ga0501315_004199 Ga0501315_004199_295_750 150
487 3300049533 Ga0501317_025489 Ga0501317_025489_251_706 150
488 3300049537 Ga0501321_021937 Ga0501321_021937_131_586 150
489 3300049543 Ga0501327_15172 Ga0501327_15172_78_533 150
490 3300049569 Ga0501032_0010226 Ga0501032_0010226_5653_6117 150
491 3300049571 Ga0501034_0007266 Ga0501034_0007266_3327_3791 150
492 3300049572 Ga0501036_0034183 Ga0501036_0034183_1342_1806 150
493 3300049573 Ga0501037_0048313 Ga0501037_0048313_47_511 150
494 3300049578 Ga0501042_0065928 Ga0501042_0065928_1455_1919 150
495 3300049579 Ga0501043_0009418 Ga0501043_0009418_4070_4534 150
496 3300049580 Ga0501046_0356833 Ga0501046_0356833_47_502 150
497 3300049581 Ga0501047_0044953 Ga0501047_0044953_2004_2468 150
498 3300049582 Ga0501048_0145326 Ga0501048_0145326_540_1004 150
499 3300049583 Ga0501067_0060114 Ga0501067_0060114_678_1142 150
500 3300049584 Ga0501068_0346208 Ga0501068_0346208_256_720 150
501 3300049589 Ga0501073_0004832 Ga0501073_0004832_8027_8491 150
502 3300049590 Ga0501074_0001779 Ga0501074_0001779_1659_2123 150
503 3300049591 Ga0501075_1222825 Ga0501075_1222825_61_525 150
504 3300049679 Ga0501249_110678 Ga0501249_110678_70_525 150
505 3300049741 Ga0501079_0239029 Ga0501079_0239029_76_540 150
506 3300049742 Ga0501080_0097369 Ga0501080_0097369_1494_1958 150
507 3300049744 Ga0501083_0005688 Ga0501083_0005688_3145_3609 150
508 3300049822 Ga0501035_0012125 Ga0501035_0012125_6109_6573 150
509 3300049823 Ga0501044_0003510 Ga0501044_0003510_6105_6569 150
510 3300049824 Ga0501045_0136884 Ga0501045_0136884_651_1115 150
511 3300050493 nmdc:mga0k408_703386_c1 nmdc:mga0k408_703386_c1_29_490 150
512 3300053153 Ga0500616_0047079 Ga0500616_0047079_1067_1519 150
513 3300054114 Ga0501084_0586477 Ga0501084_0586477_195_659 150
514 2162886011 MRS1b_contig_5087598 MRS1b_0360.00002850 151
515 2162886012 MBSR1b_contig_3015194 MBSR1b_0866.00004730 151
516 2162886012 MBSR1b_contig_3057618 MBSR1b_0677.00007170 151
517 3300002155 JGI24033J26618_1013705 JGI24033J26618_10137052 151
518 3300005289 Ga0065704_10347901 Ga0065704_103479011 151
519 3300005290 Ga0065712_10000839 Ga0065712_100008394 151
520 3300005293 Ga0065715_10185083 Ga0065715_101850832 151
521 3300005295 Ga0065707_10005177 Ga0065707_100051773 151
522 3300005331 Ga0070670_100037744 Ga0070670_1000377443 151
523 3300005334 Ga0068869_100005837 Ga0068869_1000058374 151
524 3300005338 Ga0068868_100748030 Ga0068868_1007480302 151
525 3300005340 Ga0070689_100016475 Ga0070689_1000164755 151
526 3300005343 Ga0070687_100144083 Ga0070687_1001440832 151
527 3300005354 Ga0070675_100006621 Ga0070675_1000066212 151
528 3300005364 Ga0070673_100006390 Ga0070673_1000063902 151
529 3300005365 Ga0070688_100004101 Ga0070688_1000041012 151
530 3300005459 Ga0068867_100017470 Ga0068867_1000174702 151
531 3300005577 Ga0068857_100058130 Ga0068857_1000581302 151
532 3300005617 Ga0068859_100082520 Ga0068859_1000825202 151
533 3300005719 Ga0068861_100012180 Ga0068861_1000121802 151
534 3300005840 Ga0068870_10002874 Ga0068870_100028742 151
535 3300005844 Ga0068862_100035100 Ga0068862_1000351004 151
536 3300006931 Ga0097620_100082520 Ga0097620_1000825203 151
537 3300009094 Ga0111539_10002057 Ga0111539_100020575 151
538 3300009174 Ga0105241_10618263 Ga0105241_106182631 151
539 3300009553 Ga0105249_10175390 Ga0105249_101753902 151
540 3300013308 Ga0157375_10017430 Ga0157375_100174304 151
541 3300014325 Ga0163163_11422338 Ga0163163_114223381 151
542 3300014326 Ga0157380_10006849 Ga0157380_100068493 151
543 3300014745 Ga0157377_10000417 Ga0157377_1000041710 151
544 3300025271 Ga0207666_1021785 Ga0207666_10217852 151
545 3300025315 Ga0207697_10039214 Ga0207697_100392142 151
546 3300025907 Ga0207645_10113368 Ga0207645_101133682 151
547 3300025908 Ga0207643_10009563 Ga0207643_100095634 151
548 3300025923 Ga0207681_10032255 Ga0207681_100322552 151
549 3300025925 Ga0207650_10392058 Ga0207650_103920581 151
550 3300025926 Ga0207659_10176470 Ga0207659_101764702 151
551 3300025936 Ga0207670_10109596 Ga0207670_101095962 151
552 3300025940 Ga0207691_10039336 Ga0207691_100393362 151
553 3300025942 Ga0207689_10020156 Ga0207689_100201562 151
554 3300025961 Ga0207712_10099531 Ga0207712_100995313 151
555 3300025972 Ga0207668_10173520 Ga0207668_101735201 151
556 3300026023 Ga0207677_10852677 Ga0207677_108526772 151
557 3300026089 Ga0207648_10035005 Ga0207648_100350054 151
558 3300026116 Ga0207674_10011127 Ga0207674_100111274 151
559 3300026118 Ga0207675_100003924 Ga0207675_1000039246 151
560 3300027907 Ga0207428_10016019 Ga0207428_100160193 151
561 3300028380 Ga0268265_10010677 Ga0268265_100106774 151
562 3300050511 nmdc:mga08y16_17537_c1 nmdc:mga08y16_17537_c1_5900_6364 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11412

DsbD_N

Thiol:disulfide interchange protein DsbD, N-terminal

38

168

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dnv-assembly2.cif.gz_B crystal structure of neisseria meningitidis dsbd n-terminal domain in the reduced form 0.6952 18 148
2e9g-assembly1.cif.gz_A solution structure of the alpha adaptinc2 domain from human adapter-related protein complex 1 gamma 2 subunit 0.6887 21 147
6c29-assembly3.cif.gz_C crystal structure of the n-terminal periplasmic domain of scsb from proteus mirabilis 0.6756 25 150
2k9f-assembly1.cif.gz_B structural features of the complex between the dsbd n-terminal and the pilb n-terminal domains from neisseria meningitidis 0.6749 19 147
3mnm-assembly1.cif.gz_A crystal structure of gae domain of gga2p from saccharomyces cerevisiae 0.6572 21 149
ID Description Score Start End Superfamily
6dnvB00 Mainly Beta;Sandwich;Immunoglobulin-like;Thiol:disulfide interchange protein DsbD, N-terminal domain 0.6952 18 148 2.60.40.1250
af_Q8I4W9_644_772_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.6952 24 146 2.60.40.1230
af_Q86KI1_749_872_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.6813 25 151 2.60.40.1230
af_B0R024_667_786_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.6655 23 146 2.60.40.1230
5cn1C00 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.6518 21 149 2.60.40.1230
ID Description Score Start End GO Terms
AF-A0A1M3HLL6-F1-model_v4 Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein 0.9608 19 150
AF-A0A1Q3TG54-F1-model_v4 Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein 0.9581 24 151
AF-A0A2P8DCC0-F1-model_v4 Thiol:disulfide interchange protein DsbD 0.9546 25 151 GO:0005886
GO:0015035
GO:0017004
GO:0045454
AF-A0A644UDE8-F1-model_v4 Thiol:disulfide interchange protein DsbD (EC 1.8.1.8) 0.9477 24 151 GO:0016020
GO:0017004
GO:0045454
GO:0047134
AF-A0A7T9QQ28-F1-model_v4 deleted 0.9427 23 150

Feature Viewer

pLDDT pTM Quality
89.06 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map