F463871

General Info

Members Datasets Scaffolds Average Seq Length
561 404 377 398

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0020693|Ga0501033_0020693_3171_4517
Length 448
Sequence MFCAGRVDFRTNWFSIAASDRARAGAPSAEPYRSVPVFHRGSAMTSRLFGTALVLGLLSAVGPFAIDMYLPALPGIQRGLHTGVDAAQMSLMAFFAAIAVGQLVYGPVSDMLGRKPPIYFGLCLFAVASIGCALAPDIHTLIAARFVQGLGACAGMVVPRAIVRDMHTGTEATRLMALLMLVFSVSPILAPLTGSLVVRLSSWRGIFWVVAGAAVLGLALATFVLKETRTAAQRVESSVRSALAAYRTLLRDPSFLGLVFIGAFGISSFFAYLANSSFVLIEHYGLTPTQYSLAFSVNAVSFIGAAQFTGRLGERFGLRRVVRTAVAGYAATMLLLLALTAAGLDRLDLLMALLFVGYGFLGLVIPTTAVLALDRHGPVAGTASALMGTLQFVTGAAVIAVVGRFLDGTALPMVGGIAGCAVIAFLLARVTLRRDDEPTMDDVVVEQA

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
12 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
13 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
19 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
20 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
21 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
22 2519899620 Rhizobium sp. Pop5 Isolate Nodule
23 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
24 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
25 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
26 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
27 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
28 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
29 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
30 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
31 2643221651 Afipia sp. Root123D2 Isolate Unclassified
32 2718217882 Rhizobium sp. N741 Isolate Nodule
33 2718217927 Rhizobium sp. N324 Isolate Nodule
34 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
35 2718218009 Rhizobium sp. N561 Isolate Nodule
36 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
37 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
38 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
39 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
40 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
41 2718218363 Rhizobium sp. N113 Isolate Nodule
42 2718218365 Rhizobium sp. N731 Isolate Nodule
43 2718218366 Rhizobium sp. N621 Isolate Nodule
44 2718218423 Rhizobium sp. N941 Isolate Nodule
45 2721755514 Rhizobium sp. N6212 Isolate Nodule
46 2721755523 Delftia sp. HK171 Isolate Unclassified
47 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
48 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
49 2721755809 Rhizobium sp. N541 Isolate Nodule
50 2721755810 Rhizobium sp. N871 Isolate Nodule
51 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
52 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
53 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
54 2728369365 Rhizobium sp. N1341 Isolate Nodule
55 2728369397 Rhizobium sp. N1314 Isolate Nodule
56 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
57 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
58 2773857925 Microvirga vignae BR3299 Isolate Unclassified
59 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
60 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
61 2791355260 Rhizobium sp. L9 Isolate Nodule
62 2791355261 Rhizobium sp. J15 Isolate Nodule
63 2791355263 Rhizobium chutanense C5 Isolate Nodule
64 2791355264 Rhizobium sp. S9 Isolate Nodule
65 2791355265 Rhizobium sp. H4 Isolate Nodule
66 2791355266 Rhizobium sp. L43 Isolate Nodule
67 2791355267 Rhizobium sp. L18 Isolate Nodule
68 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
69 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
70 2802429633 Rhizobium anhuiense J3 Isolate Nodule
71 2802429634 Rhizobium anhuiense S10 Isolate Nodule
72 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
73 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
74 2802429637 Rhizobium anhuiense C15 Isolate Nodule
75 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
76 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
77 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
78 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
79 2838048938 Rhizobium pisi 27/80 Isolate Nodule
80 2838061910 Rhizobium phaseoli L15 Isolate Nodule
81 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
82 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
83 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
84 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
85 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
86 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
87 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
88 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
89 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
90 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
91 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
92 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
93 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
94 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
95 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
96 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
97 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
98 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
99 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
100 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
101 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
102 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
103 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
104 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
105 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
106 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
107 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
108 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
109 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
110 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
111 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
112 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
113 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
114 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
115 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
116 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
117 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
118 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
119 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
120 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
121 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
122 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
123 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
124 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
125 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
126 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
127 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
128 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
129 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
130 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
131 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
132 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
133 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
134 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
135 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
136 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
137 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
138 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
139 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
140 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
141 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
142 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
143 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
144 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
145 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
146 2933599457 Rhizobium phaseoli M3 Isolate Nodule
147 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
148 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
149 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
150 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
151 2936381700 Rhizobium chutanense C16 Isolate Unclassified
152 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
153 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
154 2996893221 Rhizobium sp. R635 Isolate Nodule
155 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
156 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
157 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
158 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
159 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
160 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
161 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
162 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
163 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
164 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
165 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
166 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
167 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
168 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
169 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
170 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
171 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
172 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
173 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
174 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
175 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
176 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
177 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
178 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
179 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
180 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
181 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
182 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
183 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
184 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
185 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
186 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
187 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
188 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
189 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
190 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
191 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
192 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
193 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
194 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
195 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
196 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
197 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
198 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
199 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
200 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
201 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
202 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
203 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
204 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
205 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
206 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
207 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
208 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
209 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
210 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
211 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
212 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
213 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
214 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
215 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
216 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
217 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
218 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
219 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
220 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
223 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
225 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
226 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
227 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
229 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
230 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
231 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
234 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
237 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
239 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
242 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
265 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
266 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
267 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
268 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
269 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
270 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
271 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
272 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
273 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
274 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
275 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
276 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
277 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
278 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
279 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
280 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
281 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
287 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
288 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
289 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
290 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
291 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
292 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
293 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
294 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
295 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
296 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
297 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
298 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
299 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
300 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
303 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
308 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
309 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
310 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
311 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
312 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
313 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
314 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
315 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
316 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
335 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
338 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
361 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
362 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
363 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
364 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
365 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
366 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
367 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
368 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
369 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
370 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
371 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
372 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
373 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
374 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
375 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
376 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
377 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
378 8005275841 Rhizobium sp. N4311 Isolate Nodule
379 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
380 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
381 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
382 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
383 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
384 8005382845 Rhizobium sp. R634 Isolate Nodule
385 8005395548 Rhizobium sp. R339 Isolate Nodule
386 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
387 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
388 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
389 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
390 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
391 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
392 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
393 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
394 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
395 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
396 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
397 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
398 8018176218 Rhizobium sp. N122 Isolate Nodule
399 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
400 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
401 8024501048 Rhizobium sp. H4 Isolate Nodule
402 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
403 8056382006 Rhizobium croatiense 13T Isolate Nodule
404 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.84
Metatranscriptomes 0.36
Isolates 32.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.89
Nodule 28.52
Rhizoplane 1.6
Rhizosphere 34.58
Stem 0
Stem Tuber 0
Unclassified 16.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000890 3300001979 Bacteria 13222
2 JGI24739J22299_10004216 3300001989 Bacteria 5504
3 JGI24737J22298_10026654 3300001990 Bacteria 1825
4 JGI25155J39150_1000098 3300002704 Bacteria 48725
5 JGI25156J39149_1000163 3300002705 Bacteria 48762
6 JGI25154J39366_1000183 3300002738 Bacteria 48762
7 JGI25154J39366_1001790 3300002738 Bacteria 6757
8 JGI25157J39369_1000135 3300002741 Bacteria 61510
9 JGI25157J39369_1000209 3300002741 Bacteria 48762
10 JGI25150J39212_1008450 3300002774 Bacteria 2012
11 JGI25159J45721_1000271 3300002987 Bacteria 24276
12 JGI25151J46595_10000274 3300003187 Bacteria 59318
13 JGI25153J46596_10000480 3300003215 Bacteria 25618
14 JGI25153J46596_10001740 3300003215 Bacteria 12923
15 rootH1_10040789 3300003316 Bacteria 5184
16 rootH2_10015358 3300003320 Bacteria 34751
17 rootH2_10130503 3300003320 Bacteria 1686
18 rootL2_10123658 3300003322 Bacteria 2720
19 rootH1_10005734 3300003323 Bacteria 12384
20 JGI25160J50197_1000212 3300003354 Bacteria 47984
21 JGI25160J50197_1000494 3300003354 Bacteria 23565
22 JGI25161J50226_1000151 3300003374 Bacteria 47984
23 JGI25161J50226_1005788 3300003374 Bacteria 2332
24 Ga0006562J51391_1027984 3300003578 Bacteria 4700
25 Ga0006562J51391_1027986 3300003578 Bacteria 4140
26 Ga0055533_1000172 3300003756 Bacteria 58634
27 Ga0055525_1001042 3300003759 Bacteria 7195
28 Ga0055535_1000641 3300003761 Bacteria 27812
29 Ga0055529_1000602 3300003763 Bacteria 27804
30 Ga0055526_1001782 3300003771 Bacteria 14943
31 Ga0055526_1002394 3300003771 Bacteria 12702
32 Ga0055526_1005662 3300003771 Bacteria 7095
33 Ga0055537_1011344 3300003773 Bacteria 1813
34 Ga0055524_1000082 3300003775 Bacteria 119749
35 Ga0055524_1005911 3300003775 Bacteria 5389
36 Ga0055524_1011941 3300003775 Bacteria 3362
37 Ga0055534_1001660 3300003784 Bacteria 8566
38 Ga0055528_1000511 3300003790 Bacteria 30498
39 Ga0055528_1002493 3300003790 Bacteria 9828
40 Ga0055528_1003441 3300003790 Bacteria 7938
41 Ga0055528_1020245 3300003790 Bacteria 2166
42 Ga0055540_1000010 3300003792 Bacteria 290865
43 Ga0055540_1004378 3300003792 Bacteria 6401
44 Ga0055531_10001298 3300003794 Bacteria 18832
45 Ga0055543_1000394 3300004625 Bacteria 27958
46 Ga0055543_1001641 3300004625 Bacteria 8524
47 Ga0065165_1010503 3300005262 Bacteria 3987
48 Ga0065165_1014130 3300005262 Bacteria 3117
49 Ga0065704_10134648 3300005289 Bacteria 1586
50 Ga0070667_100000183 3300005367 Bacteria 75488
51 Ga0070663_100000125 3300005455 Bacteria 36566
52 Ga0070663_100043673 3300005455 Bacteria 3155
53 Ga0070663_100184805 3300005455 Bacteria 1619
54 Ga0070685_10001154 3300005466 Bacteria 14130
55 Ga0068853_100405412 3300005539 Bacteria 1277
56 Ga0068855_100015586 3300005563 Bacteria 9146
57 Ga0068855_100029391 3300005563 Bacteria 6572
58 Ga0068857_100002648 3300005577 Bacteria 14705
59 Ga0068857_100051962 3300005577 Bacteria 3637
60 Ga0068854_100001124 3300005578 Bacteria 16073
61 Ga0068854_100007140 3300005578 Bacteria 7132
62 Ga0068856_100000116 3300005614 Bacteria 79220
63 Ga0068856_100004917 3300005614 Bacteria 13226
64 Ga0068863_100069231 3300005841 Bacteria 3337
65 Ga0068858_100037754 3300005842 Bacteria 4480
66 Ga0068862_100198035 3300005844 Bacteria 1810
67 Ga0075365_10015292 3300006038 Bacteria 4638
68 Ga0075362_10006704 3300006177 Bacteria 4303
69 Ga0075362_10064246 3300006177 Bacteria 1665
70 Ga0075367_10035768 3300006178 Bacteria 2877
71 Ga0075366_10018038 3300006195 Bacteria 4074
72 Ga0075366_10104946 3300006195 Bacteria 1698
73 Ga0079104_1000011 3300006946 Bacteria 359962
74 Ga0079104_1005385 3300006946 Bacteria 5129
75 Ga0105250_10011200 3300009092 Bacteria 3722
76 Ga0105240_10000254 3300009093 Bacteria 106067
77 Ga0105240_10000385 3300009093 Bacteria 82999
78 Ga0105240_10000668 3300009093 Bacteria 62941
79 Ga0105240_10002661 3300009093 Bacteria 28417
80 Ga0105240_10009760 3300009093 Bacteria 13555
81 Ga0105240_10088882 3300009093 Bacteria 3780
82 Ga0105243_10001827 3300009148 Bacteria 18207
83 Ga0105243_10057611 3300009148 Bacteria 3094
84 Ga0105241_10129443 3300009174 Bacteria 2042
85 Ga0105248_10000209 3300009177 Bacteria 67624
86 Ga0105237_10000105 3300009545 Bacteria 118218
87 Ga0105237_10000876 3300009545 Bacteria 40779
88 Ga0105237_10058676 3300009545 Bacteria 3851
89 Ga0105237_10073419 3300009545 Bacteria 3413
90 Ga0105238_10002261 3300009551 Bacteria 19395
91 Ga0105238_10052076 3300009551 Bacteria 4116
92 Ga0105238_10079574 3300009551 Bacteria 3267
93 Ga0105249_10000601 3300009553 Bacteria 32834
94 Ga0105239_10000030 3300010375 Bacteria 233669
95 Ga0105239_10144458 3300010375 Bacteria 2652
96 Ga0157370_10162439 3300013104 Bacteria 2078
97 Ga0157378_10048640 3300013297 Bacteria 3771
98 Ga0182008_10024609 3300014497 Bacteria 3063
99 Ga0182006_1000246 3300015261 Bacteria 50594
100 Ga0182005_1004217 3300015265 Bacteria 4693
101 Ga0213872_10005058 3300021361 Bacteria 6838
102 Ga0209435_100010 3300025206 Bacteria 475373
103 Ga0209674_100088 3300025226 Bacteria 181554
104 Ga0209563_100160 3300025230 Bacteria 58893
105 Ga0207427_100296 3300025231 Bacteria 34920
106 Ga0209258_100630 3300025242 Bacteria 27864
107 Ga0209258_101241 3300025242 Bacteria 9822
108 Ga0207425_1001861 3300025245 Bacteria 8113
109 Ga0209646_1000001 3300025246 Bacteria 3092932
110 Ga0209646_1000214 3300025246 Bacteria 64093
111 Ga0209026_1000001 3300025250 Bacteria 1228671
112 Ga0209026_1000059 3300025250 Bacteria 226652
113 Ga0209026_1000111 3300025250 Bacteria 140599
114 Ga0209026_1011177 3300025250 Bacteria 1631
115 Ga0209677_100162 3300025253 Bacteria 58923
116 Ga0209677_100226 3300025253 Bacteria 40136
117 Ga0209759_1000001 3300025256 Bacteria 2799452
118 Ga0209759_1000365 3300025256 Bacteria 56836
119 Ga0209759_1001640 3300025256 Bacteria 11816
120 Ga0209759_1009710 3300025256 Bacteria 2886
121 Ga0209129_1000514 3300025258 Bacteria 27663
122 Ga0209565_1000036 3300025263 Bacteria 293334
123 Ga0209455_1000211 3300025272 Bacteria 82660
124 Ga0209455_1000508 3300025272 Bacteria 27836
125 Ga0209455_1002009 3300025272 Bacteria 8341
126 Ga0209673_1000023 3300025273 Bacteria 411385
127 Ga0209673_1000212 3300025273 Bacteria 116031
128 Ga0209673_1000282 3300025273 Bacteria 95013
129 Ga0209673_1001489 3300025273 Bacteria 21798
130 Ga0209673_1017380 3300025273 Bacteria 2652
131 Ga0209130_1000042 3300025284 Bacteria 257581
132 Ga0209130_1000151 3300025284 Bacteria 107021
133 Ga0209675_1000751 3300025291 Bacteria 21867
134 Ga0209676_1000007 3300025292 Bacteria 1029371
135 Ga0209676_1003880 3300025292 Bacteria 8720
136 Ga0209025_1000300 3300025294 Bacteria 110956
137 Ga0209025_1005150 3300025294 Bacteria 10829
138 Ga0209025_1007501 3300025294 Bacteria 8106
139 Ga0209025_1010080 3300025294 Bacteria 6464
140 Ga0209025_1017601 3300025294 Bacteria 4111
141 Ga0209564_1000112 3300025295 Bacteria 211939
142 Ga0209564_1000402 3300025295 Bacteria 76964
143 Ga0209564_1000729 3300025295 Bacteria 46947
144 Ga0209564_1000903 3300025295 Bacteria 38881
145 Ga0209758_1000053 3300025297 Bacteria 337751
146 Ga0209758_1000276 3300025297 Bacteria 102362
147 Ga0209758_1002527 3300025297 Bacteria 18490
148 Ga0209050_1000003 3300025298 Bacteria 1609245
149 Ga0209050_1003577 3300025298 Bacteria 11308
150 Ga0209050_1019396 3300025298 Bacteria 2584
151 Ga0209256_1000001 3300025299 Bacteria 2166974
152 Ga0209256_1000485 3300025299 Bacteria 58920
153 Ga0209256_1000678 3300025299 Bacteria 46016
154 Ga0207426_1000035 3300025302 Bacteria 448327
155 Ga0207426_1000097 3300025302 Bacteria 265930
156 Ga0209051_1000003 3300025303 Bacteria 1609245
157 Ga0209051_1000119 3300025303 Bacteria 148746
158 Ga0209051_1003793 3300025303 Bacteria 9680
159 Ga0209257_1000020 3300025304 Bacteria 773356
160 Ga0207647_10018554 3300025904 Bacteria 4701
161 Ga0207695_10000007 3300025913 Bacteria 1092551
162 Ga0207695_10000408 3300025913 Bacteria 95748
163 Ga0207695_10000517 3300025913 Bacteria 81791
164 Ga0207695_10001526 3300025913 Bacteria 38277
165 Ga0207695_10001623 3300025913 Bacteria 36467
166 Ga0207695_10027940 3300025913 Bacteria 6270
167 Ga0207695_10132564 3300025913 Bacteria 2448
168 Ga0207671_10000031 3300025914 Bacteria 247030
169 Ga0207671_10002583 3300025914 Bacteria 19130
170 Ga0207671_10004557 3300025914 Bacteria 13165
171 Ga0207671_10054116 3300025914 Bacteria 2974
172 Ga0207657_10158558 3300025919 Bacteria 1839
173 Ga0207657_10162860 3300025919 Bacteria 1811
174 Ga0207694_10001589 3300025924 Bacteria 19223
175 Ga0207694_10053688 3300025924 Bacteria 3125
176 Ga0207686_10042748 3300025934 Bacteria 2772
177 Ga0207709_10000074 3300025935 Bacteria 174947
178 Ga0207711_10000720 3300025941 Bacteria 32591
179 Ga0207667_10000082 3300025949 Bacteria 157749
180 Ga0207667_10000806 3300025949 Bacteria 40715
181 Ga0207667_10002183 3300025949 Bacteria 24557
182 Ga0207667_10019766 3300025949 Bacteria 7508
183 Ga0207712_10001934 3300025961 Bacteria 13617
184 Ga0207668_10045273 3300025972 Bacteria 3000
185 Ga0207640_10000018 3300025981 Bacteria 193664
186 Ga0207640_10000579 3300025981 Bacteria 21817
187 Ga0207640_10006220 3300025981 Bacteria 6540
188 Ga0207658_10000056 3300025986 Bacteria 124846
189 Ga0207703_10032449 3300026035 Bacteria 4134
190 Ga0207639_10271618 3300026041 Bacteria 1487
191 Ga0207678_10000590 3300026067 Bacteria 33196
192 Ga0207678_10006028 3300026067 Bacteria 10782
193 Ga0207678_10053822 3300026067 Bacteria 3467
194 Ga0207678_10158486 3300026067 Bacteria 1933
195 Ga0207708_10083830 3300026075 Bacteria 2451
196 Ga0207702_10000170 3300026078 Bacteria 77504
197 Ga0207702_10009865 3300026078 Bacteria 8004
198 Ga0207676_10030246 3300026095 Bacteria 4063
199 Ga0207674_10001067 3300026116 Bacteria 35659
200 Ga0207674_10005021 3300026116 Bacteria 15803
201 Ga0207674_10187773 3300026116 Bacteria 2017
202 Ga0209281_1000005 3300027111 Bacteria 1242284
203 Ga0307517_10000122 3300028786 Bacteria 116429
204 Ga0307515_10000571 3300028794 Bacteria 86938
205 Ga0307515_10045626 3300028794 Bacteria 6726
206 Ga0265324_10001806 3300029957 Bacteria 11625
207 Ga0265325_10054682 3300031241 Bacteria 2043
208 Ga0265316_10027715 3300031344 Bacteria 4684
209 Ga0265316_10159686 3300031344 Bacteria 1686
210 Ga0307513_10000011 3300031456 Bacteria 354929
211 Ga0307513_10008208 3300031456 Bacteria 13394
212 Ga0307513_10064864 3300031456 Bacteria 3845
213 Ga0307513_10085269 3300031456 Bacteria 3242
214 Ga0307408_100080719 3300031548 Bacteria 2430
215 Ga0265313_10004214 3300031595 Bacteria 11149
216 Ga0265313_10004285 3300031595 Bacteria 11046
217 Ga0265313_10038203 3300031595 Bacteria 2393
218 Ga0307508_10006278 3300031616 Bacteria 11192
219 Ga0307514_10001114 3300031649 Bacteria 37486
220 Ga0265314_10065768 3300031711 Bacteria 2448
221 Ga0265342_10005326 3300031712 Bacteria 9848
222 Ga0307406_10078324 3300031901 Bacteria 2189
223 Ga0307412_10000272 3300031911 Bacteria 33000
224 Ga0307409_100014189 3300031995 Bacteria 5167
225 Ga0307416_100030722 3300032002 Bacteria 4034
226 Ga0307415_100058441 3300032126 Bacteria 2655
227 Ga0395900_0149930 3300037418 Bacteria 2383
228 Ga0395898_0036497 3300037466 Bacteria 4880
229 Ga0395905_0029715 3300037471 Bacteria 5151
230 Ga0395901_0010225 3300038443 Bacteria 9505
231 Ga0436361_1143890 3300039447 Bacteria 13239
232 Ga0439436_0000001 3300041404 Bacteria 299341
233 Ga0439465_0000698 3300041413 Bacteria 10311
234 Ga0451791_0110928 3300041451 Bacteria 1260
235 Ga0451833_0091336 3300041491 Bacteria 2791
236 Ga0451851_0374511 3300041507 Bacteria 2769
237 Ga0451853_1630839 3300041512 Bacteria 1361
238 Ga0439449_0020632 3300042007 Bacteria 2468
239 Ga0466972_0030229 3300044658 Bacteria 2667
240 Ga0466982_0000004 3300044672 Bacteria 386724
241 Ga0466966_0059241 3300044684 Bacteria 2418
242 Ga0466961_0057164 3300044693 Bacteria 2484
243 Ga0466971_0001157 3300044719 Bacteria 10969
244 Ga0466968_0010068 3300044735 Bacteria 3654
245 Ga0466968_0024702 3300044735 Bacteria 2457
246 Ga0466960_0031417 3300044901 Bacteria 2450
247 Ga0495638_0000142 3300046460 Bacteria 113893
248 Ga0495650_0005279 3300046471 Bacteria 8459
249 Ga0495605_0005281 3300046474 Bacteria 7539
250 Ga0495605_0099187 3300046474 Bacteria 1341
251 Ga0495639_0073105 3300046475 Bacteria 1587
252 Ga0495585_0093176 3300046492 Bacteria 1620
253 Ga0495607_0030443 3300046501 Bacteria 3314
254 Ga0495583_0021267 3300046506 Bacteria 3342
255 Ga0495606_0003502 3300046507 Bacteria 16624
256 Ga0495606_0022855 3300046507 Bacteria 4543
257 Ga0495606_0050836 3300046507 Bacteria 2708
258 Ga0495610_0000954 3300046512 Bacteria 26782
259 Ga0495610_0041276 3300046512 Bacteria 2317
260 Ga0495616_0024549 3300046513 Bacteria 3232
261 Ga0495620_0032748 3300046515 Bacteria 2365
262 Ga0495632_0087833 3300046519 Bacteria 1477
263 Ga0495654_0000884 3300046530 Bacteria 22400
264 Ga0495597_0016301 3300046542 Bacteria 3509
265 Ga0495633_0002721 3300046558 Bacteria 12257
266 Ga0495668_0006798 3300046616 Bacteria 7433
267 Ga0495611_0012918 3300046648 Bacteria 3550
268 Ga0495625_0002570 3300046660 Bacteria 19495
269 Ga0495625_0080350 3300046660 Bacteria 2271
270 Ga0495588_0085718 3300046674 Bacteria 1647
271 Ga0495670_0000608 3300046691 Bacteria 17106
272 Ga0495670_0024794 3300046691 Bacteria 2965
273 Ga0495672_0018013 3300047320 Bacteria 4703
274 Ga0495686_0000574 3300047472 Bacteria 52228
275 Ga0495686_0009589 3300047472 Bacteria 6959
276 Ga0495686_0018052 3300047472 Bacteria 4741
277 Ga0496100_0032387 3300048903 Bacteria 3260
278 Ga0496101_0123307 3300048904 Bacteria 1961
279 Ga0496102_0002413 3300048905 Bacteria 15959
280 Ga0496104_0315878 3300048907 Bacteria 1475
281 Ga0496105_0013981 3300048908 Bacteria 6384
282 Ga0496107_0177627 3300048910 Bacteria 1581
283 Ga0496110_0224964 3300048913 Bacteria 1706
284 Ga0496115_0027081 3300048918 Bacteria 4480
285 Ga0496116_0144149 3300048919 Bacteria 1334
286 Ga0496117_0002926 3300048920 Bacteria 20663
287 Ga0496117_0052428 3300048920 Bacteria 2873
288 Ga0496117_0068555 3300048920 Bacteria 2394
289 Ga0496118_0000366 3300048921 Bacteria 76070
290 Ga0496118_0000678 3300048921 Bacteria 55390
291 Ga0496118_0001987 3300048921 Bacteria 29053
292 Ga0496118_0009608 3300048921 Bacteria 9736
293 Ga0496118_0059351 3300048921 Bacteria 2849
294 Ga0496119_0000382 3300048922 Bacteria 60994
295 Ga0496119_0009132 3300048922 Bacteria 8579
296 Ga0496119_0011994 3300048922 Bacteria 7095
297 Ga0496120_0000335 3300048923 Bacteria 78595
298 Ga0496120_0000343 3300048923 Bacteria 76966
299 Ga0496121_0000369 3300048924 Bacteria 92541
300 Ga0496121_0005991 3300048924 Bacteria 15357
301 Ga0496121_0083278 3300048924 Bacteria 2525
302 Ga0496121_0129801 3300048924 Bacteria 1888
303 Ga0496121_0156546 3300048924 Bacteria 1671
304 Ga0496121_0179021 3300048924 Bacteria 1532
305 Ga0496122_0000642 3300048925 Bacteria 70999
306 Ga0496122_0025252 3300048925 Bacteria 5166
307 Ga0496122_0027219 3300048925 Bacteria 4895
308 Ga0496123_0000464 3300048926 Bacteria 70999
309 Ga0496123_0050775 3300048926 Bacteria 2768
310 Ga0496123_0128665 3300048926 Bacteria 1408
311 Ga0496124_0000086 3300048927 Bacteria 202844
312 Ga0496124_0013655 3300048927 Bacteria 7916
313 Ga0496125_0000455 3300048928 Bacteria 73934
314 Ga0496125_0000729 3300048928 Bacteria 54486
315 Ga0496125_0014131 3300048928 Bacteria 7790
316 Ga0496125_0018025 3300048928 Bacteria 6712
317 Ga0496125_0165782 3300048928 Bacteria 1493
318 Ga0496126_0000757 3300048929 Bacteria 58502
319 Ga0496126_0013879 3300048929 Bacteria 8172
320 Ga0496126_0032821 3300048929 Bacteria 4887
321 Ga0496126_0088302 3300048929 Bacteria 2731
322 Ga0496126_0169634 3300048929 Bacteria 1860
323 Ga0501031_0009984 3300049568 Bacteria 6184
324 Ga0501032_0064622 3300049569 Bacteria 2449
325 Ga0501032_0113515 3300049569 Bacteria 1792
326 Ga0501033_0020693 3300049570 Bacteria 4971
327 Ga0501033_0071948 3300049570 Bacteria 2540
328 Ga0501033_0078938 3300049570 Bacteria 2415
329 Ga0501033_0140504 3300049570 Bacteria 1746
330 Ga0501034_0145013 3300049571 Bacteria 2352
331 Ga0501034_0174749 3300049571 Bacteria 2114
332 Ga0501034_0185493 3300049571 Bacteria 2044
333 Ga0501034_0227063 3300049571 Bacteria 1817
334 Ga0501036_0106940 3300049572 Bacteria 2366
335 Ga0501036_0143264 3300049572 Bacteria 2016
336 Ga0501036_0306545 3300049572 Bacteria 1328
337 Ga0501037_0148626 3300049573 Bacteria 1675
338 Ga0501038_0027405 3300049574 Bacteria 5069
339 Ga0501038_0044931 3300049574 Bacteria 3836
340 Ga0501038_0199298 3300049574 Bacteria 1607
341 Ga0501043_0173822 3300049579 Bacteria 1680
342 Ga0501046_0108994 3300049580 Bacteria 2117
343 Ga0501046_0122589 3300049580 Bacteria 1977
344 Ga0501047_0070772 3300049581 Bacteria 3358
345 Ga0501047_0116416 3300049581 Bacteria 2554
346 Ga0501048_0107161 3300049582 Bacteria 1973
347 Ga0501070_0092275 3300049586 Bacteria 2506
348 Ga0501073_0061521 3300049589 Bacteria 2620
349 Ga0501073_0199236 3300049589 Bacteria 1385
350 Ga0501080_0059651 3300049742 Bacteria 3550
351 Ga0501080_0301794 3300049742 Bacteria 1452
352 Ga0501083_0087522 3300049744 Bacteria 2060
353 Ga0501044_0031662 3300049823 Bacteria 5565
354 Ga0501044_0052644 3300049823 Bacteria 4193
355 Ga0501044_0135732 3300049823 Bacteria 2451
356 Ga0501044_0209620 3300049823 Bacteria 1903
357 nmdc:mga0k408_91003_c1 3300050493 Bacteria 1792
358 nmdc:mga07m45_32622_c1 3300050496 Bacteria 2888
359 Ga0500610_0018254 3300053079 Bacteria 3387
360 Ga0500578_0167275 3300053086 Bacteria 1361
361 Ga0500643_008875 3300053087 Bacteria 3900
362 Ga0500644_0002764 3300053088 Bacteria 4374
363 Ga0500650_0043679 3300053098 Bacteria 2074
364 Ga0500557_000707 3300053105 Bacteria 4701
365 Ga0500593_000131 3300053117 Bacteria 29789
366 Ga0500594_0000642 3300053118 Bacteria 7452
367 Ga0500597_000256 3300053120 Bacteria 10905
368 Ga0500618_019307 3300053125 Bacteria 1678
369 Ga0500658_0000491 3300053134 Bacteria 16931
370 Ga0500559_0010847 3300053136 Bacteria 3906
371 Ga0500568_0000291 3300053139 Bacteria 41336
372 Ga0500573_0019696 3300053140 Bacteria 3861
373 Ga0500616_0003188 3300053153 Bacteria 12767
374 Ga0500619_000415 3300053154 Bacteria 7709
375 Ga0500645_000397 3300053730 Bacteria 30509
376 Ga0500645_000644 3300053730 Bacteria 22175
377 Ga0500645_009597 3300053730 Bacteria 3243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10130503 rootH2_101305032 362
2 3300003323 rootH1_10005734 rootH1_100057345 362
3 3300031344 Ga0265316_10159686 Ga0265316_101596862 365
4 3300031595 Ga0265313_10004214 Ga0265313_100042149 365
5 3300031712 Ga0265342_10005326 Ga0265342_100053269 365
6 3300005841 Ga0068863_100069231 Ga0068863_1000692312 367
7 3300026095 Ga0207676_10030246 Ga0207676_100302463 367
8 3300053140 Ga0500573_0019696 Ga0500573_0019696_1108_2307 369
9 3300031241 Ga0265325_10054682 Ga0265325_100546822 370
10 3300031595 Ga0265313_10038203 Ga0265313_100382031 370
11 3300044735 Ga0466968_0010068 Ga0466968_0010068_84_1280 371
12 3300048928 Ga0496125_0165782 Ga0496125_0165782_61_1215 372
13 3300049572 Ga0501036_0306545 Ga0501036_0306545_187_1317 375
14 3300049580 Ga0501046_0122589 Ga0501046_0122589_829_1959 375
15 3300031344 Ga0265316_10027715 Ga0265316_100277153 379
16 3300031595 Ga0265313_10004285 Ga0265313_100042854 379
17 3300031711 Ga0265314_10065768 Ga0265314_100657682 379
18 3300046471 Ga0495650_0005279 Ga0495650_0005279_3543_4748 379
19 3300053125 Ga0500618_019307 Ga0500618_019307_89_1306 379
20 3300048910 Ga0496107_0177627 Ga0496107_0177627_23_1222 380
21 3300048913 Ga0496110_0224964 Ga0496110_0224964_370_1575 380
22 3300048924 Ga0496121_0083278 Ga0496121_0083278_23_1222 380
23 3300048925 Ga0496122_0025252 Ga0496122_0025252_127_1326 380
24 3300048926 Ga0496123_0050775 Ga0496123_0050775_1025_2224 380
25 3300048927 Ga0496124_0013655 Ga0496124_0013655_3882_5081 380
26 3300048929 Ga0496126_0088302 Ga0496126_0088302_262_1461 380
27 3300048924 Ga0496121_0156546 Ga0496121_0156546_286_1485 381
28 3300048928 Ga0496125_0000455 Ga0496125_0000455_52361_53560 381
29 3300021361 Ga0213872_10005058 Ga0213872_100050588 382
30 3300025272 Ga0209455_1002009 Ga0209455_10020096 382
31 3300039447 Ga0436361_1143890 Ga0436361_1143890_4594_5796 382
32 3300041451 Ga0451791_0110928 Ga0451791_0110928_45_1247 382
33 3300046558 Ga0495633_0002721 Ga0495633_0002721_439_1635 382
34 3300048926 Ga0496123_0128665 Ga0496123_0128665_33_1229 382
35 3300053088 Ga0500644_0002764 Ga0500644_0002764_2282_3484 382
36 3300053117 Ga0500593_000131 Ga0500593_000131_1700_2914 382
37 3300046507 Ga0495606_0050836 Ga0495606_0050836_1389_2588 384
38 3300048929 Ga0496126_0013879 Ga0496126_0013879_4708_5868 386
39 3300025934 Ga0207686_10042748 Ga0207686_100427482 387
40 3300037418 Ga0395900_0149930 Ga0395900_0149930_687_1892 388
41 iso_pu_bacteria 2508501114 2509077036 388
42 iso_pu_bacteria 2773857925 2774868402 388
43 iso_pu_bacteria 2775506901 2776262598 388
44 iso_pu_bacteria 2835312727 2835313064 388
45 iso_pu_bacteria 2882456835 2882459194 388
46 iso_pu_bacteria 2894232714 2894234866 388
47 iso_pu_bacteria 2894023352 2894024592 389
48 3300048925 Ga0496122_0027219 Ga0496122_0027219_1446_2624 390
49 3300048928 Ga0496125_0000729 Ga0496125_0000729_29898_31076 390
50 3300025273 Ga0209673_1001489 Ga0209673_100148915 391
51 3300025298 Ga0209050_1019396 Ga0209050_10193963 391
52 3300025303 Ga0209051_1000119 Ga0209051_1000119117 391
53 3300005289 Ga0065704_10134648 Ga0065704_101346482 392
54 3300005844 Ga0068862_100198035 Ga0068862_1001980352 392
55 3300009148 Ga0105243_10057611 Ga0105243_100576113 392
56 3300025972 Ga0207668_10045273 Ga0207668_100452732 392
57 3300026075 Ga0207708_10083830 Ga0207708_100838302 392
58 3300031548 Ga0307408_100080719 Ga0307408_1000807192 392
59 3300031901 Ga0307406_10078324 Ga0307406_100783242 392
60 3300031995 Ga0307409_100014189 Ga0307409_1000141894 392
61 3300032002 Ga0307416_100030722 Ga0307416_1000307224 392
62 3300032126 Ga0307415_100058441 Ga0307415_1000584411 392
63 3300037471 Ga0395905_0029715 Ga0395905_0029715_2251_3438 392
64 3300044658 Ga0466972_0030229 Ga0466972_0030229_787_1974 392
65 3300049570 Ga0501033_0140504 Ga0501033_0140504_515_1714 392
66 3300049572 Ga0501036_0143264 Ga0501036_0143264_158_1357 392
67 3300049573 Ga0501037_0148626 Ga0501037_0148626_85_1284 392
68 3300049574 Ga0501038_0027405 Ga0501038_0027405_1032_2231 392
69 3300049589 Ga0501073_0061521 Ga0501073_0061521_812_2011 392
70 3300049742 Ga0501080_0059651 Ga0501080_0059651_931_2130 392
71 3300049823 Ga0501044_0052644 Ga0501044_0052644_1557_2756 392
72 3300031649 Ga0307514_10001114 Ga0307514_100011143 394
73 3300049571 Ga0501034_0145013 Ga0501034_0145013_547_1749 394
74 3300049744 Ga0501083_0087522 Ga0501083_0087522_338_1540 394
75 iso_pu_bacteria 2509276021 2509385798 394
76 iso_pu_bacteria 2509276033 2509448148 394
77 iso_pu_bacteria 2510461076 2510899953 394
78 iso_pu_bacteria 2510461076 2510900549 394
79 iso_pu_bacteria 2513237084 2513569806 394
80 iso_pu_bacteria 2513237085 2513576661 394
81 iso_pu_bacteria 2513237093 2513631657 394
82 iso_pu_bacteria 2513237103 2513710073 394
83 iso_pu_bacteria 2513237144 2513910044 394
84 iso_pu_bacteria 2513237146 2513928778 394
85 iso_pu_bacteria 2513237162 2514021412 394
86 iso_pu_bacteria 2515075009 2515115357 394
87 iso_pu_bacteria 2515154113 2515636086 394
88 iso_pu_bacteria 2515154114 2515644758 394
89 iso_pu_bacteria 2515154116 2515658057 394
90 iso_pu_bacteria 2515154134 2515742220 394
91 iso_pu_bacteria 2516653077 2517041647 394
92 iso_pu_bacteria 2516653085 2517080772 394
93 iso_pu_bacteria 2517093000 2517099100 394
94 iso_pu_bacteria 2517287029 2517410673 394
95 iso_pu_bacteria 2519899620 2520377354 394
96 iso_pu_bacteria 2529292951 2530644865 394
97 iso_pu_bacteria 2582581299 2585228094 394
98 iso_pu_bacteria 2585427526 2585524454 394
99 iso_pu_bacteria 2585427528 2585539055 394
100 iso_pu_bacteria 2585427593 2585837005 394
101 iso_pu_bacteria 2599185170 2599415012 394
102 iso_pu_bacteria 2615840624 2616295049 394
103 iso_pu_bacteria 2643221634 2644191702 394
104 iso_pu_bacteria 2718217882 2719183520 394
105 iso_pu_bacteria 2718217927 2719388264 394
106 iso_pu_bacteria 2718217997 2719667884 394
107 iso_pu_bacteria 2718218009 2719727961 394
108 iso_pu_bacteria 2718218199 2720494647 394
109 iso_pu_bacteria 2718218232 2720610982 394
110 iso_pu_bacteria 2718218233 2720616150 394
111 iso_pu_bacteria 2718218235 2720629231 394
112 iso_pu_bacteria 2718218269 2720771803 394
113 iso_pu_bacteria 2718218363 2721144822 394
114 iso_pu_bacteria 2718218365 2721155561 394
115 iso_pu_bacteria 2718218366 2721166909 394
116 iso_pu_bacteria 2718218423 2721402887 394
117 iso_pu_bacteria 2721755514 2722837887 394
118 iso_pu_bacteria 2721755684 2723562840 394
119 iso_pu_bacteria 2721755685 2723570830 394
120 iso_pu_bacteria 2721755809 2724035244 394
121 iso_pu_bacteria 2721755810 2724042155 394
122 iso_pu_bacteria 2721755819 2724086623 394
123 iso_pu_bacteria 2721755822 2724106781 394
124 iso_pu_bacteria 2724679232 2725945633 394
125 iso_pu_bacteria 2728369365 2730161660 394
126 iso_pu_bacteria 2728369397 2730300668 394
127 iso_pu_bacteria 2738541333 2739033513 394
128 iso_pu_bacteria 2765235942 2766068650 394
129 iso_pu_bacteria 2791355259 2793314859 394
130 iso_pu_bacteria 2791355260 2793321516 394
131 iso_pu_bacteria 2791355261 2793325887 394
132 iso_pu_bacteria 2791355263 2793340313 394
133 iso_pu_bacteria 2791355264 2793345994 394
134 iso_pu_bacteria 2791355265 2793355214 394
135 iso_pu_bacteria 2791355266 2793357964 394
136 iso_pu_bacteria 2791355267 2793366725 394
137 iso_pu_bacteria 2802429605 2805927895 394
138 iso_pu_bacteria 2802429606 2805933742 394
139 iso_pu_bacteria 2802429633 2806044992 394
140 iso_pu_bacteria 2802429634 2806053851 394
141 iso_pu_bacteria 2802429635 2806060057 394
142 iso_pu_bacteria 2802429636 2806065889 394
143 iso_pu_bacteria 2802429637 2806075417 394
144 iso_pu_bacteria 2838016132 2838019300 394
145 iso_pu_bacteria 2838022645 2838026635 394
146 iso_pu_bacteria 2838035591 2838039262 394
147 iso_pu_bacteria 2838048938 2838050365 394
148 iso_pu_bacteria 2838061910 2838063069 394
149 iso_pu_bacteria 2838068647 2838071634 394
150 iso_pu_bacteria 2838661181 2838667628 394
151 iso_pu_bacteria 2838668709 2838673700 394
152 iso_pu_bacteria 2838680041 2838684222 394
153 iso_pu_bacteria 2838686498 2838692259 394
154 iso_pu_bacteria 2838694306 2838699712 394
155 iso_pu_bacteria 2838701080 2838705267 394
156 iso_pu_bacteria 2838707686 2838712002 394
157 iso_pu_bacteria 2838729681 2838734322 394
158 iso_pu_bacteria 2838742623 2838746774 394
159 iso_pu_bacteria 2841851746 2841853465 394
160 iso_pu_bacteria 2841864319 2841869154 394
161 iso_pu_bacteria 2842077413 2842081688 394
162 iso_pu_bacteria 2842110456 2842114616 394
163 iso_pu_bacteria 2842118031 2842122264 394
164 iso_pu_bacteria 2842146304 2842150243 394
165 iso_pu_bacteria 2842156927 2842161450 394
166 iso_pu_bacteria 2842163707 2842167346 394
167 iso_pu_bacteria 2842180545 2842185749 394
168 iso_pu_bacteria 2842192696 2842195486 394
169 iso_pu_bacteria 2842198810 2842202238 394
170 iso_pu_bacteria 2842205361 2842210523 394
171 iso_pu_bacteria 2842217011 2842223103 394
172 iso_pu_bacteria 2842229732 2842234080 394
173 iso_pu_bacteria 2842237096 2842241414 394
174 iso_pu_bacteria 2842243621 2842246381 394
175 iso_pu_bacteria 2842250916 2842254929 394
176 iso_pu_bacteria 2842257432 2842260759 394
177 iso_pu_bacteria 2842264693 2842269344 394
178 iso_pu_bacteria 2842271015 2842276048 394
179 iso_pu_bacteria 2842278818 2842283977 394
180 iso_pu_bacteria 2842285085 2842289857 394
181 iso_pu_bacteria 2842291075 2842295344 394
182 iso_pu_bacteria 2842304105 2842308633 394
183 iso_pu_bacteria 2842311132 2842311964 394
184 iso_pu_bacteria 2842317721 2842319248 394
185 iso_pu_bacteria 2842341865 2842344304 394
186 iso_pu_bacteria 2842363717 2842368210 394
187 iso_pu_bacteria 2842370503 2842375887 394
188 iso_pu_bacteria 2842377471 2842381881 394
189 iso_pu_bacteria 2842384541 2842388813 394
190 iso_pu_bacteria 2842395702 2842396698 394
191 iso_pu_bacteria 2842402390 2842407003 394
192 iso_pu_bacteria 2842409023 2842413895 394
193 iso_pu_bacteria 2842415677 2842420537 394
194 iso_pu_bacteria 2842422224 2842425267 394
195 iso_pu_bacteria 2842428310 2842432699 394
196 iso_pu_bacteria 2842434925 2842438853 394
197 iso_pu_bacteria 2842441272 2842445483 394
198 iso_pu_bacteria 2842447887 2842449937 394
199 iso_pu_bacteria 2842462802 2842467728 394
200 iso_pu_bacteria 2842469257 2842473468 394
201 iso_pu_bacteria 2842489311 2842491694 394
202 iso_pu_bacteria 2842495871 2842502086 394
203 iso_pu_bacteria 2842918807 2842919290 394
204 iso_pu_bacteria 2844454524 2844460812 394
205 iso_pu_bacteria 2857516855 2857519487 394
206 iso_pu_bacteria 2933016740 2933017121 394
207 iso_pu_bacteria 2933570622 2933575236 394
208 iso_pu_bacteria 2933586486 2933590528 394
209 iso_pu_bacteria 2933599457 2933602433 394
210 iso_pu_bacteria 2935894831 2935898437 394
211 iso_pu_bacteria 2935901341 2935906870 394
212 iso_pu_bacteria 2936367885 2936370462 394
213 iso_pu_bacteria 2936375103 2936378127 394
214 iso_pu_bacteria 2936381700 2936385455 394
215 iso_pu_bacteria 2996893221 2996896730 394
216 iso_pu_bacteria 3005409236 3005413649 394
217 iso_pu_bacteria 639633055 639651366 394
218 iso_pu_bacteria 8005275841 8005276979 394
219 iso_pu_bacteria 8005282627 8005288006 394
220 iso_pu_bacteria 8005289223 8005289444 394
221 iso_pu_bacteria 8005301065 8005305225 394
222 iso_pu_bacteria 8005307578 8005313327 394
223 iso_pu_bacteria 8005376324 8005382136 394
224 iso_pu_bacteria 8005382845 8005388616 394
225 iso_pu_bacteria 8005395548 8005398022 394
226 iso_pu_bacteria 8005430974 8005431297 394
227 iso_pu_bacteria 8005460587 8005466582 394
228 iso_pu_bacteria 8005497431 8005503294 394
229 iso_pu_bacteria 8005556819 8005561960 394
230 iso_pu_bacteria 8005563573 8005567300 394
231 iso_pu_bacteria 8005619151 8005625435 394
232 iso_pu_bacteria 8005626139 8005630417 394
233 iso_pu_bacteria 8005668836 8005674812 394
234 iso_pu_bacteria 8005688590 8005689247 394
235 iso_pu_bacteria 8005695170 8005696885 394
236 iso_pu_bacteria 8018127388 8018127758 394
237 iso_pu_bacteria 8018163183 8018166188 394
238 iso_pu_bacteria 8018176218 8018182916 394
239 iso_pu_bacteria 8023680758 8023688353 394
240 iso_pu_bacteria 8024479707 8024483988 394
241 iso_pu_bacteria 8024501048 8024503978 394
242 iso_pu_bacteria 8056375014 8056375347 394
243 iso_pu_bacteria 8056382006 8056383124 394
244 iso_pu_bacteria 8057874678 8057880807 394
245 3300003761 Ga0055535_1000641 Ga0055535_100064121 395
246 3300003763 Ga0055529_1000602 Ga0055529_10006027 395
247 3300009093 Ga0105240_10009760 Ga0105240_100097603 395
248 3300009545 Ga0105237_10000105 Ga0105237_1000010587 395
249 3300009551 Ga0105238_10052076 Ga0105238_100520763 395
250 3300025242 Ga0209258_100630 Ga0209258_10063022 395
251 3300025256 Ga0209759_1001640 Ga0209759_10016405 395
252 3300025272 Ga0209455_1000508 Ga0209455_100050822 395
253 3300025904 Ga0207647_10018554 Ga0207647_100185544 395
254 3300025913 Ga0207695_10001623 Ga0207695_1000162314 395
255 3300025914 Ga0207671_10004557 Ga0207671_100045579 395
256 3300037466 Ga0395898_0036497 Ga0395898_0036497_880_2070 395
257 3300038443 Ga0395901_0010225 Ga0395901_0010225_1407_2597 395
258 3300046460 Ga0495638_0000142 Ga0495638_0000142_70140_71408 395
259 3300046507 Ga0495606_0003502 Ga0495606_0003502_6800_8020 395
260 3300048924 Ga0496121_0129801 Ga0496121_0129801_544_1764 395
261 3300049579 Ga0501043_0173822 Ga0501043_0173822_286_1518 395
262 iso_pu_bacteria 2643221651 2644287738 395
263 iso_pu_bacteria 2884298095 2884298741 395
264 3300005577 Ga0068857_100051962 Ga0068857_1000519624 396
265 3300026116 Ga0207674_10187773 Ga0207674_101877731 396
266 3300029957 Ga0265324_10001806 Ga0265324_100018063 396
267 iso_pu_bacteria 2511231002 2511247211 396
268 iso_pu_bacteria 2939631187 2939633451 396
269 iso_pu_bacteria 2953994433 2953998262 396
270 3300005563 Ga0068855_100015586 Ga0068855_1000155864 397
271 3300025949 Ga0207667_10002183 Ga0207667_100021833 397
272 3300028786 Ga0307517_10000122 Ga0307517_1000012273 397
273 3300031616 Ga0307508_10006278 Ga0307508_100062787 397
274 3300046660 Ga0495625_0080350 Ga0495625_0080350_663_1871 397
275 3300048903 Ga0496100_0032387 Ga0496100_0032387_1105_2298 397
276 3300048929 Ga0496126_0169634 Ga0496126_0169634_432_1664 397
277 3300002738 JGI25154J39366_1001790 JGI25154J39366_10017903 398
278 3300002741 JGI25157J39369_1000135 JGI25157J39369_100013529 398
279 3300003187 JGI25151J46595_10000274 JGI25151J46595_100002746 398
280 3300003215 JGI25153J46596_10000480 JGI25153J46596_1000048012 398
281 3300003215 JGI25153J46596_10001740 JGI25153J46596_100017406 398
282 3300003354 JGI25160J50197_1000494 JGI25160J50197_10004946 398
283 3300003374 JGI25161J50226_1005788 JGI25161J50226_10057881 398
284 3300003756 Ga0055533_1000172 Ga0055533_100017224 398
285 3300003759 Ga0055525_1001042 Ga0055525_10010423 398
286 3300003771 Ga0055526_1001782 Ga0055526_10017827 398
287 3300003771 Ga0055526_1005662 Ga0055526_10056622 398
288 3300003775 Ga0055524_1005911 Ga0055524_10059112 398
289 3300003775 Ga0055524_1011941 Ga0055524_10119414 398
290 3300003790 Ga0055528_1000511 Ga0055528_100051112 398
291 3300003790 Ga0055528_1003441 Ga0055528_10034411 398
292 3300003790 Ga0055528_1020245 Ga0055528_10202452 398
293 3300003792 Ga0055540_1004378 Ga0055540_10043785 398
294 3300004625 Ga0055543_1001641 Ga0055543_10016416 398
295 3300005262 Ga0065165_1014130 Ga0065165_10141302 398
296 3300005539 Ga0068853_100405412 Ga0068853_1004054121 398
297 3300005578 Ga0068854_100007140 Ga0068854_1000071403 398
298 3300005614 Ga0068856_100004917 Ga0068856_1000049178 398
299 3300006038 Ga0075365_10015292 Ga0075365_100152923 398
300 3300006177 Ga0075362_10006704 Ga0075362_100067045 398
301 3300006178 Ga0075367_10035768 Ga0075367_100357682 398
302 3300006195 Ga0075366_10104946 Ga0075366_101049462 398
303 3300009174 Ga0105241_10129443 Ga0105241_101294432 398
304 3300009545 Ga0105237_10073419 Ga0105237_100734192 398
305 3300009551 Ga0105238_10079574 Ga0105238_100795744 398
306 3300014497 Ga0182008_10024609 Ga0182008_100246093 398
307 3300015261 Ga0182006_1000246 Ga0182006_10002465 398
308 3300015265 Ga0182005_1004217 Ga0182005_10042174 398
309 3300025226 Ga0209674_100088 Ga0209674_10008830 398
310 3300025230 Ga0209563_100160 Ga0209563_10016030 398
311 3300025231 Ga0207427_100296 Ga0207427_10029631 398
312 3300025242 Ga0209258_101241 Ga0209258_1012415 398
313 3300025246 Ga0209646_1000214 Ga0209646_100021429 398
314 3300025250 Ga0209026_1000059 Ga0209026_1000059176 398
315 3300025253 Ga0209677_100162 Ga0209677_10016230 398
316 3300025253 Ga0209677_100226 Ga0209677_1002268 398
317 3300025256 Ga0209759_1000365 Ga0209759_100036529 398
318 3300025258 Ga0209129_1000514 Ga0209129_10005148 398
319 3300025273 Ga0209673_1000023 Ga0209673_100002388 398
320 3300025273 Ga0209673_1000212 Ga0209673_100021230 398
321 3300025273 Ga0209673_1017380 Ga0209673_10173801 398
322 3300025294 Ga0209025_1000300 Ga0209025_100030030 398
323 3300025295 Ga0209564_1000112 Ga0209564_1000112105 398
324 3300025295 Ga0209564_1000402 Ga0209564_100040230 398
325 3300025297 Ga0209758_1000053 Ga0209758_1000053302 398
326 3300025297 Ga0209758_1002527 Ga0209758_10025279 398
327 3300025299 Ga0209256_1000485 Ga0209256_100048513 398
328 3300025299 Ga0209256_1000678 Ga0209256_10006789 398
329 3300025302 Ga0207426_1000035 Ga0207426_1000035389 398
330 3300025303 Ga0209051_1003793 Ga0209051_10037937 398
331 3300025919 Ga0207657_10158558 Ga0207657_101585582 398
332 3300025919 Ga0207657_10162860 Ga0207657_101628602 398
333 3300025949 Ga0207667_10019766 Ga0207667_100197664 398
334 3300025981 Ga0207640_10006220 Ga0207640_100062203 398
335 3300026041 Ga0207639_10271618 Ga0207639_102716181 398
336 3300026078 Ga0207702_10009865 Ga0207702_100098655 398
337 3300026116 Ga0207674_10005021 Ga0207674_100050212 398
338 3300028794 Ga0307515_10045626 Ga0307515_100456264 398
339 3300031456 Ga0307513_10085269 Ga0307513_100852693 398
340 3300031911 Ga0307412_10000272 Ga0307412_1000027212 398
341 3300041404 Ga0439436_0000001 Ga0439436_0000001_226516_227712 398
342 3300041491 Ga0451833_0091336 Ga0451833_0091336_303_1502 398
343 3300041507 Ga0451851_0374511 Ga0451851_0374511_222_1421 398
344 3300041512 Ga0451853_1630839 Ga0451853_1630839_33_1232 398
345 3300042007 Ga0439449_0020632 Ga0439449_0020632_1050_2249 398
346 3300046474 Ga0495605_0005281 Ga0495605_0005281_5381_6580 398
347 3300046474 Ga0495605_0099187 Ga0495605_0099187_66_1265 398
348 3300046492 Ga0495585_0093176 Ga0495585_0093176_390_1589 398
349 3300046501 Ga0495607_0030443 Ga0495607_0030443_2023_3222 398
350 3300046506 Ga0495583_0021267 Ga0495583_0021267_312_1511 398
351 3300046507 Ga0495606_0022855 Ga0495606_0022855_2963_4162 398
352 3300046512 Ga0495610_0000954 Ga0495610_0000954_22797_23993 398
353 3300046512 Ga0495610_0041276 Ga0495610_0041276_740_1939 398
354 3300046513 Ga0495616_0024549 Ga0495616_0024549_64_1263 398
355 3300046515 Ga0495620_0032748 Ga0495620_0032748_390_1589 398
356 3300046519 Ga0495632_0087833 Ga0495632_0087833_43_1242 398
357 3300046542 Ga0495597_0016301 Ga0495597_0016301_1846_3045 398
358 3300046616 Ga0495668_0006798 Ga0495668_0006798_154_1353 398
359 3300046648 Ga0495611_0012918 Ga0495611_0012918_767_1966 398
360 3300046660 Ga0495625_0002570 Ga0495625_0002570_12345_13544 398
361 3300046674 Ga0495588_0085718 Ga0495588_0085718_431_1630 398
362 3300046691 Ga0495670_0000608 Ga0495670_0000608_7934_9130 398
363 3300046691 Ga0495670_0024794 Ga0495670_0024794_1189_2388 398
364 3300047320 Ga0495672_0018013 Ga0495672_0018013_1118_2317 398
365 3300047472 Ga0495686_0009589 Ga0495686_0009589_75_1274 398
366 3300048920 Ga0496117_0052428 Ga0496117_0052428_93_1292 398
367 3300048920 Ga0496117_0068555 Ga0496117_0068555_998_2197 398
368 3300048921 Ga0496118_0000366 Ga0496118_0000366_59485_60684 398
369 3300048921 Ga0496118_0000678 Ga0496118_0000678_5856_7055 398
370 3300048922 Ga0496119_0009132 Ga0496119_0009132_4336_5532 398
371 3300049571 Ga0501034_0227063 Ga0501034_0227063_350_1573 398
372 3300050493 nmdc:mga0k408_91003_c1 nmdc:mga0k408_91003_c1_324_1523 398
373 3300050496 nmdc:mga07m45_32622_c1 nmdc:mga07m45_32622_c1_1309_2508 398
374 3300053079 Ga0500610_0018254 Ga0500610_0018254_1730_2929 398
375 3300053086 Ga0500578_0167275 Ga0500578_0167275_62_1261 398
376 3300053098 Ga0500650_0043679 Ga0500650_0043679_618_1817 398
377 3300053105 Ga0500557_000707 Ga0500557_000707_3343_4542 398
378 3300053118 Ga0500594_0000642 Ga0500594_0000642_5977_7176 398
379 3300053134 Ga0500658_0000491 Ga0500658_0000491_8411_9610 398
380 3300053139 Ga0500568_0000291 Ga0500568_0000291_22614_23813 398
381 3300053153 Ga0500616_0003188 Ga0500616_0003188_6744_7943 398
382 3300049571 Ga0501034_0174749 Ga0501034_0174749_835_2079 399
383 3300049572 Ga0501036_0106940 Ga0501036_0106940_267_1511 399
384 3300049574 Ga0501038_0044931 Ga0501038_0044931_1544_2788 399
385 3300049586 Ga0501070_0092275 Ga0501070_0092275_76_1311 399
386 3300049589 Ga0501073_0199236 Ga0501073_0199236_104_1339 399
387 3300049823 Ga0501044_0209620 Ga0501044_0209620_603_1847 399
388 3300002704 JGI25155J39150_1000098 JGI25155J39150_100009834 400
389 3300002705 JGI25156J39149_1000163 JGI25156J39149_100016334 400
390 3300002738 JGI25154J39366_1000183 JGI25154J39366_100018334 400
391 3300002741 JGI25157J39369_1000209 JGI25157J39369_100020916 400
392 3300002774 JGI25150J39212_1008450 JGI25150J39212_10084501 400
393 3300002987 JGI25159J45721_1000271 JGI25159J45721_100027111 400
394 3300003354 JGI25160J50197_1000212 JGI25160J50197_100021213 400
395 3300003374 JGI25161J50226_1000151 JGI25161J50226_100015113 400
396 3300003771 Ga0055526_1002394 Ga0055526_10023943 400
397 3300003773 Ga0055537_1011344 Ga0055537_10113442 400
398 3300003775 Ga0055524_1000082 Ga0055524_1000082102 400
399 3300003784 Ga0055534_1001660 Ga0055534_10016603 400
400 3300003790 Ga0055528_1002493 Ga0055528_10024936 400
401 3300003792 Ga0055540_1000010 Ga0055540_1000010255 400
402 3300003794 Ga0055531_10001298 Ga0055531_100012988 400
403 3300004625 Ga0055543_1000394 Ga0055543_10003946 400
404 3300005262 Ga0065165_1010503 Ga0065165_10105034 400
405 3300005455 Ga0070663_100043673 Ga0070663_1000436733 400
406 3300005455 Ga0070663_100184805 Ga0070663_1001848052 400
407 3300005466 Ga0070685_10001154 Ga0070685_100011543 400
408 3300005614 Ga0068856_100000116 Ga0068856_10000011628 400
409 3300006177 Ga0075362_10064246 Ga0075362_100642462 400
410 3300006195 Ga0075366_10018038 Ga0075366_100180383 400
411 3300006946 Ga0079104_1000011 Ga0079104_1000011210 400
412 3300006946 Ga0079104_1005385 Ga0079104_10053855 400
413 3300009092 Ga0105250_10011200 Ga0105250_100112003 400
414 3300009093 Ga0105240_10000668 Ga0105240_1000066810 400
415 3300009148 Ga0105243_10001827 Ga0105243_1000182711 400
416 3300009545 Ga0105237_10058676 Ga0105237_100586764 400
417 3300009551 Ga0105238_10002261 Ga0105238_100022615 400
418 3300013104 Ga0157370_10162439 Ga0157370_101624392 400
419 3300013297 Ga0157378_10048640 Ga0157378_100486401 400
420 3300025206 Ga0209435_100010 Ga0209435_100010397 400
421 3300025245 Ga0207425_1001861 Ga0207425_10018612 400
422 3300025246 Ga0209646_1000001 Ga0209646_10000011745 400
423 3300025250 Ga0209026_1000001 Ga0209026_1000001399 400
424 3300025250 Ga0209026_1000111 Ga0209026_100011130 400
425 3300025256 Ga0209759_1000001 Ga0209759_10000011376 400
426 3300025256 Ga0209759_1009710 Ga0209759_10097101 400
427 3300025263 Ga0209565_1000036 Ga0209565_1000036104 400
428 3300025272 Ga0209455_1000211 Ga0209455_100021116 400
429 3300025273 Ga0209673_1000282 Ga0209673_100028214 400
430 3300025284 Ga0209130_1000042 Ga0209130_1000042133 400
431 3300025284 Ga0209130_1000151 Ga0209130_100015194 400
432 3300025291 Ga0209675_1000751 Ga0209675_100075114 400
433 3300025292 Ga0209676_1000007 Ga0209676_1000007281 400
434 3300025292 Ga0209676_1003880 Ga0209676_10038804 400
435 3300025294 Ga0209025_1005150 Ga0209025_10051507 400
436 3300025294 Ga0209025_1007501 Ga0209025_10075015 400
437 3300025294 Ga0209025_1010080 Ga0209025_10100805 400
438 3300025294 Ga0209025_1017601 Ga0209025_10176012 400
439 3300025295 Ga0209564_1000729 Ga0209564_100072933 400
440 3300025295 Ga0209564_1000903 Ga0209564_10009038 400
441 3300025298 Ga0209050_1000003 Ga0209050_10000031227 400
442 3300025298 Ga0209050_1003577 Ga0209050_10035775 400
443 3300025299 Ga0209256_1000001 Ga0209256_10000011231 400
444 3300025302 Ga0207426_1000097 Ga0207426_1000097139 400
445 3300025303 Ga0209051_1000003 Ga0209051_10000031227 400
446 3300025304 Ga0209257_1000020 Ga0209257_1000020281 400
447 3300025913 Ga0207695_10000007 Ga0207695_10000007805 400
448 3300025914 Ga0207671_10054116 Ga0207671_100541162 400
449 3300025924 Ga0207694_10001589 Ga0207694_100015895 400
450 3300025924 Ga0207694_10053688 Ga0207694_100536883 400
451 3300025935 Ga0207709_10000074 Ga0207709_1000007495 400
452 3300026067 Ga0207678_10006028 Ga0207678_1000602812 400
453 3300026067 Ga0207678_10158486 Ga0207678_101584862 400
454 3300026078 Ga0207702_10000170 Ga0207702_100001706 400
455 3300027111 Ga0209281_1000005 Ga0209281_1000005731 400
456 3300028794 Ga0307515_10000571 Ga0307515_1000057138 400
457 3300031456 Ga0307513_10000011 Ga0307513_10000011154 400
458 3300031456 Ga0307513_10008208 Ga0307513_1000820813 400
459 3300031456 Ga0307513_10064864 Ga0307513_100648642 400
460 3300041413 Ga0439465_0000698 Ga0439465_0000698_4403_5608 400
461 3300046475 Ga0495639_0073105 Ga0495639_0073105_117_1322 400
462 3300046530 Ga0495654_0000884 Ga0495654_0000884_9010_10212 400
463 3300048905 Ga0496102_0002413 Ga0496102_0002413_5448_6662 400
464 3300048921 Ga0496118_0009608 Ga0496118_0009608_1055_2257 400
465 3300048924 Ga0496121_0005991 Ga0496121_0005991_11367_12629 400
466 3300048927 Ga0496124_0000086 Ga0496124_0000086_113118_114380 400
467 3300048928 Ga0496125_0014131 Ga0496125_0014131_6383_7645 400
468 3300049568 Ga0501031_0009984 Ga0501031_0009984_4570_5787 400
469 3300049569 Ga0501032_0064622 Ga0501032_0064622_236_1441 400
470 3300049569 Ga0501032_0113515 Ga0501032_0113515_364_1581 400
471 3300049570 Ga0501033_0020693 Ga0501033_0020693_3171_4517 400
472 3300049570 Ga0501033_0071948 Ga0501033_0071948_650_1867 400
473 3300049570 Ga0501033_0078938 Ga0501033_0078938_56_1261 400
474 3300049571 Ga0501034_0185493 Ga0501034_0185493_265_1470 400
475 3300049574 Ga0501038_0199298 Ga0501038_0199298_367_1584 400
476 3300049580 Ga0501046_0108994 Ga0501046_0108994_103_1320 400
477 3300049581 Ga0501047_0070772 Ga0501047_0070772_654_1871 400
478 3300049581 Ga0501047_0116416 Ga0501047_0116416_526_1743 400
479 3300049582 Ga0501048_0107161 Ga0501048_0107161_413_1618 400
480 3300049742 Ga0501080_0301794 Ga0501080_0301794_155_1360 400
481 3300049823 Ga0501044_0031662 Ga0501044_0031662_3277_4494 400
482 3300049823 Ga0501044_0135732 Ga0501044_0135732_849_2066 400
483 3300053136 Ga0500559_0010847 Ga0500559_0010847_1892_3106 400
484 3300053730 Ga0500645_000397 Ga0500645_000397_23546_24748 400
485 3300053730 Ga0500645_000644 Ga0500645_000644_12394_13605 400
486 iso_pu_bacteria 2721755523 2722884051 400
487 iso_pu_bacteria 2932422444 2932422603 400
488 3300003320 rootH2_10015358 rootH2_100153586 401
489 3300009093 Ga0105240_10000254 Ga0105240_1000025460 401
490 3300009093 Ga0105240_10000385 Ga0105240_1000038522 401
491 3300010375 Ga0105239_10000030 Ga0105239_1000003022 401
492 3300025913 Ga0207695_10000517 Ga0207695_1000051721 401
493 3300025913 Ga0207695_10001526 Ga0207695_100015267 401
494 3300048904 Ga0496101_0123307 Ga0496101_0123307_27_1235 401
495 3300048907 Ga0496104_0315878 Ga0496104_0315878_224_1435 401
496 3300048908 Ga0496105_0013981 Ga0496105_0013981_135_1346 401
497 3300048918 Ga0496115_0027081 Ga0496115_0027081_315_1523 401
498 3300048919 Ga0496116_0144149 Ga0496116_0144149_111_1322 401
499 3300048920 Ga0496117_0002926 Ga0496117_0002926_1312_2523 401
500 3300048921 Ga0496118_0001987 Ga0496118_0001987_6009_7217 401
501 3300048921 Ga0496118_0059351 Ga0496118_0059351_1440_2651 401
502 3300048922 Ga0496119_0000382 Ga0496119_0000382_59708_60919 401
503 3300048922 Ga0496119_0011994 Ga0496119_0011994_4976_6187 401
504 3300048923 Ga0496120_0000335 Ga0496120_0000335_49636_50847 401
505 3300048923 Ga0496120_0000343 Ga0496120_0000343_66_1277 401
506 3300048924 Ga0496121_0000369 Ga0496121_0000369_39489_40700 401
507 3300048924 Ga0496121_0179021 Ga0496121_0179021_285_1496 401
508 3300048929 Ga0496126_0000757 Ga0496126_0000757_52428_53636 401
509 3300048929 Ga0496126_0032821 Ga0496126_0032821_1890_3101 401
510 3300053154 Ga0500619_000415 Ga0500619_000415_6178_7389 401
511 3300001979 JGI24740J21852_10000890 JGI24740J21852_100008903 402
512 3300001989 JGI24739J22299_10004216 JGI24739J22299_100042167 402
513 3300001990 JGI24737J22298_10026654 JGI24737J22298_100266541 402
514 3300003316 rootH1_10040789 rootH1_100407896 402
515 3300003322 rootL2_10123658 rootL2_101236583 402
516 3300003578 Ga0006562J51391_1027984 Ga0006562J51391_10279841 402
517 3300003578 Ga0006562J51391_1027986 Ga0006562J51391_10279864 402
518 3300005367 Ga0070667_100000183 Ga0070667_10000018319 402
519 3300005455 Ga0070663_100000125 Ga0070663_1000001254 402
520 3300005563 Ga0068855_100029391 Ga0068855_1000293919 402
521 3300005577 Ga0068857_100002648 Ga0068857_10000264816 402
522 3300005578 Ga0068854_100001124 Ga0068854_10000112410 402
523 3300005842 Ga0068858_100037754 Ga0068858_1000377543 402
524 3300009093 Ga0105240_10002661 Ga0105240_100026612 402
525 3300009093 Ga0105240_10088882 Ga0105240_100888824 402
526 3300009177 Ga0105248_10000209 Ga0105248_1000020948 402
527 3300009545 Ga0105237_10000876 Ga0105237_1000087611 402
528 3300009553 Ga0105249_10000601 Ga0105249_1000060132 402
529 3300010375 Ga0105239_10144458 Ga0105239_101444581 402
530 3300025250 Ga0209026_1011177 Ga0209026_10111771 402
531 3300025297 Ga0209758_1000276 Ga0209758_100027622 402
532 3300025913 Ga0207695_10000408 Ga0207695_1000040821 402
533 3300025913 Ga0207695_10027940 Ga0207695_100279407 402
534 3300025913 Ga0207695_10132564 Ga0207695_101325641 402
535 3300025914 Ga0207671_10000031 Ga0207671_1000003144 402
536 3300025914 Ga0207671_10002583 Ga0207671_100025835 402
537 3300025941 Ga0207711_10000720 Ga0207711_1000072023 402
538 3300025949 Ga0207667_10000082 Ga0207667_1000008269 402
539 3300025949 Ga0207667_10000806 Ga0207667_1000080644 402
540 3300025961 Ga0207712_10001934 Ga0207712_1000193413 402
541 3300025981 Ga0207640_10000018 Ga0207640_1000001882 402
542 3300025981 Ga0207640_10000579 Ga0207640_100005797 402
543 3300025986 Ga0207658_10000056 Ga0207658_1000005668 402
544 3300026035 Ga0207703_10032449 Ga0207703_100324493 402
545 3300026067 Ga0207678_10000590 Ga0207678_1000059024 402
546 3300026067 Ga0207678_10053822 Ga0207678_100538222 402
547 3300026116 Ga0207674_10001067 Ga0207674_1000106711 402
548 3300044672 Ga0466982_0000004 Ga0466982_0000004_99773_100993 402
549 3300044684 Ga0466966_0059241 Ga0466966_0059241_1068_2288 402
550 3300044693 Ga0466961_0057164 Ga0466961_0057164_14_1234 402
551 3300044719 Ga0466971_0001157 Ga0466971_0001157_725_1945 402
552 3300044735 Ga0466968_0024702 Ga0466968_0024702_1181_2401 402
553 3300044901 Ga0466960_0031417 Ga0466960_0031417_751_1971 402
554 3300047472 Ga0495686_0000574 Ga0495686_0000574_12572_13792 402
555 3300047472 Ga0495686_0018052 Ga0495686_0018052_295_1536 402
556 3300048925 Ga0496122_0000642 Ga0496122_0000642_57804_59045 402
557 3300048926 Ga0496123_0000464 Ga0496123_0000464_11955_13196 402
558 3300048928 Ga0496125_0018025 Ga0496125_0018025_4147_5355 402
559 3300053087 Ga0500643_008875 Ga0500643_008875_1640_2881 402
560 3300053120 Ga0500597_000256 Ga0500597_000256_6557_7798 402
561 3300053730 Ga0500645_009597 Ga0500645_009597_935_2143 402

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

81

234

0.94

PF07690

MFS_1

Major Facilitator Superfamily

55

400

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6euq-assembly1.cif.gz_A mdfa(q131r/l339e) 0.9295 7 389
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.9277 1 389
6vs2-assembly1.cif.gz_A protein d 0.9261 5 389
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.9209 1 389
6euq-assembly1.cif.gz_A mdfa(q131r/l339e) 0.9203 7 389
ID Description Score Start End Superfamily
af_P28246_11_389_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.9682 9 385 1.20.1720.10
af_P28246_11_389_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.9582 9 385 1.20.1720.10
af_Q2G2I3_14_312_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9475 9 297 1.20.1250.20
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9457 11 185 1.20.1250.20
af_Q2FVI5_15_392_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.9423 9 385 1.20.1720.10
ID Description Score Start End GO Terms
AF-C4WF17-F1-model_v4 Bcr/CflA family efflux transporter 0.9922 1 390 GO:0005886
GO:0042910
GO:1990961
AF-M5JWB5-F1-model_v4 Bcr/CflA family efflux transporter 0.992 1 390 GO:0005886
GO:0042910
GO:1990961
AF-A0A0R0MFL3-F1-model_v4 Bcr/CflA family efflux transporter 0.9916 1 391 GO:0005886
GO:0015385
GO:0042910
GO:1990961
AF-A0A0R0MFL3-F1-model_v4 Bcr/CflA family efflux transporter 0.9891 1 391 GO:0005886
GO:0015385
GO:0042910
GO:1990961
AF-A0A2U0TDC5-F1-model_v4 deleted 0.9887 1 390

Feature Viewer

pLDDT pTM Quality
88.25 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map