F463872

General Info

Members Datasets Scaffolds Average Seq Length
561 244 1122 156

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0091057|Ga0501033_0091057_153_728
Length 191
Sequence VTGFITLRTGDPNQDPGPLISLGRNPFVLPEQERIPMSLIDPGKKAPAFTLKDQQGQTHRLSDYEGRPVVLYFYPKDDTPGCTKEACAFQDNLPKFKPSKAAILGVSILDEESKARFATKYKLSFPLLADEEHTVADKYGVWQKKSLYGRNFMGIVRTTYLIDGKGKVAKRWDNVKVDGHAEAVLAAVNEL

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
165 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
166 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
167 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
168 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.67
Nodule 0
Rhizoplane 0.89
Rhizosphere 96.26
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0091057 3300049570 Bacteria 2231
2 Ga0065712_10032229 3300005290 Bacteria 1170
3 Ga0065715_10005486 3300005293 Bacteria 5836
4 Ga0065715_10234993 3300005293 Bacteria 1220
5 Ga0065715_10541707 3300005293 Archaea 747
6 Ga0065707_10156412 3300005295 Bacteria 1604
7 Ga0065707_10393964 3300005295 Bacteria 861
8 Ga0065707_10609412 3300005295 Bacteria 685
9 Ga0065707_10753933 3300005295 Bacteria 617
10 Ga0070676_10294527 3300005328 Unclassified 1098
11 Ga0070676_10330767 3300005328 Bacteria 1042
12 Ga0070676_11159471 3300005328 Bacteria 586
13 Ga0070683_100227243 3300005329 Unclassified 1774
14 Ga0070683_100367700 3300005329 Bacteria 1370
15 Ga0070690_100157299 3300005330 Bacteria 1554
16 Ga0070690_100269851 3300005330 Bacteria 1210
17 Ga0070670_100500843 3300005331 Bacteria 1080
18 Ga0070670_100796574 3300005331 Bacteria 853
19 Ga0070677_10069437 3300005333 Bacteria 1478
20 Ga0068869_100039420 3300005334 Bacteria 3372
21 Ga0068869_100052706 3300005334 Bacteria 2955
22 Ga0070680_100130185 3300005336 Bacteria 2105
23 Ga0068868_100156713 3300005338 Bacteria 1878
24 Ga0068868_100181414 3300005338 Bacteria 1747
25 Ga0070689_100228088 3300005340 Bacteria 1530
26 Ga0070689_100367684 3300005340 Bacteria 1209
27 Ga0070689_100566177 3300005340 Bacteria 980
28 Ga0070689_100904876 3300005340 Bacteria 781
29 Ga0070687_100768253 3300005343 Bacteria 680
30 Ga0070692_10353560 3300005345 Bacteria 914
31 Ga0070692_10472974 3300005345 Bacteria 807
32 Ga0070668_100132097 3300005347 Bacteria 2005
33 Ga0070668_100132830 3300005347 Bacteria 1999
34 Ga0070668_101080359 3300005347 Bacteria 724
35 Ga0070669_100011803 3300005353 Bacteria 6197
36 Ga0070669_100287872 3300005353 Bacteria 1318
37 Ga0070669_100303524 3300005353 Bacteria 1285
38 Ga0070669_101078404 3300005353 Unclassified 691
39 Ga0070675_100000814 3300005354 Bacteria 21976
40 Ga0070675_100015296 3300005354 Bacteria 6063
41 Ga0070675_100096754 3300005354 Bacteria 2480
42 Ga0070675_100212218 3300005354 Bacteria 1683
43 Ga0070675_100247442 3300005354 Bacteria 1559
44 Ga0070675_100523680 3300005354 Bacteria 1070
45 Ga0070675_100547771 3300005354 Bacteria 1046
46 Ga0070671_100022189 3300005355 Bacteria 5186
47 Ga0070671_100420587 3300005355 Bacteria 1144
48 Ga0070674_100009299 3300005356 Bacteria 5883
49 Ga0070674_100070940 3300005356 Bacteria 2463
50 Ga0070674_100317654 3300005356 Bacteria 1247
51 Ga0070673_100066841 3300005364 Bacteria 2873
52 Ga0070673_100094619 3300005364 Unclassified 2449
53 Ga0070673_100624038 3300005364 Bacteria 985
54 Ga0070688_100025461 3300005365 Bacteria 3503
55 Ga0070688_100179815 3300005365 Bacteria 1466
56 Ga0070667_100188368 3300005367 Bacteria 1827
57 Ga0070703_10061045 3300005406 Bacteria 1234
58 Ga0070701_10082745 3300005438 Bacteria 1741
59 Ga0070711_100177568 3300005439 Bacteria 1628
60 Ga0070711_100344273 3300005439 Bacteria 1197
61 Ga0070711_100492091 3300005439 Bacteria 1010
62 Ga0070705_100168966 3300005440 Bacteria 1470
63 Ga0070705_101046078 3300005440 Bacteria 665
64 Ga0070700_100400111 3300005441 Bacteria 1032
65 Ga0070700_100624191 3300005441 Bacteria 848
66 Ga0070700_101286100 3300005441 Bacteria 614
67 Ga0070694_100051911 3300005444 Bacteria 2770
68 Ga0070694_100767091 3300005444 Bacteria 789
69 Ga0070694_101079468 3300005444 Bacteria 669
70 Ga0070708_100011381 3300005445 Bacteria 7237
71 Ga0070708_100146341 3300005445 Bacteria 2195
72 Ga0070708_100256951 3300005445 Bacteria 1642
73 Ga0070708_100867028 3300005445 Bacteria 848
74 Ga0070663_100130100 3300005455 Bacteria 1911
75 Ga0070678_100062434 3300005456 Bacteria 2751
76 Ga0070678_100145326 3300005456 Bacteria 1903
77 Ga0070678_100187030 3300005456 Bacteria 1700
78 Ga0070678_100267449 3300005456 Archaea 1440
79 Ga0070662_100052593 3300005457 Bacteria 2945
80 Ga0070662_100219462 3300005457 Bacteria 1516
81 Ga0070681_11411557 3300005458 Bacteria 620
82 Ga0068867_100003303 3300005459 Bacteria 11360
83 Ga0068867_100257210 3300005459 Bacteria 1422
84 Ga0070685_10029775 3300005466 Bacteria 3036
85 Ga0070706_100015269 3300005467 Bacteria 7089
86 Ga0070706_100222946 3300005467 Bacteria 1760
87 Ga0070707_100022704 3300005468 Bacteria 5932
88 Ga0070707_100058772 3300005468 Bacteria 3688
89 Ga0070707_100112563 3300005468 Bacteria 2640
90 Ga0070707_100248482 3300005468 Bacteria 1731
91 Ga0070707_100468977 3300005468 Bacteria 1220
92 Ga0070698_100026990 3300005471 Bacteria 5972
93 Ga0070698_100061542 3300005471 Bacteria 3788
94 Ga0070698_100345546 3300005471 Bacteria 1419
95 Ga0070698_100459608 3300005471 Bacteria 1209
96 Ga0070699_100526352 3300005518 Bacteria 1075
97 Ga0070684_100011804 3300005535 Bacteria 6971
98 Ga0070697_100023608 3300005536 Bacteria 4891
99 Ga0070697_100131074 3300005536 Bacteria 2102
100 Ga0070697_100588853 3300005536 Bacteria 977
101 Ga0068853_100694281 3300005539 Archaea 970
102 Ga0068853_102261140 3300005539 Bacteria 527
103 Ga0070672_100055149 3300005543 Bacteria 3113
104 Ga0070672_100226481 3300005543 Bacteria 1569
105 Ga0070672_100999726 3300005543 Bacteria 741
106 Ga0070672_101610177 3300005543 Bacteria 583
107 Ga0070686_100288687 3300005544 Bacteria 1212
108 Ga0070695_100022254 3300005545 Bacteria 3887
109 Ga0070695_100070197 3300005545 Bacteria 2291
110 Ga0070696_100081129 3300005546 Bacteria 2298
111 Ga0070696_100229911 3300005546 Bacteria 1395
112 Ga0070665_100002712 3300005548 Bacteria 19194
113 Ga0070665_100017842 3300005548 Bacteria 7125
114 Ga0070665_100833662 3300005548 Bacteria 935
115 Ga0070665_101856797 3300005548 Bacteria 609
116 Ga0070704_100067307 3300005549 Bacteria 2586
117 Ga0070704_100584669 3300005549 Bacteria 980
118 Ga0070704_100593209 3300005549 Bacteria 973
119 Ga0070664_100390400 3300005564 Bacteria 1272
120 Ga0070664_101979282 3300005564 Bacteria 553
121 Ga0068857_100406209 3300005577 Bacteria 1268
122 Ga0068857_101132796 3300005577 Bacteria 756
123 Ga0070702_100023025 3300005615 Bacteria 3303
124 Ga0068852_101357268 3300005616 Bacteria 733
125 Ga0068859_100006108 3300005617 Bacteria 12234
126 Ga0068859_100008286 3300005617 Bacteria 10537
127 Ga0068859_100041208 3300005617 Bacteria 4639
128 Ga0068866_10073784 3300005718 Bacteria 1812
129 Ga0068866_10092430 3300005718 Bacteria 1651
130 Ga0068861_100038241 3300005719 Bacteria 3571
131 Ga0068861_100076879 3300005719 Bacteria 2602
132 Ga0068861_101157178 3300005719 Bacteria 746
133 Ga0068861_101549261 3300005719 Bacteria 652
134 Ga0068851_10381057 3300005834 Archaea 826
135 Ga0068870_10053348 3300005840 Bacteria 2147
136 Ga0068863_100036804 3300005841 Bacteria 4660
137 Ga0068858_100013249 3300005842 Bacteria 7770
138 Ga0068858_100175574 3300005842 Bacteria 2021
139 Ga0068858_100303656 3300005842 Bacteria 1523
140 Ga0068858_100350326 3300005842 Bacteria 1414
141 Ga0068858_100523924 3300005842 Bacteria 1146
142 Ga0068858_101788678 3300005842 Bacteria 607
143 Ga0068860_100014897 3300005843 Bacteria 7603
144 Ga0068860_100142171 3300005843 Bacteria 2307
145 Ga0068860_100165813 3300005843 Bacteria 2132
146 Ga0068860_100610431 3300005843 Bacteria 1097
147 Ga0068862_100089575 3300005844 Bacteria 2678
148 Ga0068862_100110444 3300005844 Bacteria 2413
149 Ga0068862_100143556 3300005844 Bacteria 2120
150 Ga0068862_100205706 3300005844 Bacteria 1776
151 Ga0068862_101607925 3300005844 Bacteria 657
152 Ga0081540_1183802 3300005983 Bacteria 779
153 Ga0081539_10262748 3300005985 Bacteria 760
154 Ga0075364_10038436 3300006051 Bacteria 3100
155 Ga0070716_100020229 3300006173 Bacteria 3491
156 Ga0075362_10102708 3300006177 Bacteria 1338
157 Ga0075367_10067827 3300006178 Bacteria 2139
158 Ga0075367_10343397 3300006178 Bacteria 942
159 Ga0075369_10082772 3300006186 Bacteria 1425
160 Ga0075366_10039015 3300006195 Bacteria 2805
161 Ga0097621_100085898 3300006237 Bacteria 2625
162 Ga0097621_100894708 3300006237 Bacteria 827
163 Ga0075370_10038785 3300006353 Bacteria 2682
164 Ga0068871_100042663 3300006358 Bacteria 3643
165 Ga0068871_100147105 3300006358 Bacteria 2007
166 Ga0068871_100167434 3300006358 Bacteria 1882
167 Ga0068871_101848820 3300006358 Bacteria 574
168 Ga0075428_100003666 3300006844 Bacteria 16843
169 Ga0075428_100046182 3300006844 Bacteria 4785
170 Ga0075428_100101497 3300006844 Bacteria 3136
171 Ga0075428_100136726 3300006844 Bacteria 2665
172 Ga0075428_100195432 3300006844 Bacteria 2188
173 Ga0075428_100744752 3300006844 Unclassified 1043
174 Ga0075430_100040224 3300006846 Bacteria 3958
175 Ga0075430_100158016 3300006846 Bacteria 1887
176 Ga0075430_100792248 3300006846 Bacteria 781
177 Ga0075430_101318349 3300006846 Unclassified 594
178 Ga0075431_100033694 3300006847 Bacteria 5278
179 Ga0075431_100037756 3300006847 Bacteria 4973
180 Ga0075431_100038059 3300006847 Bacteria 4953
181 Ga0075431_100087164 3300006847 Bacteria 3222
182 Ga0075431_100572864 3300006847 Bacteria 1115
183 Ga0075433_10004207 3300006852 Bacteria 11171
184 Ga0075433_10051672 3300006852 Bacteria 3580
185 Ga0075433_10055068 3300006852 Bacteria 3471
186 Ga0075433_10081839 3300006852 Bacteria 2847
187 Ga0075433_10804518 3300006852 Bacteria 821
188 Ga0075434_100014802 3300006871 Bacteria 7465
189 Ga0075434_100198702 3300006871 Bacteria 2025
190 Ga0075434_100913680 3300006871 Bacteria 893
191 Ga0075434_101362505 3300006871 Bacteria 720
192 Ga0075434_101466500 3300006871 Bacteria 692
193 Ga0075434_101704018 3300006871 Bacteria 638
194 Ga0075429_100007119 3300006880 Bacteria 9716
195 Ga0075429_100015545 3300006880 Bacteria 6595
196 Ga0075429_100058957 3300006880 Bacteria 3344
197 Ga0075429_100351293 3300006880 Bacteria 1291
198 Ga0075429_100460315 3300006880 Bacteria 1114
199 Ga0068865_100272456 3300006881 Bacteria 1344
200 Ga0068865_100536854 3300006881 Bacteria 980
201 Ga0068865_100764589 3300006881 Bacteria 831
202 Ga0068865_101003206 3300006881 Bacteria 731
203 Ga0075436_100085243 3300006914 Bacteria 2193
204 Ga0097620_100006108 3300006931 Bacteria 12234
205 Ga0097620_100008286 3300006931 Bacteria 10537
206 Ga0097620_100041209 3300006931 Bacteria 4639
207 Ga0075435_100063881 3300007076 Bacteria 2990
208 Ga0075435_100863603 3300007076 Bacteria 789
209 Ga0075435_101066244 3300007076 Bacteria 706
210 Ga0099794_10010944 3300007265 Bacteria 3870
211 Ga0099794_10433389 3300007265 Bacteria 688
212 Ga0111539_10003086 3300009094 Bacteria 22081
213 Ga0111539_10025085 3300009094 Bacteria 7307
214 Ga0111539_10040819 3300009094 Bacteria 5584
215 Ga0111539_10108947 3300009094 Bacteria 3251
216 Ga0111539_10207118 3300009094 Bacteria 2286
217 Ga0111539_10399267 3300009094 Bacteria 1601
218 Ga0111539_10441205 3300009094 Bacteria 1516
219 Ga0111539_10692479 3300009094 Bacteria 1186
220 Ga0111539_11388547 3300009094 Bacteria 815
221 Ga0105245_10010575 3300009098 Bacteria 8029
222 Ga0105245_10055503 3300009098 Bacteria 3558
223 Ga0105245_10179550 3300009098 Bacteria 2021
224 Ga0105245_10786262 3300009098 Bacteria 989
225 Ga0105245_10799219 3300009098 Bacteria 981
226 Ga0105245_10905771 3300009098 Bacteria 924
227 Ga0105247_10140660 3300009101 Bacteria 1581
228 Ga0114129_10001435 3300009147 Bacteria 32173
229 Ga0114129_10011538 3300009147 Bacteria 12582
230 Ga0114129_10025580 3300009147 Bacteria 8363
231 Ga0114129_10030292 3300009147 Bacteria 7659
232 Ga0114129_10135221 3300009147 Bacteria 3383
233 Ga0114129_10156236 3300009147 Bacteria 3119
234 Ga0114129_10162111 3300009147 Bacteria 3054
235 Ga0114129_10206165 3300009147 Bacteria 2660
236 Ga0114129_11582974 3300009147 Bacteria 803
237 Ga0105243_10322369 3300009148 Bacteria 1408
238 Ga0105243_10789737 3300009148 Bacteria 935
239 Ga0105243_11236971 3300009148 Bacteria 761
240 Ga0105243_11304072 3300009148 Bacteria 743
241 Ga0105242_10035513 3300009176 Bacteria 3997
242 Ga0105242_10154767 3300009176 Bacteria 2002
243 Ga0105242_10458184 3300009176 Bacteria 1203
244 Ga0105248_10017843 3300009177 Bacteria 7832
245 Ga0105248_10061263 3300009177 Bacteria 4224
246 Ga0105248_10147696 3300009177 Bacteria 2653
247 Ga0105248_10233891 3300009177 Unclassified 2069
248 Ga0105248_10383349 3300009177 Bacteria 1583
249 Ga0105248_10398699 3300009177 Bacteria 1549
250 Ga0105238_10055906 3300009551 Bacteria 3960
251 Ga0105238_10119912 3300009551 Bacteria 2610
252 Ga0105238_12062090 3300009551 Bacteria 604
253 Ga0105238_12237449 3300009551 Bacteria 582
254 Ga0105249_10043333 3300009553 Bacteria 4093
255 Ga0105249_10058215 3300009553 Bacteria 3542
256 Ga0105249_10738236 3300009553 Bacteria 1046
257 Ga0105249_11283532 3300009553 Bacteria 804
258 Ga0105239_10887698 3300010375 Bacteria 1023
259 Ga0157374_11455951 3300013296 Bacteria 708
260 Ga0157378_10201273 3300013297 Bacteria 1884
261 Ga0157378_11413527 3300013297 Bacteria 739
262 Ga0163162_10070009 3300013306 Bacteria 3560
263 Ga0157375_10173094 3300013308 Bacteria 2307
264 Ga0157375_10349576 3300013308 Bacteria 1644
265 Ga0157380_10046940 3300014326 Bacteria 3394
266 Ga0157380_10050564 3300014326 Bacteria 3284
267 Ga0157380_10082498 3300014326 Bacteria 2631
268 Ga0157380_10788601 3300014326 Bacteria 966
269 Ga0157377_10008132 3300014745 Bacteria 5100
270 Ga0157377_11185820 3300014745 Bacteria 590
271 Ga0157379_10017961 3300014968 Bacteria 6233
272 Ga0157379_10228083 3300014968 Bacteria 1688
273 Ga0157379_11592968 3300014968 Bacteria 637
274 Ga0163161_10136681 3300017792 Bacteria 1853
275 Ga0163161_10194392 3300017792 Bacteria 1561
276 Ga0207653_10047814 3300025885 Bacteria 1417
277 Ga0207682_10043795 3300025893 Bacteria 1833
278 Ga0207682_10064751 3300025893 Bacteria 1537
279 Ga0207642_10057119 3300025899 Bacteria 1793
280 Ga0207710_10174942 3300025900 Bacteria 1051
281 Ga0207688_10141853 3300025901 Bacteria 1414
282 Ga0207688_10686459 3300025901 Bacteria 647
283 Ga0207699_10251513 3300025906 Bacteria 1218
284 Ga0207645_10356382 3300025907 Bacteria 980
285 Ga0207645_10724215 3300025907 Archaea 676
286 Ga0207643_10005128 3300025908 Bacteria 7009
287 Ga0207643_10018001 3300025908 Bacteria 3869
288 Ga0207684_10025033 3300025910 Bacteria 5086
289 Ga0207684_10190361 3300025910 Bacteria 1770
290 Ga0207671_11128910 3300025914 Bacteria 615
291 Ga0207693_10289025 3300025915 Bacteria 1285
292 Ga0207663_10445406 3300025916 Bacteria 998
293 Ga0207660_11256356 3300025917 Bacteria 602
294 Ga0207662_10001680 3300025918 Bacteria 10833
295 Ga0207662_10210362 3300025918 Bacteria 1262
296 Ga0207646_10013113 3300025922 Bacteria 7934
297 Ga0207646_10138597 3300025922 Bacteria 2191
298 Ga0207646_10231268 3300025922 Bacteria 1670
299 Ga0207646_10511833 3300025922 Bacteria 1081
300 Ga0207650_10551970 3300025925 Bacteria 966
301 Ga0207650_10768767 3300025925 Bacteria 816
302 Ga0207659_10001353 3300025926 Bacteria 14631
303 Ga0207659_10061935 3300025926 Bacteria 2699
304 Ga0207659_10313256 3300025926 Bacteria 1293
305 Ga0207659_10382856 3300025926 Bacteria 1173
306 Ga0207659_10443816 3300025926 Bacteria 1092
307 Ga0207659_10748395 3300025926 Bacteria 838
308 Ga0207659_11257938 3300025926 Bacteria 636
309 Ga0207687_10227811 3300025927 Bacteria 1471
310 Ga0207687_10265201 3300025927 Bacteria 1371
311 Ga0207687_10628995 3300025927 Bacteria 907
312 Ga0207700_10373916 3300025928 Bacteria 1245
313 Ga0207706_10240944 3300025933 Bacteria 1581
314 Ga0207686_10025501 3300025934 Bacteria 3439
315 Ga0207686_10289626 3300025934 Bacteria 1212
316 Ga0207709_10721247 3300025935 Bacteria 799
317 Ga0207670_10198205 3300025936 Bacteria 1524
318 Ga0207670_10419129 3300025936 Bacteria 1074
319 Ga0207669_10145292 3300025937 Bacteria 1653
320 Ga0207669_10166219 3300025937 Bacteria 1565
321 Ga0207704_10142697 3300025938 Bacteria 1678
322 Ga0207704_10778855 3300025938 Unclassified 797
323 Ga0207704_11642370 3300025938 Bacteria 552
324 Ga0207665_10001249 3300025939 Bacteria 17146
325 Ga0207691_10004284 3300025940 Bacteria 13861
326 Ga0207691_10130218 3300025940 Bacteria 2223
327 Ga0207691_10610794 3300025940 Bacteria 923
328 Ga0207711_10028513 3300025941 Bacteria 4698
329 Ga0207711_10242226 3300025941 Bacteria 1654
330 Ga0207711_10912098 3300025941 Bacteria 817
331 Ga0207689_10018764 3300025942 Bacteria 5832
332 Ga0207689_10068412 3300025942 Bacteria 2919
333 Ga0207689_10187702 3300025942 Bacteria 1705
334 Ga0207689_11066134 3300025942 Bacteria 681
335 Ga0207661_10044808 3300025944 Unclassified 3499
336 Ga0207661_10209820 3300025944 Bacteria 1716
337 Ga0207679_10202484 3300025945 Bacteria 1659
338 Ga0207679_11305781 3300025945 Bacteria 666
339 Ga0207651_10001274 3300025960 Bacteria 11351
340 Ga0207651_10242061 3300025960 Bacteria 1471
341 Ga0207651_10743854 3300025960 Bacteria 866
342 Ga0207712_10116472 3300025961 Bacteria 2014
343 Ga0207712_10124506 3300025961 Bacteria 1955
344 Ga0207712_10474492 3300025961 Bacteria 1065
345 Ga0207668_10480332 3300025972 Bacteria 1066
346 Ga0207668_10970235 3300025972 Bacteria 759
347 Ga0207668_11184079 3300025972 Bacteria 686
348 Ga0207677_10148550 3300026023 Bacteria 1804
349 Ga0207677_10388379 3300026023 Bacteria 1180
350 Ga0207677_10671384 3300026023 Bacteria 917
351 Ga0207703_10116112 3300026035 Bacteria 2291
352 Ga0207703_10219649 3300026035 Bacteria 1698
353 Ga0207703_10232697 3300026035 Bacteria 1653
354 Ga0207703_11591213 3300026035 Bacteria 629
355 Ga0207639_10065078 3300026041 Bacteria 2829
356 Ga0207678_10030590 3300026067 Bacteria 4699
357 Ga0207708_10018447 3300026075 Bacteria 5255
358 Ga0207708_11826126 3300026075 Unclassified 533
359 Ga0207641_11246707 3300026088 Bacteria 744
360 Ga0207648_10002116 3300026089 Bacteria 21633
361 Ga0207676_10347847 3300026095 Bacteria 1370
362 Ga0207676_11048671 3300026095 Archaea 805
363 Ga0207675_100054358 3300026118 Bacteria 3735
364 Ga0207675_100094828 3300026118 Bacteria 2807
365 Ga0207675_100313736 3300026118 Bacteria 1530
366 Ga0207683_10019544 3300026121 Bacteria 5785
367 Ga0207683_10039721 3300026121 Bacteria 4106
368 Ga0207683_10124616 3300026121 Bacteria 2315
369 Ga0207683_10152755 3300026121 Bacteria 2084
370 Ga0207698_10782720 3300026142 Bacteria 955
371 Ga0209813_10079624 3300027866 Bacteria 1081
372 Ga0207428_10000311 3300027907 Bacteria 64550
373 Ga0207428_10015962 3300027907 Bacteria 6476
374 Ga0268266_10027059 3300028379 Bacteria 4879
375 Ga0268266_10028012 3300028379 Bacteria 4790
376 Ga0268265_10010887 3300028380 Bacteria 6143
377 Ga0268265_10103264 3300028380 Bacteria 2308
378 Ga0268265_10575614 3300028380 Bacteria 1073
379 Ga0268265_11112774 3300028380 Bacteria 784
380 Ga0268264_10101573 3300028381 Bacteria 2500
381 Ga0268264_10361144 3300028381 Bacteria 1385
382 Ga0307416_101156860 3300032002 Bacteria 879
383 Ga0373936_0285099 3300035113 Bacteria 743
384 Ga0373960_0242975 3300035121 Bacteria 652
385 Ga0373946_0100041 3300035171 Bacteria 1299
386 Ga0373935_0598819 3300035692 Bacteria 806
387 Ga0373935_1197772 3300035692 Bacteria 566
388 Ga0373925_0526188 3300037068 Bacteria 972
389 Ga0395900_0052213 3300037418 Bacteria 4208
390 Ga0395900_1209991 3300037418 Bacteria 671
391 Ga0395898_0070912 3300037466 Bacteria 3368
392 Ga0395901_0005029 3300038443 Bacteria 13349
393 Ga0439453_0118615 3300041408 Bacteria 605
394 Ga0451802_1142393 3300041460 Bacteria 537
395 Ga0451804_0721827 3300041463 Bacteria 540
396 Ga0439433_0094338 3300041999 Bacteria 738
397 Ga0439462_0016796 3300042015 Bacteria 1894
398 Ga0450892_009838 3300042130 Bacteria 831
399 Ga0450896_044485 3300042133 Bacteria 697
400 Ga0439446_0028150 3300042156 Bacteria 1617
401 Ga0439435_0004811 3300042436 Bacteria 2930
402 Ga0439460_0074380 3300042461 Bacteria 1057
403 Ga0439460_0173964 3300042461 Bacteria 726
404 Ga0439440_0047709 3300042993 Archaea 1062
405 Ga0453684_1689359 3300044712 Bacteria 647
406 Ga0451576_0991778 3300045051 Bacteria 880
407 Ga0495629_0317026 3300046459 Bacteria 1066
408 Ga0495653_0130907 3300046463 Bacteria 1776
409 Ga0495580_0209899 3300046472 Bacteria 1340
410 Ga0495580_0309967 3300046472 Bacteria 1074
411 Ga0495586_0178788 3300046535 Bacteria 1200
412 Ga0495621_0310657 3300046539 Bacteria 655
413 Ga0495645_0129175 3300046543 Bacteria 1773
414 Ga0495633_0428621 3300046558 Bacteria 598
415 Ga0495656_0298509 3300046615 Bacteria 825
416 Ga0495634_0413429 3300046642 Bacteria 800
417 Ga0495647_0302098 3300046681 Bacteria 722
418 Ga0495669_0118305 3300046684 Bacteria 1241
419 Ga0495613_0294807 3300046689 Bacteria 1124
420 Ga0495600_0167203 3300046809 Bacteria 1420
421 Ga0495680_0112216 3300047322 Bacteria 2020
422 Ga0496105_0233270 3300048908 Bacteria 1495
423 Ga0496110_0377857 3300048913 Unclassified 1291
424 Ga0496114_0204898 3300048917 Archaea 1729
425 Ga0496126_0010266 3300048929 Bacteria 9838
426 Ga0501031_0011276 3300049568 Bacteria 5825
427 Ga0501032_0003245 3300049569 Bacteria 12504
428 Ga0501032_0019537 3300049569 Bacteria 4738
429 Ga0501032_0380735 3300049569 Bacteria 907
430 Ga0501032_0983637 3300049569 Bacteria 530
431 Ga0501034_0008129 3300049571 Bacteria 11124
432 Ga0501034_0051141 3300049571 Bacteria 4166
433 Ga0501034_0053933 3300049571 Bacteria 4047
434 Ga0501034_0114255 3300049571 Bacteria 2688
435 Ga0501034_0247511 3300049571 Bacteria 1727
436 Ga0501034_0736139 3300049571 Bacteria 882
437 Ga0501034_0975342 3300049571 Bacteria 732
438 Ga0501036_0008423 3300049572 Bacteria 8447
439 Ga0501036_0017633 3300049572 Bacteria 5974
440 Ga0501036_0019058 3300049572 Bacteria 5757
441 Ga0501036_0023477 3300049572 Bacteria 5195
442 Ga0501036_0047180 3300049572 Bacteria 3648
443 Ga0501037_0034354 3300049573 Bacteria 3741
444 Ga0501037_0101033 3300049573 Bacteria 2082
445 Ga0501037_1016273 3300049573 Bacteria 539
446 Ga0501038_0043036 3300049574 Bacteria 3929
447 Ga0501038_0049175 3300049574 Bacteria 3647
448 Ga0501038_0190327 3300049574 Bacteria 1651
449 Ga0501039_0001653 3300049575 Bacteria 16438
450 Ga0501039_0056110 3300049575 Bacteria 3051
451 Ga0501039_0184387 3300049575 Bacteria 1641
452 Ga0501039_0417767 3300049575 Bacteria 1053
453 Ga0501040_0079534 3300049576 Bacteria 2269
454 Ga0501041_0146503 3300049577 Bacteria 1473
455 Ga0501042_0003287 3300049578 Bacteria 10117
456 Ga0501043_0001959 3300049579 Bacteria 17594
457 Ga0501043_0031254 3300049579 Bacteria 4186
458 Ga0501046_0006016 3300049580 Bacteria 10790
459 Ga0501046_0019549 3300049580 Bacteria 5616
460 Ga0501046_0030787 3300049580 Bacteria 4354
461 Ga0501046_0057954 3300049580 Bacteria 3037
462 Ga0501046_0117985 3300049580 Bacteria 2021
463 Ga0501046_0215432 3300049580 Bacteria 1424
464 Ga0501047_0000429 3300049581 Bacteria 47067
465 Ga0501047_0010395 3300049581 Bacteria 8806
466 Ga0501047_0019577 3300049581 Bacteria 6494
467 Ga0501047_0073169 3300049581 Bacteria 3299
468 Ga0501047_0079494 3300049581 Bacteria 3152
469 Ga0501048_0045934 3300049582 Bacteria 3118
470 Ga0501048_0482733 3300049582 Bacteria 888
471 Ga0501067_0077451 3300049583 Bacteria 1842
472 Ga0501067_0192909 3300049583 Bacteria 1135
473 Ga0501067_0354999 3300049583 Bacteria 817
474 Ga0501068_0015509 3300049584 Bacteria 4377
475 Ga0501068_0161275 3300049584 Bacteria 1413
476 Ga0501068_0536280 3300049584 Bacteria 760
477 Ga0501070_0034452 3300049586 Bacteria 4234
478 Ga0501070_0290900 3300049586 Bacteria 1332
479 Ga0501071_0015878 3300049587 Bacteria 5171
480 Ga0501071_0684769 3300049587 Bacteria 789
481 Ga0501072_0006587 3300049588 Bacteria 8847
482 Ga0501072_0093891 3300049588 Bacteria 2383
483 Ga0501073_0019953 3300049589 Bacteria 4834
484 Ga0501073_0021510 3300049589 Bacteria 4650
485 Ga0501074_0015192 3300049590 Bacteria 5597
486 Ga0501074_0043011 3300049590 Bacteria 3269
487 Ga0501075_0003745 3300049591 Bacteria 10214
488 Ga0501076_0001303 3300049592 Bacteria 16644
489 Ga0501077_0083528 3300049593 Bacteria 2024
490 Ga0501079_0504787 3300049741 Bacteria 951
491 Ga0501079_0796588 3300049741 Bacteria 744
492 Ga0501080_0000360 3300049742 Bacteria 35117
493 Ga0501080_0057773 3300049742 Bacteria 3611
494 Ga0501080_0105325 3300049742 Bacteria 2615
495 Ga0501080_0296429 3300049742 Bacteria 1467
496 Ga0501081_0005166 3300049743 Bacteria 8401
497 Ga0501083_0007449 3300049744 Bacteria 7758
498 Ga0501083_0021670 3300049744 Bacteria 4462
499 Ga0501083_0570317 3300049744 Bacteria 736
500 Ga0501035_0075205 3300049822 Bacteria 2987
501 Ga0501035_0283634 3300049822 Bacteria 1399
502 Ga0501044_0008088 3300049823 Bacteria 11543
503 Ga0501044_0032701 3300049823 Bacteria 5467
504 Ga0501045_0009544 3300049824 Bacteria 6789
505 nmdc:mga00v17_168211_c1 3300050491 Bacteria 1413
506 nmdc:mga0yw44_142079_c1 3300050492 Bacteria 1561
507 nmdc:mga0k408_56605_c1 3300050493 Bacteria 2276
508 nmdc:mga06z11_8925_c1 3300050494 Bacteria 4205
509 nmdc:mga07m45_43502_c1 3300050496 Bacteria 2518
510 nmdc:mga05p37_107783_c1 3300050507 Bacteria 3427
511 nmdc:mga05p37_1575938_c1 3300050507 Bacteria 649
512 nmdc:mga05p37_178015_c1 3300050507 Bacteria 2590
513 nmdc:mga05p37_263847_c1 3300050507 Bacteria 2060
514 nmdc:mga05p37_68601_c1 3300050507 Unclassified 1993
515 nmdc:mga05p37_816796_c1 3300050507 Bacteria 1017
516 nmdc:mga05p37_9103_c1 3300050507 Bacteria 11737
517 nmdc:mga09592_16615_c1 3300050508 Bacteria 6022
518 nmdc:mga09592_21777_c1 3300050508 Bacteria 5285
519 nmdc:mga09592_36857_c1 3300050508 Bacteria 4098
520 nmdc:mga0qj67_389138_c1 3300050509 Bacteria 1126
521 nmdc:mga06r32_175695_c1 3300050510 Bacteria 2126
522 nmdc:mga06r32_197212_c1 3300050510 Bacteria 2001
523 nmdc:mga06r32_277391_c1 3300050510 Bacteria 1663
524 nmdc:mga06r32_614550_c1 3300050510 Bacteria 1057
525 nmdc:mga08y16_222438_c1 3300050511 Bacteria 1954
526 nmdc:mga08y16_312866_c1 3300050511 Bacteria 1617
527 nmdc:mga08y16_32123_c1 3300050511 Bacteria 5520
528 nmdc:mga0n895_1504123_c1 3300050512 Bacteria 639
529 nmdc:mga0n895_1528216_c1 3300050512 Bacteria 633
530 nmdc:mga0n895_2019119_c1 3300050512 Bacteria 534
531 nmdc:mga0n895_217328_c1 3300050512 Bacteria 1941
532 nmdc:mga0n895_297227_c1 3300050512 Bacteria 1637
533 nmdc:mga0n895_391817_c1 3300050512 Bacteria 1405
534 nmdc:mga0n895_669277_c1 3300050512 Bacteria 1035
535 nmdc:mga0rr50_138794_c1 3300050513 Bacteria 1954
536 nmdc:mga0rr50_225965_c1 3300050513 Bacteria 1547
537 nmdc:mga0rr50_405146_c1 3300050513 Bacteria 1152
538 nmdc:mga0rr50_43271_c1 3300050513 Bacteria 3294
539 nmdc:mga0rr50_912690_c1 3300050513 Bacteria 749
540 nmdc:mga08x19_408118_c1 3300050514 Bacteria 953
541 nmdc:mga08x19_472334_c1 3300050514 Bacteria 884
542 nmdc:mga0a205_170895_c1 3300050515 Bacteria 2070
543 nmdc:mga0a205_35708_c1 3300050515 Bacteria 4773
544 Ga0495595_0336830 3300053084 Bacteria 761
545 Ga0495619_0204558 3300053085 Bacteria 1367
546 Ga0495619_0485590 3300053085 Bacteria 850
547 Ga0500646_0072895 3300053090 Bacteria 1033
548 Ga0500652_052617 3300053131 Bacteria 1665
549 Ga0501084_0004388 3300054114 Bacteria 11499
550 Ga0501084_0083847 3300054114 Bacteria 2675
551 Ga0501084_1029836 3300054114 Bacteria 692
552 Ga0501084_1137201 3300054114 Bacteria 655
553 Ga0501084_1324670 3300054114 Bacteria 603
554 Ga0501082_0004301 3300060353 Bacteria 12449
555 Ga0501082_0012361 3300060353 Bacteria 7338
556 Ga0501082_0040411 3300060353 Bacteria 4024
557 Ga0501082_0053587 3300060353 Bacteria 3476
558 Ga0501082_0923873 3300060353 Bacteria 763
559 Ga0501082_1375675 3300060353 Bacteria 616
560 Ga0501082_1681930 3300060353 Bacteria 554
561 Ga0530510_0001113 3300061734 Bacteria 17859
562 Ga0501033_0091057
563 Ga0065712_10032229
564 Ga0065715_10005486
565 Ga0065715_10234993
566 Ga0065715_10541707
567 Ga0065707_10156412
568 Ga0065707_10393964
569 Ga0065707_10609412
570 Ga0065707_10753933
571 Ga0070676_10294527
572 Ga0070676_10330767
573 Ga0070676_11159471
574 Ga0070683_100227243
575 Ga0070683_100367700
576 Ga0070690_100157299
577 Ga0070690_100269851
578 Ga0070670_100500843
579 Ga0070670_100796574
580 Ga0070677_10069437
581 Ga0068869_100039420
582 Ga0068869_100052706
583 Ga0070680_100130185
584 Ga0068868_100156713
585 Ga0068868_100181414
586 Ga0070689_100228088
587 Ga0070689_100367684
588 Ga0070689_100566177
589 Ga0070689_100904876
590 Ga0070687_100768253
591 Ga0070692_10353560
592 Ga0070692_10472974
593 Ga0070668_100132097
594 Ga0070668_100132830
595 Ga0070668_101080359
596 Ga0070669_100011803
597 Ga0070669_100287872
598 Ga0070669_100303524
599 Ga0070669_101078404
600 Ga0070675_100000814
601 Ga0070675_100015296
602 Ga0070675_100096754
603 Ga0070675_100212218
604 Ga0070675_100247442
605 Ga0070675_100523680
606 Ga0070675_100547771
607 Ga0070671_100022189
608 Ga0070671_100420587
609 Ga0070674_100009299
610 Ga0070674_100070940
611 Ga0070674_100317654
612 Ga0070673_100066841
613 Ga0070673_100094619
614 Ga0070673_100624038
615 Ga0070688_100025461
616 Ga0070688_100179815
617 Ga0070667_100188368
618 Ga0070703_10061045
619 Ga0070701_10082745
620 Ga0070711_100177568
621 Ga0070711_100344273
622 Ga0070711_100492091
623 Ga0070705_100168966
624 Ga0070705_101046078
625 Ga0070700_100400111
626 Ga0070700_100624191
627 Ga0070700_101286100
628 Ga0070694_100051911
629 Ga0070694_100767091
630 Ga0070694_101079468
631 Ga0070708_100011381
632 Ga0070708_100146341
633 Ga0070708_100256951
634 Ga0070708_100867028
635 Ga0070663_100130100
636 Ga0070678_100062434
637 Ga0070678_100145326
638 Ga0070678_100187030
639 Ga0070678_100267449
640 Ga0070662_100052593
641 Ga0070662_100219462
642 Ga0070681_11411557
643 Ga0068867_100003303
644 Ga0068867_100257210
645 Ga0070685_10029775
646 Ga0070706_100015269
647 Ga0070706_100222946
648 Ga0070707_100022704
649 Ga0070707_100058772
650 Ga0070707_100112563
651 Ga0070707_100248482
652 Ga0070707_100468977
653 Ga0070698_100026990
654 Ga0070698_100061542
655 Ga0070698_100345546
656 Ga0070698_100459608
657 Ga0070699_100526352
658 Ga0070684_100011804
659 Ga0070697_100023608
660 Ga0070697_100131074
661 Ga0070697_100588853
662 Ga0068853_100694281
663 Ga0068853_102261140
664 Ga0070672_100055149
665 Ga0070672_100226481
666 Ga0070672_100999726
667 Ga0070672_101610177
668 Ga0070686_100288687
669 Ga0070695_100022254
670 Ga0070695_100070197
671 Ga0070696_100081129
672 Ga0070696_100229911
673 Ga0070665_100002712
674 Ga0070665_100017842
675 Ga0070665_100833662
676 Ga0070665_101856797
677 Ga0070704_100067307
678 Ga0070704_100584669
679 Ga0070704_100593209
680 Ga0070664_100390400
681 Ga0070664_101979282
682 Ga0068857_100406209
683 Ga0068857_101132796
684 Ga0070702_100023025
685 Ga0068852_101357268
686 Ga0068859_100006108
687 Ga0068859_100008286
688 Ga0068859_100041208
689 Ga0068866_10073784
690 Ga0068866_10092430
691 Ga0068861_100038241
692 Ga0068861_100076879
693 Ga0068861_101157178
694 Ga0068861_101549261
695 Ga0068851_10381057
696 Ga0068870_10053348
697 Ga0068863_100036804
698 Ga0068858_100013249
699 Ga0068858_100175574
700 Ga0068858_100303656
701 Ga0068858_100350326
702 Ga0068858_100523924
703 Ga0068858_101788678
704 Ga0068860_100014897
705 Ga0068860_100142171
706 Ga0068860_100165813
707 Ga0068860_100610431
708 Ga0068862_100089575
709 Ga0068862_100110444
710 Ga0068862_100143556
711 Ga0068862_100205706
712 Ga0068862_101607925
713 Ga0081540_1183802
714 Ga0081539_10262748
715 Ga0075364_10038436
716 Ga0070716_100020229
717 Ga0075362_10102708
718 Ga0075367_10067827
719 Ga0075367_10343397
720 Ga0075369_10082772
721 Ga0075366_10039015
722 Ga0097621_100085898
723 Ga0097621_100894708
724 Ga0075370_10038785
725 Ga0068871_100042663
726 Ga0068871_100147105
727 Ga0068871_100167434
728 Ga0068871_101848820
729 Ga0075428_100003666
730 Ga0075428_100046182
731 Ga0075428_100101497
732 Ga0075428_100136726
733 Ga0075428_100195432
734 Ga0075428_100744752
735 Ga0075430_100040224
736 Ga0075430_100158016
737 Ga0075430_100792248
738 Ga0075430_101318349
739 Ga0075431_100033694
740 Ga0075431_100037756
741 Ga0075431_100038059
742 Ga0075431_100087164
743 Ga0075431_100572864
744 Ga0075433_10004207
745 Ga0075433_10051672
746 Ga0075433_10055068
747 Ga0075433_10081839
748 Ga0075433_10804518
749 Ga0075434_100014802
750 Ga0075434_100198702
751 Ga0075434_100913680
752 Ga0075434_101362505
753 Ga0075434_101466500
754 Ga0075434_101704018
755 Ga0075429_100007119
756 Ga0075429_100015545
757 Ga0075429_100058957
758 Ga0075429_100351293
759 Ga0075429_100460315
760 Ga0068865_100272456
761 Ga0068865_100536854
762 Ga0068865_100764589
763 Ga0068865_101003206
764 Ga0075436_100085243
765 Ga0097620_100006108
766 Ga0097620_100008286
767 Ga0097620_100041209
768 Ga0075435_100063881
769 Ga0075435_100863603
770 Ga0075435_101066244
771 Ga0099794_10010944
772 Ga0099794_10433389
773 Ga0111539_10003086
774 Ga0111539_10025085
775 Ga0111539_10040819
776 Ga0111539_10108947
777 Ga0111539_10207118
778 Ga0111539_10399267
779 Ga0111539_10441205
780 Ga0111539_10692479
781 Ga0111539_11388547
782 Ga0105245_10010575
783 Ga0105245_10055503
784 Ga0105245_10179550
785 Ga0105245_10786262
786 Ga0105245_10799219
787 Ga0105245_10905771
788 Ga0105247_10140660
789 Ga0114129_10001435
790 Ga0114129_10011538
791 Ga0114129_10025580
792 Ga0114129_10030292
793 Ga0114129_10135221
794 Ga0114129_10156236
795 Ga0114129_10162111
796 Ga0114129_10206165
797 Ga0114129_11582974
798 Ga0105243_10322369
799 Ga0105243_10789737
800 Ga0105243_11236971
801 Ga0105243_11304072
802 Ga0105242_10035513
803 Ga0105242_10154767
804 Ga0105242_10458184
805 Ga0105248_10017843
806 Ga0105248_10061263
807 Ga0105248_10147696
808 Ga0105248_10233891
809 Ga0105248_10383349
810 Ga0105248_10398699
811 Ga0105238_10055906
812 Ga0105238_10119912
813 Ga0105238_12062090
814 Ga0105238_12237449
815 Ga0105249_10043333
816 Ga0105249_10058215
817 Ga0105249_10738236
818 Ga0105249_11283532
819 Ga0105239_10887698
820 Ga0157374_11455951
821 Ga0157378_10201273
822 Ga0157378_11413527
823 Ga0163162_10070009
824 Ga0157375_10173094
825 Ga0157375_10349576
826 Ga0157380_10046940
827 Ga0157380_10050564
828 Ga0157380_10082498
829 Ga0157380_10788601
830 Ga0157377_10008132
831 Ga0157377_11185820
832 Ga0157379_10017961
833 Ga0157379_10228083
834 Ga0157379_11592968
835 Ga0163161_10136681
836 Ga0163161_10194392
837 Ga0207653_10047814
838 Ga0207682_10043795
839 Ga0207682_10064751
840 Ga0207642_10057119
841 Ga0207710_10174942
842 Ga0207688_10141853
843 Ga0207688_10686459
844 Ga0207699_10251513
845 Ga0207645_10356382
846 Ga0207645_10724215
847 Ga0207643_10005128
848 Ga0207643_10018001
849 Ga0207684_10025033
850 Ga0207684_10190361
851 Ga0207671_11128910
852 Ga0207693_10289025
853 Ga0207663_10445406
854 Ga0207660_11256356
855 Ga0207662_10001680
856 Ga0207662_10210362
857 Ga0207646_10013113
858 Ga0207646_10138597
859 Ga0207646_10231268
860 Ga0207646_10511833
861 Ga0207650_10551970
862 Ga0207650_10768767
863 Ga0207659_10001353
864 Ga0207659_10061935
865 Ga0207659_10313256
866 Ga0207659_10382856
867 Ga0207659_10443816
868 Ga0207659_10748395
869 Ga0207659_11257938
870 Ga0207687_10227811
871 Ga0207687_10265201
872 Ga0207687_10628995
873 Ga0207700_10373916
874 Ga0207706_10240944
875 Ga0207686_10025501
876 Ga0207686_10289626
877 Ga0207709_10721247
878 Ga0207670_10198205
879 Ga0207670_10419129
880 Ga0207669_10145292
881 Ga0207669_10166219
882 Ga0207704_10142697
883 Ga0207704_10778855
884 Ga0207704_11642370
885 Ga0207665_10001249
886 Ga0207691_10004284
887 Ga0207691_10130218
888 Ga0207691_10610794
889 Ga0207711_10028513
890 Ga0207711_10242226
891 Ga0207711_10912098
892 Ga0207689_10018764
893 Ga0207689_10068412
894 Ga0207689_10187702
895 Ga0207689_11066134
896 Ga0207661_10044808
897 Ga0207661_10209820
898 Ga0207679_10202484
899 Ga0207679_11305781
900 Ga0207651_10001274
901 Ga0207651_10242061
902 Ga0207651_10743854
903 Ga0207712_10116472
904 Ga0207712_10124506
905 Ga0207712_10474492
906 Ga0207668_10480332
907 Ga0207668_10970235
908 Ga0207668_11184079
909 Ga0207677_10148550
910 Ga0207677_10388379
911 Ga0207677_10671384
912 Ga0207703_10116112
913 Ga0207703_10219649
914 Ga0207703_10232697
915 Ga0207703_11591213
916 Ga0207639_10065078
917 Ga0207678_10030590
918 Ga0207708_10018447
919 Ga0207708_11826126
920 Ga0207641_11246707
921 Ga0207648_10002116
922 Ga0207676_10347847
923 Ga0207676_11048671
924 Ga0207675_100054358
925 Ga0207675_100094828
926 Ga0207675_100313736
927 Ga0207683_10019544
928 Ga0207683_10039721
929 Ga0207683_10124616
930 Ga0207683_10152755
931 Ga0207698_10782720
932 Ga0209813_10079624
933 Ga0207428_10000311
934 Ga0207428_10015962
935 Ga0268266_10027059
936 Ga0268266_10028012
937 Ga0268265_10010887
938 Ga0268265_10103264
939 Ga0268265_10575614
940 Ga0268265_11112774
941 Ga0268264_10101573
942 Ga0268264_10361144
943 Ga0307416_101156860
944 Ga0373936_0285099
945 Ga0373960_0242975
946 Ga0373946_0100041
947 Ga0373935_0598819
948 Ga0373935_1197772
949 Ga0373925_0526188
950 Ga0395900_0052213
951 Ga0395900_1209991
952 Ga0395898_0070912
953 Ga0395901_0005029
954 Ga0439453_0118615
955 Ga0451802_1142393
956 Ga0451804_0721827
957 Ga0439433_0094338
958 Ga0439462_0016796
959 Ga0450892_009838
960 Ga0450896_044485
961 Ga0439446_0028150
962 Ga0439435_0004811
963 Ga0439460_0074380
964 Ga0439460_0173964
965 Ga0439440_0047709
966 Ga0453684_1689359
967 Ga0451576_0991778
968 Ga0495629_0317026
969 Ga0495653_0130907
970 Ga0495580_0209899
971 Ga0495580_0309967
972 Ga0495586_0178788
973 Ga0495621_0310657
974 Ga0495645_0129175
975 Ga0495633_0428621
976 Ga0495656_0298509
977 Ga0495634_0413429
978 Ga0495647_0302098
979 Ga0495669_0118305
980 Ga0495613_0294807
981 Ga0495600_0167203
982 Ga0495680_0112216
983 Ga0496105_0233270
984 Ga0496110_0377857
985 Ga0496114_0204898
986 Ga0496126_0010266
987 Ga0501031_0011276
988 Ga0501032_0003245
989 Ga0501032_0019537
990 Ga0501032_0380735
991 Ga0501032_0983637
992 Ga0501034_0008129
993 Ga0501034_0051141
994 Ga0501034_0053933
995 Ga0501034_0114255
996 Ga0501034_0247511
997 Ga0501034_0736139
998 Ga0501034_0975342
999 Ga0501036_0008423
1000 Ga0501036_0017633
1001 Ga0501036_0019058
1002 Ga0501036_0023477
1003 Ga0501036_0047180
1004 Ga0501037_0034354
1005 Ga0501037_0101033
1006 Ga0501037_1016273
1007 Ga0501038_0043036
1008 Ga0501038_0049175
1009 Ga0501038_0190327
1010 Ga0501039_0001653
1011 Ga0501039_0056110
1012 Ga0501039_0184387
1013 Ga0501039_0417767
1014 Ga0501040_0079534
1015 Ga0501041_0146503
1016 Ga0501042_0003287
1017 Ga0501043_0001959
1018 Ga0501043_0031254
1019 Ga0501046_0006016
1020 Ga0501046_0019549
1021 Ga0501046_0030787
1022 Ga0501046_0057954
1023 Ga0501046_0117985
1024 Ga0501046_0215432
1025 Ga0501047_0000429
1026 Ga0501047_0010395
1027 Ga0501047_0019577
1028 Ga0501047_0073169
1029 Ga0501047_0079494
1030 Ga0501048_0045934
1031 Ga0501048_0482733
1032 Ga0501067_0077451
1033 Ga0501067_0192909
1034 Ga0501067_0354999
1035 Ga0501068_0015509
1036 Ga0501068_0161275
1037 Ga0501068_0536280
1038 Ga0501070_0034452
1039 Ga0501070_0290900
1040 Ga0501071_0015878
1041 Ga0501071_0684769
1042 Ga0501072_0006587
1043 Ga0501072_0093891
1044 Ga0501073_0019953
1045 Ga0501073_0021510
1046 Ga0501074_0015192
1047 Ga0501074_0043011
1048 Ga0501075_0003745
1049 Ga0501076_0001303
1050 Ga0501077_0083528
1051 Ga0501079_0504787
1052 Ga0501079_0796588
1053 Ga0501080_0000360
1054 Ga0501080_0057773
1055 Ga0501080_0105325
1056 Ga0501080_0296429
1057 Ga0501081_0005166
1058 Ga0501083_0007449
1059 Ga0501083_0021670
1060 Ga0501083_0570317
1061 Ga0501035_0075205
1062 Ga0501035_0283634
1063 Ga0501044_0008088
1064 Ga0501044_0032701
1065 Ga0501045_0009544
1066 nmdc:mga00v17_168211_c1
1067 nmdc:mga0yw44_142079_c1
1068 nmdc:mga0k408_56605_c1
1069 nmdc:mga06z11_8925_c1
1070 nmdc:mga07m45_43502_c1
1071 nmdc:mga05p37_107783_c1
1072 nmdc:mga05p37_1575938_c1
1073 nmdc:mga05p37_178015_c1
1074 nmdc:mga05p37_263847_c1
1075 nmdc:mga05p37_68601_c1
1076 nmdc:mga05p37_816796_c1
1077 nmdc:mga05p37_9103_c1
1078 nmdc:mga09592_16615_c1
1079 nmdc:mga09592_21777_c1
1080 nmdc:mga09592_36857_c1
1081 nmdc:mga0qj67_389138_c1
1082 nmdc:mga06r32_175695_c1
1083 nmdc:mga06r32_197212_c1
1084 nmdc:mga06r32_277391_c1
1085 nmdc:mga06r32_614550_c1
1086 nmdc:mga08y16_222438_c1
1087 nmdc:mga08y16_312866_c1
1088 nmdc:mga08y16_32123_c1
1089 nmdc:mga0n895_1504123_c1
1090 nmdc:mga0n895_1528216_c1
1091 nmdc:mga0n895_2019119_c1
1092 nmdc:mga0n895_217328_c1
1093 nmdc:mga0n895_297227_c1
1094 nmdc:mga0n895_391817_c1
1095 nmdc:mga0n895_669277_c1
1096 nmdc:mga0rr50_138794_c1
1097 nmdc:mga0rr50_225965_c1
1098 nmdc:mga0rr50_405146_c1
1099 nmdc:mga0rr50_43271_c1
1100 nmdc:mga0rr50_912690_c1
1101 nmdc:mga08x19_408118_c1
1102 nmdc:mga08x19_472334_c1
1103 nmdc:mga0a205_170895_c1
1104 nmdc:mga0a205_35708_c1
1105 Ga0495595_0336830
1106 Ga0495619_0204558
1107 Ga0495619_0485590
1108 Ga0500646_0072895
1109 Ga0500652_052617
1110 Ga0501084_0004388
1111 Ga0501084_0083847
1112 Ga0501084_1029836
1113 Ga0501084_1137201
1114 Ga0501084_1324670
1115 Ga0501082_0004301
1116 Ga0501082_0012361
1117 Ga0501082_0040411
1118 Ga0501082_0053587
1119 Ga0501082_0923873
1120 Ga0501082_1375675
1121 Ga0501082_1681930
1122 Ga0530510_0001113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

42

171

0.98

PF08534

Redoxin

Redoxin

41

187

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9461 1 154
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.944 2 155
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9411 5 154
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9381 2 155
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9372 4 154
ID Description Score Start End Superfamily
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9806 5 152 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9677 5 152 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9612 4 154 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.943 4 154 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9416 4 153 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A5Q4ESY9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9985 1 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-F7U8W1-F1-model_v4 deleted 0.9952 23 155
AF-A0A7D8YGS7-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9945 2 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A3C1X5H1-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9944 1 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-B6B4M5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9928 34 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map