F463822

General Info

Members Datasets Scaffolds Average Seq Length
561 263 1122 204

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10657583|Ga0157372_106575833
Length 198
Sequence MTQIFDPETGAVTPVTVVEAGPCPVVRVKTVESDGYEAVQVAFGAVDKRRVTKARLGQLGDAGPHRRLVEFRGPSELTPGETVTVEAFEPGERIKVSGIGSGKGFAGTIKRHNFSRGPKTHGSHNVRAPGSIGASATPARVRKGIRMAGRMGGKRFTQVGLTVHDVDAERNLVLIKGAVPGPRNGSVEIREDKGRGGA

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.01
Metatranscriptomes 4.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 10.87
Rhizosphere 88.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10657583 3300013307 Bacteria 1220
2 Ga0058863_10020367 3300004799 Bacteria 962
3 Ga0070658_10368964 3300005327 Bacteria 1230
4 Ga0070658_10853417 3300005327 Bacteria 791
5 Ga0070683_100095159 3300005329 Bacteria 2800
6 Ga0070680_100040374 3300005336 Bacteria 3778
7 Ga0070680_100249198 3300005336 Bacteria 1501
8 Ga0070680_100264532 3300005336 Bacteria 1455
9 Ga0070680_100479270 3300005336 Bacteria 1063
10 Ga0070680_100584140 3300005336 Bacteria 958
11 Ga0070682_100197918 3300005337 Bacteria 1415
12 Ga0070682_100346903 3300005337 Bacteria 1105
13 Ga0068868_100757997 3300005338 Bacteria 873
14 Ga0070660_100030868 3300005339 Bacteria 4021
15 Ga0070660_100061092 3300005339 Bacteria 2925
16 Ga0070660_100093346 3300005339 Bacteria 2376
17 Ga0070660_100111951 3300005339 Bacteria 2172
18 Ga0070660_100507480 3300005339 Bacteria 1004
19 Ga0070660_100634158 3300005339 Bacteria 894
20 Ga0070691_10257230 3300005341 Bacteria 939
21 Ga0070691_10266957 3300005341 Bacteria 923
22 Ga0070661_100036270 3300005344 Bacteria 3584
23 Ga0070661_100087407 3300005344 Bacteria 2305
24 Ga0070671_100179297 3300005355 Bacteria 1793
25 Ga0070674_100115432 3300005356 Bacteria 1979
26 Ga0070659_100064189 3300005366 Bacteria 2906
27 Ga0070659_100157166 3300005366 Bacteria 1857
28 Ga0070667_100034531 3300005367 Bacteria 4232
29 Ga0070714_100134786 3300005435 Bacteria 2210
30 Ga0070711_100176717 3300005439 Bacteria 1631
31 Ga0070711_100272273 3300005439 Bacteria 1336
32 Ga0070708_100072514 3300005445 Bacteria 3103
33 Ga0070663_100401545 3300005455 Bacteria 1120
34 Ga0070663_101048556 3300005455 Bacteria 711
35 Ga0070678_100898555 3300005456 Bacteria 809
36 Ga0070681_10063242 3300005458 Bacteria 3673
37 Ga0070681_10243095 3300005458 Bacteria 1713
38 Ga0070681_10292600 3300005458 Bacteria 1538
39 Ga0070681_10489030 3300005458 Bacteria 1143
40 Ga0070681_10584895 3300005458 Bacteria 1030
41 Ga0070679_100066883 3300005530 Bacteria 3583
42 Ga0070679_100077300 3300005530 Bacteria 3317
43 Ga0070679_100091020 3300005530 Bacteria 3038
44 Ga0070679_100114573 3300005530 Bacteria 2681
45 Ga0070679_100161324 3300005530 Bacteria 2216
46 Ga0070679_100220524 3300005530 Bacteria 1857
47 Ga0070679_100401973 3300005530 Bacteria 1316
48 Ga0070679_100456480 3300005530 Bacteria 1222
49 Ga0070679_100532527 3300005530 Bacteria 1118
50 Ga0070684_100043943 3300005535 Bacteria 3861
51 Ga0070684_100088491 3300005535 Bacteria 2751
52 Ga0070684_100336974 3300005535 Bacteria 1386
53 Ga0070696_100288701 3300005546 Bacteria 1252
54 Ga0070665_100234003 3300005548 Bacteria 1837
55 Ga0068855_100138502 3300005563 Bacteria 2775
56 Ga0068855_100204730 3300005563 Bacteria 2220
57 Ga0068855_100228145 3300005563 Bacteria 2086
58 Ga0068855_100624690 3300005563 Bacteria 1160
59 Ga0070664_100429753 3300005564 Bacteria 1210
60 Ga0068857_100578960 3300005577 Bacteria 1059
61 Ga0068856_100758202 3300005614 Bacteria 990
62 Ga0068852_100053060 3300005616 Bacteria 3488
63 Ga0068852_100239338 3300005616 Bacteria 1734
64 Ga0081455_10060937 3300005937 Bacteria 3178
65 Ga0070717_10292110 3300006028 Bacteria 1447
66 Ga0070717_10293733 3300006028 Bacteria 1443
67 Ga0075365_10292296 3300006038 Bacteria 1146
68 Ga0070712_100049042 3300006175 Bacteria 2930
69 Ga0070712_100075712 3300006175 Bacteria 2421
70 Ga0070712_100187299 3300006175 Bacteria 1617
71 Ga0075433_10112179 3300006852 Bacteria 2419
72 Ga0075433_10144220 3300006852 Bacteria 2117
73 Ga0075434_100094550 3300006871 Bacteria 2994
74 Ga0075435_100027531 3300007076 Bacteria 4448
75 Ga0105240_10171319 3300009093 Bacteria 2571
76 Ga0105240_10931283 3300009093 Bacteria 933
77 Ga0111539_10493475 3300009094 Bacteria 1426
78 Ga0105245_10331695 3300009098 Bacteria 1502
79 Ga0105245_10856512 3300009098 Bacteria 949
80 Ga0114129_10821939 3300009147 Bacteria 1184
81 Ga0105243_10082615 3300009148 Bacteria 2626
82 Ga0105241_10571579 3300009174 Bacteria 1018
83 Ga0105242_10265040 3300009176 Bacteria 1554
84 Ga0105248_10346926 3300009177 Bacteria 1671
85 Ga0105237_10064717 3300009545 Bacteria 3652
86 Ga0105237_10211769 3300009545 Bacteria 1938
87 Ga0105238_10112359 3300009551 Bacteria 2704
88 Ga0105238_10131720 3300009551 Bacteria 2479
89 Ga0105238_10729224 3300009551 Bacteria 1004
90 Ga0105239_10856675 3300010375 Bacteria 1042
91 Ga0105239_11474001 3300010375 Bacteria 786
92 Ga0105246_10364221 3300011119 Bacteria 1189
93 Ga0157370_10057577 3300013104 Bacteria 3695
94 Ga0157370_10455332 3300013104 Bacteria 1176
95 Ga0157370_10742962 3300013104 Bacteria 894
96 Ga0157369_10230308 3300013105 Bacteria 1937
97 Ga0157369_10355880 3300013105 Bacteria 1520
98 Ga0157369_10502955 3300013105 Bacteria 1254
99 Ga0157372_10104802 3300013307 Bacteria 3234
100 Ga0157372_10363200 3300013307 Bacteria 1687
101 Ga0157375_10060387 3300013308 Bacteria 3759
102 Ga0157375_10458320 3300013308 Bacteria 1440
103 Ga0182008_10033214 3300014497 Bacteria 2590
104 Ga0197907_10041333 3300020069 Bacteria 2533
105 Ga0197907_10078274 3300020069 Bacteria 993
106 Ga0197907_10514735 3300020069 Bacteria 857
107 Ga0206356_10503468 3300020070 Bacteria 1190
108 Ga0206356_11190128 3300020070 Bacteria 1585
109 Ga0206356_11688529 3300020070 Bacteria 2342
110 Ga0206352_11164402 3300020078 Bacteria 1090
111 Ga0206350_10659759 3300020080 Bacteria 1056
112 Ga0206354_10131682 3300020081 Bacteria 1259
113 Ga0206354_11330624 3300020081 Bacteria 1731
114 Ga0206354_11709488 3300020081 Bacteria 1293
115 Ga0206353_10512868 3300020082 Bacteria 827
116 Ga0206353_10901896 3300020082 Bacteria 2349
117 Ga0213876_10056781 3300021384 Bacteria 2067
118 Ga0224712_10025815 3300022467 Bacteria 2069
119 Ga0207647_10336237 3300025904 Bacteria 856
120 Ga0207705_10013304 3300025909 Bacteria 5938
121 Ga0207705_10029214 3300025909 Bacteria 3930
122 Ga0207705_10037144 3300025909 Bacteria 3485
123 Ga0207654_10185239 3300025911 Bacteria 1361
124 Ga0207707_10017724 3300025912 Bacteria 6212
125 Ga0207707_10020910 3300025912 Bacteria 5716
126 Ga0207707_10395862 3300025912 Bacteria 1186
127 Ga0207707_10408250 3300025912 Bacteria 1165
128 Ga0207695_10279798 3300025913 Bacteria 1562
129 Ga0207671_10091125 3300025914 Bacteria 2297
130 Ga0207671_10227708 3300025914 Bacteria 1462
131 Ga0207693_10087381 3300025915 Bacteria 2443
132 Ga0207693_10195401 3300025915 Bacteria 1592
133 Ga0207693_10846268 3300025915 Bacteria 704
134 Ga0207663_10336949 3300025916 Bacteria 1138
135 Ga0207663_10853707 3300025916 Bacteria 727
136 Ga0207660_10120253 3300025917 Bacteria 1988
137 Ga0207660_10189137 3300025917 Bacteria 1602
138 Ga0207660_10223498 3300025917 Bacteria 1478
139 Ga0207660_10236018 3300025917 Bacteria 1439
140 Ga0207657_10045230 3300025919 Bacteria 3865
141 Ga0207657_10348688 3300025919 Bacteria 1168
142 Ga0207649_10060107 3300025920 Bacteria 2387
143 Ga0207649_10220264 3300025920 Bacteria 1351
144 Ga0207652_10018676 3300025921 Bacteria 5689
145 Ga0207652_10108390 3300025921 Bacteria 2461
146 Ga0207652_10338790 3300025921 Bacteria 1357
147 Ga0207652_10475099 3300025921 Bacteria 1126
148 Ga0207687_10394461 3300025927 Bacteria 1137
149 Ga0207664_10588326 3300025929 Bacteria 999
150 Ga0207644_10032993 3300025931 Bacteria 3616
151 Ga0207686_10095285 3300025934 Bacteria 1975
152 Ga0207669_10310103 3300025937 Bacteria 1203
153 Ga0207665_10408957 3300025939 Bacteria 1035
154 Ga0207661_10204991 3300025944 Bacteria 1735
155 Ga0207661_10337009 3300025944 Bacteria 1358
156 Ga0207661_10404387 3300025944 Bacteria 1238
157 Ga0207661_10758868 3300025944 Bacteria 893
158 Ga0207667_10022223 3300025949 Bacteria 7012
159 Ga0207667_10437256 3300025949 Bacteria 1330
160 Ga0207667_10766557 3300025949 Bacteria 963
161 Ga0207667_10920797 3300025949 Bacteria 865
162 Ga0207640_10225231 3300025981 Bacteria 1438
163 Ga0207658_10025319 3300025986 Bacteria 4154
164 Ga0207639_10306675 3300026041 Bacteria 1405
165 Ga0207678_10115589 3300026067 Bacteria 2289
166 Ga0207678_10121434 3300026067 Bacteria 2230
167 Ga0207702_10884423 3300026078 Bacteria 885
168 Ga0207648_10862127 3300026089 Bacteria 845
169 Ga0207674_10501387 3300026116 Bacteria 1173
170 Ga0207674_10549353 3300026116 Bacteria 1116
171 Ga0207698_10022316 3300026142 Bacteria 4395
172 Ga0207698_10660359 3300026142 Bacteria 1037
173 Ga0268266_10634985 3300028379 Bacteria 1027
174 Ga0265319_1008145 3300028563 Bacteria 4624
175 Ga0265319_1153302 3300028563 Bacteria 713
176 Ga0265318_10002190 3300028577 Bacteria 10568
177 Ga0265318_10125961 3300028577 Bacteria 942
178 Ga0265322_10004220 3300028654 Bacteria 4301
179 Ga0265336_10124329 3300028666 Bacteria 768
180 Ga0265338_10004174 3300028800 Bacteria 19716
181 Ga0265338_10038128 3300028800 Bacteria 4559
182 Ga0265338_10123946 3300028800 Bacteria 2054
183 Ga0265332_10138186 3300031238 Bacteria 1021
184 Ga0265328_10077675 3300031239 Bacteria 1223
185 Ga0265325_10090227 3300031241 Bacteria 1512
186 Ga0265340_10030967 3300031247 Bacteria 2678
187 Ga0265340_10060332 3300031247 Bacteria 1817
188 Ga0265339_10053229 3300031249 Bacteria 2202
189 Ga0265327_10099359 3300031251 Bacteria 1407
190 Ga0265316_10019031 3300031344 Bacteria 5886
191 Ga0307408_100408343 3300031548 Bacteria 1168
192 Ga0307408_100609324 3300031548 Bacteria 971
193 Ga0307408_101252180 3300031548 Bacteria 694
194 Ga0265313_10003963 3300031595 Bacteria 11630
195 Ga0265314_10100305 3300031711 Bacteria 1862
196 Ga0265314_10277273 3300031711 Bacteria 950
197 Ga0265314_10433223 3300031711 Bacteria 704
198 Ga0265342_10035581 3300031712 Bacteria 3047
199 Ga0307405_10770256 3300031731 Bacteria 803
200 Ga0307413_10024576 3300031824 Bacteria 3287
201 Ga0307410_10077552 3300031852 Bacteria 2323
202 Ga0307406_10182677 3300031901 Bacteria 1528
203 Ga0307406_10568018 3300031901 Bacteria 930
204 Ga0307412_10099531 3300031911 Bacteria 2053
205 Ga0307416_100609721 3300032002 Bacteria 1172
206 Ga0307415_100071974 3300032126 Bacteria 2433
207 Ga0307415_100366325 3300032126 Bacteria 1219
208 Ga0307415_100407594 3300032126 Bacteria 1163
209 Ga0373926_0018045 3300035083 Bacteria 2425
210 Ga0373944_0009800 3300035089 Bacteria 2604
211 Ga0373936_0054332 3300035113 Bacteria 1625
212 Ga0373945_0010432 3300035116 Bacteria 3059
213 Ga0373945_0092462 3300035116 Bacteria 1173
214 Ga0373953_0010913 3300035117 Bacteria 3175
215 Ga0373954_0157555 3300035118 Bacteria 1110
216 Ga0373957_0058982 3300035120 Bacteria 1484
217 Ga0373957_0371515 3300035120 Bacteria 613
218 Ga0373943_0003051 3300035170 Bacteria 7605
219 Ga0373943_0042932 3300035170 Bacteria 2193
220 Ga0373943_0281994 3300035170 Bacteria 940
221 Ga0373946_0022627 3300035171 Bacteria 2448
222 Ga0373946_0071595 3300035171 Bacteria 1499
223 Ga0373955_0203786 3300035172 Bacteria 1178
224 Ga0373924_0058440 3300035410 Bacteria 1610
225 Ga0373935_0014714 3300035692 Bacteria 4722
226 Ga0373935_0071933 3300035692 Bacteria 2232
227 Ga0373927_0077418 3300035695 Bacteria 2154
228 Ga0373927_0188212 3300035695 Bacteria 1354
229 Ga0373933_0061946 3300035724 Bacteria 2258
230 Ga0373947_0003670 3300035725 Bacteria 9058
231 Ga0373947_0023692 3300035725 Bacteria 3573
232 Ga0373947_0050927 3300035725 Bacteria 2490
233 Ga0373947_0316463 3300035725 Bacteria 1043
234 Ga0373925_0001927 3300037068 Bacteria 17180
235 Ga0373925_0038494 3300037068 Bacteria 3536
236 Ga0373925_0465147 3300037068 Bacteria 1037
237 Ga0395899_0048412 3300037312 Bacteria 3163
238 Ga0395899_0114620 3300037312 Bacteria 1935
239 Ga0395900_0065979 3300037418 Bacteria 3719
240 Ga0395900_0111344 3300037418 Bacteria 2812
241 Ga0395900_0176249 3300037418 Bacteria 2174
242 Ga0395900_0202415 3300037418 Bacteria 2008
243 Ga0395900_0276158 3300037418 Bacteria 1674
244 Ga0395900_0425409 3300037418 Bacteria 1288
245 Ga0395900_0485940 3300037418 Bacteria 1187
246 Ga0395900_0608418 3300037418 Bacteria 1033
247 Ga0395900_0627291 3300037418 Bacteria 1013
248 Ga0395900_1001835 3300037418 Bacteria 755
249 Ga0395900_1080322 3300037418 Bacteria 720
250 Ga0395898_0011468 3300037466 Bacteria 9204
251 Ga0395898_0127884 3300037466 Bacteria 2434
252 Ga0395898_0168235 3300037466 Bacteria 2095
253 Ga0395898_0215198 3300037466 Bacteria 1833
254 Ga0395898_0267195 3300037466 Bacteria 1631
255 Ga0395898_0336726 3300037466 Bacteria 1439
256 Ga0395898_0532108 3300037466 Bacteria 1117
257 Ga0395898_0728143 3300037466 Bacteria 933
258 Ga0395905_0059050 3300037471 Bacteria 3586
259 Ga0395905_0294703 3300037471 Bacteria 1509
260 Ga0395905_0316434 3300037471 Bacteria 1450
261 Ga0395905_0847145 3300037471 Bacteria 817
262 Ga0436364_1197349 3300037853 Bacteria 1923
263 Ga0395901_0002305 3300038443 Bacteria 19452
264 Ga0395901_0043388 3300038443 Bacteria 4665
265 Ga0395901_0082086 3300038443 Bacteria 3367
266 Ga0395901_0175135 3300038443 Bacteria 2250
267 Ga0395901_0497505 3300038443 Bacteria 1241
268 Ga0395901_0743910 3300038443 Bacteria 974
269 Ga0436365_1409002 3300039437 Bacteria 1085
270 Ga0436360_0785050 3300039438 Bacteria 2595
271 Ga0436360_1309909 3300039438 Bacteria 831
272 Ga0436363_1321101 3300039450 Bacteria 1674
273 Ga0436362_0807812 3300039453 Bacteria 2874
274 Ga0439448_0097098 3300042005 Bacteria 999
275 Ga0439464_0085371 3300042439 Bacteria 947
276 Ga0466969_0107321 3300044656 Bacteria 1309
277 Ga0466972_0177400 3300044658 Bacteria 999
278 Ga0466965_0207400 3300044683 Bacteria 1041
279 Ga0466966_0160532 3300044684 Bacteria 1368
280 Ga0466966_0251608 3300044684 Bacteria 1064
281 Ga0466966_0360234 3300044684 Bacteria 874
282 Ga0466966_0426075 3300044684 Bacteria 797
283 Ga0466961_0004222 3300044693 Bacteria 8993
284 Ga0466961_0021563 3300044693 Bacteria 4145
285 Ga0466961_0176249 3300044693 Bacteria 1328
286 Ga0466963_0002146 3300044694 Bacteria 10913
287 Ga0466963_0016884 3300044694 Bacteria 4546
288 Ga0466963_0053628 3300044694 Bacteria 2677
289 Ga0466963_0099665 3300044694 Bacteria 1987
290 Ga0466963_0286670 3300044694 Bacteria 1157
291 Ga0466963_0629834 3300044694 Bacteria 757
292 Ga0466964_0019033 3300044706 Bacteria 2638
293 Ga0466964_0019511 3300044706 Bacteria 2605
294 Ga0466964_0020457 3300044706 Bacteria 2549
295 Ga0466964_0057880 3300044706 Bacteria 1605
296 Ga0466964_0163863 3300044706 Bacteria 1041
297 Ga0466968_0029093 3300044735 Bacteria 2283
298 Ga0466968_0032425 3300044735 Bacteria 2173
299 Ga0466968_0267478 3300044735 Bacteria 815
300 Ga0466970_0104760 3300044765 Bacteria 1542
301 Ga0466957_0002423 3300044842 Bacteria 10015
302 Ga0466957_0128329 3300044842 Bacteria 1622
303 Ga0466957_0276177 3300044842 Bacteria 1123
304 Ga0466960_0351435 3300044901 Bacteria 841
305 Ga0466959_0145240 3300045049 Bacteria 1674
306 Ga0466959_0287998 3300045049 Bacteria 1126
307 Ga0466959_0356202 3300045049 Bacteria 997
308 Ga0466959_0380757 3300045049 Bacteria 960
309 Ga0466959_0395096 3300045049 Bacteria 940
310 Ga0451576_0413169 3300045051 Bacteria 1415
311 Ga0466958_0011053 3300045836 Bacteria 5074
312 Ga0466958_0102068 3300045836 Bacteria 1784
313 Ga0466958_0159053 3300045836 Bacteria 1426
314 Ga0466958_0624644 3300045836 Bacteria 701
315 Ga0466967_0041992 3300045976 Bacteria 3948
316 Ga0466967_0106280 3300045976 Bacteria 2572
317 Ga0466967_0135865 3300045976 Bacteria 2286
318 Ga0466967_0165245 3300045976 Bacteria 2079
319 Ga0466967_0245796 3300045976 Bacteria 1707
320 Ga0466967_0327176 3300045976 Bacteria 1479
321 Ga0466967_0340127 3300045976 Bacteria 1451
322 Ga0466967_0419194 3300045976 Bacteria 1304
323 Ga0466967_0445592 3300045976 Bacteria 1265
324 Ga0466967_0454549 3300045976 Bacteria 1252
325 Ga0466967_0549674 3300045976 Bacteria 1136
326 Ga0466967_0733313 3300045976 Bacteria 979
327 Ga0466967_1187085 3300045976 Bacteria 760
328 Ga0495592_0083588 3300046454 Bacteria 2305
329 Ga0495592_0199882 3300046454 Bacteria 1350
330 Ga0495629_0003111 3300046459 Bacteria 12583
331 Ga0495629_0018686 3300046459 Bacteria 4955
332 Ga0495629_0163976 3300046459 Bacteria 1543
333 Ga0495641_0005595 3300046461 Bacteria 8413
334 Ga0495651_0040316 3300046462 Bacteria 3632
335 Ga0495651_0143247 3300046462 Bacteria 1730
336 Ga0495653_0080723 3300046463 Bacteria 2405
337 Ga0495653_0099561 3300046463 Bacteria 2109
338 Ga0495653_0482740 3300046463 Bacteria 775
339 Ga0495580_0092752 3300046472 Bacteria 2102
340 Ga0495582_0001042 3300046473 Bacteria 15551
341 Ga0495582_0158926 3300046473 Bacteria 1285
342 Ga0495605_0094704 3300046474 Bacteria 1379
343 Ga0495639_0000659 3300046475 Bacteria 15963
344 Ga0495639_0036144 3300046475 Bacteria 2211
345 Ga0495662_0013107 3300046476 Bacteria 4037
346 Ga0495664_0019228 3300046477 Bacteria 3925
347 Ga0495664_0137344 3300046477 Bacteria 1481
348 Ga0495584_0016012 3300046491 Bacteria 3827
349 Ga0495608_0001775 3300046511 Bacteria 15412
350 Ga0495608_0032301 3300046511 Bacteria 3538
351 Ga0495628_0042660 3300046516 Bacteria 3617
352 Ga0495628_0146222 3300046516 Bacteria 1802
353 Ga0495628_0514090 3300046516 Bacteria 863
354 Ga0495630_0021343 3300046517 Bacteria 4782
355 Ga0495630_0162444 3300046517 Bacteria 1700
356 Ga0495630_0167682 3300046517 Bacteria 1672
357 Ga0495630_0628145 3300046517 Bacteria 823
358 Ga0495644_0071619 3300046523 Bacteria 1303
359 Ga0495666_0019220 3300046526 Bacteria 3393
360 Ga0495652_0066022 3300046529 Bacteria 3038
361 Ga0495652_0226187 3300046529 Bacteria 1402
362 Ga0495652_0296504 3300046529 Bacteria 1177
363 Ga0495652_0423739 3300046529 Bacteria 937
364 Ga0495665_0001383 3300046531 Bacteria 12998
365 Ga0495665_0126708 3300046531 Bacteria 1337
366 Ga0495640_0003882 3300046533 Bacteria 11962
367 Ga0495640_0104912 3300046533 Bacteria 1852
368 Ga0495640_0203513 3300046533 Bacteria 1254
369 Ga0495640_0302306 3300046533 Bacteria 993
370 Ga0495586_0009444 3300046535 Bacteria 5191
371 Ga0495586_0250019 3300046535 Bacteria 1011
372 Ga0495587_0034355 3300046536 Bacteria 3058
373 Ga0495587_0070974 3300046536 Bacteria 2026
374 Ga0495645_0127473 3300046543 Bacteria 1787
375 Ga0495667_0021446 3300046559 Bacteria 4359
376 Ga0495667_0230604 3300046559 Bacteria 1180
377 Ga0495667_0575711 3300046559 Bacteria 702
378 Ga0495634_0030492 3300046642 Bacteria 3723
379 Ga0495634_0130933 3300046642 Bacteria 1599
380 Ga0495635_0024980 3300046663 Bacteria 4163
381 Ga0495635_0058878 3300046663 Bacteria 2642
382 Ga0495635_0159590 3300046663 Bacteria 1534
383 Ga0495659_0071386 3300046664 Bacteria 1301
384 Ga0495588_0037146 3300046674 Bacteria 2474
385 Ga0495657_0014241 3300046675 Bacteria 5843
386 Ga0495657_0147778 3300046675 Bacteria 1461
387 Ga0495657_0201433 3300046675 Bacteria 1213
388 Ga0495599_0106758 3300046678 Bacteria 1745
389 Ga0495646_0128008 3300046680 Bacteria 1432
390 Ga0495647_0015559 3300046681 Bacteria 2667
391 Ga0495658_0001453 3300046683 Bacteria 12469
392 Ga0495658_0014164 3300046683 Bacteria 4068
393 Ga0495658_0072334 3300046683 Bacteria 2005
394 Ga0495669_0202491 3300046684 Bacteria 949
395 Ga0495613_0037957 3300046689 Bacteria 3571
396 Ga0495613_0051821 3300046689 Bacteria 3024
397 Ga0495613_0138547 3300046689 Bacteria 1739
398 Ga0495613_0234973 3300046689 Bacteria 1283
399 Ga0495613_0664440 3300046689 Bacteria 688
400 Ga0495624_0011405 3300046690 Bacteria 6106
401 Ga0495624_0108818 3300046690 Bacteria 1705
402 Ga0495624_0309337 3300046690 Bacteria 952
403 Ga0495670_0364191 3300046691 Bacteria 779
404 Ga0495600_0036020 3300046809 Bacteria 3215
405 Ga0495600_0103473 3300046809 Bacteria 1855
406 Ga0495600_0191095 3300046809 Bacteria 1317
407 Ga0495581_0003962 3300047315 Bacteria 8530
408 Ga0495604_0098481 3300047317 Bacteria 2154
409 Ga0495604_0470157 3300047317 Bacteria 819
410 Ga0495674_0011281 3300047319 Bacteria 8436
411 Ga0495674_0110334 3300047319 Bacteria 2333
412 Ga0495674_0141228 3300047319 Bacteria 2024
413 Ga0495674_0322801 3300047319 Bacteria 1257
414 Ga0495676_0015831 3300047321 Bacteria 6703
415 Ga0495676_0081260 3300047321 Bacteria 2457
416 Ga0495676_0675793 3300047321 Bacteria 669
417 Ga0495680_0004202 3300047322 Bacteria 13826
418 Ga0495680_0016961 3300047322 Bacteria 6236
419 Ga0495680_0091809 3300047322 Bacteria 2276
420 Ga0495680_0092674 3300047322 Bacteria 2262
421 Ga0495680_0485700 3300047322 Bacteria 840
422 Ga0495680_0613317 3300047322 Bacteria 727
423 Ga0495675_0210456 3300047444 Bacteria 1181
424 Ga0495675_0229515 3300047444 Bacteria 1121
425 Ga0495675_0470848 3300047444 Bacteria 724
426 Ga0495684_0044889 3300047471 Bacteria 3382
427 Ga0495684_0141096 3300047471 Bacteria 1806
428 Ga0495684_0192226 3300047471 Bacteria 1508
429 Ga0495593_0015905 3300047673 Bacteria 4250
430 Ga0495593_0212159 3300047673 Bacteria 972
431 Ga0495602_0021873 3300048088 Bacteria 6278
432 Ga0495602_0145408 3300048088 Bacteria 1871
433 Ga0495614_0010011 3300048089 Bacteria 4186
434 Ga0495614_0140512 3300048089 Bacteria 1073
435 Ga0496100_0001629 3300048903 Bacteria 11110
436 Ga0496100_0063470 3300048903 Bacteria 2441
437 Ga0496100_0168987 3300048903 Bacteria 1573
438 Ga0496100_0970659 3300048903 Bacteria 668
439 Ga0496101_0006287 3300048904 Bacteria 7647
440 Ga0496101_0226806 3300048904 Bacteria 1451
441 Ga0496101_0272151 3300048904 Bacteria 1322
442 Ga0496101_0784604 3300048904 Bacteria 751
443 Ga0496101_1136877 3300048904 Bacteria 613
444 Ga0496102_0012038 3300048905 Bacteria 7476
445 Ga0496102_0041439 3300048905 Bacteria 4169
446 Ga0496102_1373156 3300048905 Bacteria 626
447 Ga0496103_0095009 3300048906 Bacteria 1884
448 Ga0496104_0044390 3300048907 Bacteria 4176
449 Ga0496104_0138734 3300048907 Bacteria 2337
450 Ga0496104_0348179 3300048907 Bacteria 1394
451 Ga0496104_0528624 3300048907 Bacteria 1090
452 Ga0496104_0637326 3300048907 Bacteria 975
453 Ga0496104_0709900 3300048907 Bacteria 913
454 Ga0496104_0742955 3300048907 Bacteria 888
455 Ga0496105_0003457 3300048908 Bacteria 11687
456 Ga0496105_0122783 3300048908 Bacteria 2141
457 Ga0496105_0274019 3300048908 Bacteria 1362
458 Ga0496105_0294348 3300048908 Bacteria 1306
459 Ga0496106_0023466 3300048909 Bacteria 4583
460 Ga0496106_0040118 3300048909 Bacteria 3505
461 Ga0496106_0193546 3300048909 Bacteria 1617
462 Ga0496106_0297574 3300048909 Bacteria 1294
463 Ga0496107_0012081 3300048910 Bacteria 6022
464 Ga0496107_0019364 3300048910 Bacteria 4801
465 Ga0496107_0024809 3300048910 Bacteria 4243
466 Ga0496107_0122299 3300048910 Bacteria 1918
467 Ga0496107_0414272 3300048910 Bacteria 1002
468 Ga0496108_0010786 3300048911 Bacteria 7416
469 Ga0496108_0088819 3300048911 Bacteria 2626
470 Ga0496108_0111525 3300048911 Bacteria 2340
471 Ga0496108_0169935 3300048911 Bacteria 1886
472 Ga0496109_0007432 3300048912 Bacteria 9275
473 Ga0496110_0038139 3300048913 Bacteria 4179
474 Ga0496110_0244713 3300048913 Bacteria 1632
475 Ga0496110_0281443 3300048913 Bacteria 1514
476 Ga0496110_0321100 3300048913 Bacteria 1410
477 Ga0496111_0064352 3300048914 Bacteria 2660
478 Ga0496111_0591154 3300048914 Bacteria 813
479 Ga0496112_0159440 3300048915 Bacteria 2222
480 Ga0496112_0216953 3300048915 Bacteria 1869
481 Ga0496112_0312113 3300048915 Bacteria 1517
482 Ga0496112_0369088 3300048915 Bacteria 1377
483 Ga0496112_0720051 3300048915 Bacteria 925
484 Ga0496113_0040087 3300048916 Bacteria 3450
485 Ga0496113_0396854 3300048916 Bacteria 1107
486 Ga0496114_0006470 3300048917 Bacteria 9232
487 Ga0496114_0050391 3300048917 Bacteria 3465
488 Ga0496114_0059182 3300048917 Bacteria 3200
489 Ga0496114_0309106 3300048917 Bacteria 1396
490 Ga0496114_0859688 3300048917 Bacteria 787
491 Ga0496114_0879718 3300048917 Bacteria 776
492 Ga0496115_0005162 3300048918 Bacteria 9499
493 Ga0496115_0083607 3300048918 Bacteria 2602
494 Ga0496115_0262128 3300048918 Bacteria 1421
495 Ga0496115_0414767 3300048918 Bacteria 1091
496 Ga0501306_009104 3300049127 Bacteria 1225
497 Ga0501031_0686252 3300049568 Bacteria 658
498 Ga0501036_0439144 3300049572 Bacteria 1088
499 Ga0501040_0127326 3300049576 Bacteria 1789
500 Ga0501043_0564932 3300049579 Bacteria 844
501 Ga0501046_0298642 3300049580 Bacteria 1177
502 Ga0501047_0046149 3300049581 Bacteria 4211
503 Ga0501047_0421313 3300049581 Bacteria 1166
504 Ga0501047_0656613 3300049581 Bacteria 868
505 Ga0501067_0040805 3300049583 Bacteria 2577
506 Ga0501067_0064058 3300049583 Bacteria 2036
507 Ga0501067_0140963 3300049583 Bacteria 1342
508 Ga0501068_0238293 3300049584 Bacteria 1158
509 Ga0501069_0161570 3300049585 Bacteria 1290
510 Ga0501070_0201710 3300049586 Bacteria 1633
511 Ga0501070_0724099 3300049586 Bacteria 785
512 Ga0501072_0277722 3300049588 Bacteria 1333
513 Ga0501074_0079710 3300049590 Bacteria 2349
514 Ga0501077_0106529 3300049593 Bacteria 1776
515 Ga0501079_0320097 3300049741 Bacteria 1214
516 Ga0501080_0132927 3300049742 Bacteria 2303
517 Ga0501080_0142901 3300049742 Bacteria 2212
518 Ga0501081_0260204 3300049743 Bacteria 1268
519 Ga0501035_0315282 3300049822 Bacteria 1315
520 Ga0501035_0496173 3300049822 Bacteria 1005
521 Ga0501044_0297681 3300049823 Bacteria 1543
522 Ga0501044_0535425 3300049823 Bacteria 1070
523 Ga0501044_0873493 3300049823 Bacteria 775
524 Ga0501045_0124958 3300049824 Bacteria 1911
525 nmdc:mga08y16_310496_c1 3300050511 Bacteria 1624
526 nmdc:mga0n895_54812_c1 3300050512 Bacteria 3923
527 nmdc:mga0rr50_358017_c1 3300050513 Bacteria 1228
528 nmdc:mga0rr50_66441_c1 3300050513 Bacteria 2736
529 nmdc:mga0a205_178135_c1 3300050515 Bacteria 2021
530 nmdc:mga0a205_465787_c1 3300050515 Bacteria 1123
531 Ga0495601_0025629 3300053077 Bacteria 3637
532 Ga0495601_0185415 3300053077 Bacteria 1360
533 Ga0495601_0201860 3300053077 Bacteria 1299
534 Ga0495601_0266070 3300053077 Bacteria 1119
535 Ga0495601_0337637 3300053077 Bacteria 980
536 Ga0495612_0025956 3300053078 Bacteria 2354
537 Ga0495655_0253951 3300053083 Bacteria 592
538 Ga0495595_0027663 3300053084 Bacteria 2527
539 Ga0495595_0034907 3300053084 Bacteria 2277
540 Ga0495595_0190393 3300053084 Bacteria 1019
541 Ga0495619_0006091 3300053085 Bacteria 7637
542 Ga0495619_0053195 3300053085 Bacteria 2677
543 Ga0495619_0054686 3300053085 Bacteria 2642
544 Ga0495619_0356556 3300053085 Bacteria 1011
545 Ga0587084_024129 3300059477 Bacteria 933
546 Ga0587066_026283 3300059490 Bacteria 1005
547 Ga0587073_0030893 3300059492 Bacteria 1105
548 Ga0587082_040117 3300059504 Bacteria 855
549 Ga0587083_0043321 3300059505 Bacteria 952
550 Ga0587085_016846 3300059506 Bacteria 1063
551 Ga0587088_046296 3300059508 Bacteria 837
552 Ga0587091_035515 3300059511 Bacteria 958
553 Ga0587122_014903 3300059628 Bacteria 789
554 Ga0587075_034721 3300059644 Bacteria 820
555 Ga0587079_043477 3300059647 Bacteria 917
556 Ga0587107_064538 3300059652 Bacteria 654
557 Ga0501082_0488812 3300060353 Bacteria 1076
558 Ga0466962_0003007 3300061719 Bacteria 8036
559 Ga0530510_0123473 3300061734 Bacteria 1902
560 Ga0530510_0500867 3300061734 Bacteria 921
561 Ga0530510_0540287 3300061734 Bacteria 885
562 Ga0157372_10657583
563 Ga0058863_10020367
564 Ga0070658_10368964
565 Ga0070658_10853417
566 Ga0070683_100095159
567 Ga0070680_100040374
568 Ga0070680_100249198
569 Ga0070680_100264532
570 Ga0070680_100479270
571 Ga0070680_100584140
572 Ga0070682_100197918
573 Ga0070682_100346903
574 Ga0068868_100757997
575 Ga0070660_100030868
576 Ga0070660_100061092
577 Ga0070660_100093346
578 Ga0070660_100111951
579 Ga0070660_100507480
580 Ga0070660_100634158
581 Ga0070691_10257230
582 Ga0070691_10266957
583 Ga0070661_100036270
584 Ga0070661_100087407
585 Ga0070671_100179297
586 Ga0070674_100115432
587 Ga0070659_100064189
588 Ga0070659_100157166
589 Ga0070667_100034531
590 Ga0070714_100134786
591 Ga0070711_100176717
592 Ga0070711_100272273
593 Ga0070708_100072514
594 Ga0070663_100401545
595 Ga0070663_101048556
596 Ga0070678_100898555
597 Ga0070681_10063242
598 Ga0070681_10243095
599 Ga0070681_10292600
600 Ga0070681_10489030
601 Ga0070681_10584895
602 Ga0070679_100066883
603 Ga0070679_100077300
604 Ga0070679_100091020
605 Ga0070679_100114573
606 Ga0070679_100161324
607 Ga0070679_100220524
608 Ga0070679_100401973
609 Ga0070679_100456480
610 Ga0070679_100532527
611 Ga0070684_100043943
612 Ga0070684_100088491
613 Ga0070684_100336974
614 Ga0070696_100288701
615 Ga0070665_100234003
616 Ga0068855_100138502
617 Ga0068855_100204730
618 Ga0068855_100228145
619 Ga0068855_100624690
620 Ga0070664_100429753
621 Ga0068857_100578960
622 Ga0068856_100758202
623 Ga0068852_100053060
624 Ga0068852_100239338
625 Ga0081455_10060937
626 Ga0070717_10292110
627 Ga0070717_10293733
628 Ga0075365_10292296
629 Ga0070712_100049042
630 Ga0070712_100075712
631 Ga0070712_100187299
632 Ga0075433_10112179
633 Ga0075433_10144220
634 Ga0075434_100094550
635 Ga0075435_100027531
636 Ga0105240_10171319
637 Ga0105240_10931283
638 Ga0111539_10493475
639 Ga0105245_10331695
640 Ga0105245_10856512
641 Ga0114129_10821939
642 Ga0105243_10082615
643 Ga0105241_10571579
644 Ga0105242_10265040
645 Ga0105248_10346926
646 Ga0105237_10064717
647 Ga0105237_10211769
648 Ga0105238_10112359
649 Ga0105238_10131720
650 Ga0105238_10729224
651 Ga0105239_10856675
652 Ga0105239_11474001
653 Ga0105246_10364221
654 Ga0157370_10057577
655 Ga0157370_10455332
656 Ga0157370_10742962
657 Ga0157369_10230308
658 Ga0157369_10355880
659 Ga0157369_10502955
660 Ga0157372_10104802
661 Ga0157372_10363200
662 Ga0157375_10060387
663 Ga0157375_10458320
664 Ga0182008_10033214
665 Ga0197907_10041333
666 Ga0197907_10078274
667 Ga0197907_10514735
668 Ga0206356_10503468
669 Ga0206356_11190128
670 Ga0206356_11688529
671 Ga0206352_11164402
672 Ga0206350_10659759
673 Ga0206354_10131682
674 Ga0206354_11330624
675 Ga0206354_11709488
676 Ga0206353_10512868
677 Ga0206353_10901896
678 Ga0213876_10056781
679 Ga0224712_10025815
680 Ga0207647_10336237
681 Ga0207705_10013304
682 Ga0207705_10029214
683 Ga0207705_10037144
684 Ga0207654_10185239
685 Ga0207707_10017724
686 Ga0207707_10020910
687 Ga0207707_10395862
688 Ga0207707_10408250
689 Ga0207695_10279798
690 Ga0207671_10091125
691 Ga0207671_10227708
692 Ga0207693_10087381
693 Ga0207693_10195401
694 Ga0207693_10846268
695 Ga0207663_10336949
696 Ga0207663_10853707
697 Ga0207660_10120253
698 Ga0207660_10189137
699 Ga0207660_10223498
700 Ga0207660_10236018
701 Ga0207657_10045230
702 Ga0207657_10348688
703 Ga0207649_10060107
704 Ga0207649_10220264
705 Ga0207652_10018676
706 Ga0207652_10108390
707 Ga0207652_10338790
708 Ga0207652_10475099
709 Ga0207687_10394461
710 Ga0207664_10588326
711 Ga0207644_10032993
712 Ga0207686_10095285
713 Ga0207669_10310103
714 Ga0207665_10408957
715 Ga0207661_10204991
716 Ga0207661_10337009
717 Ga0207661_10404387
718 Ga0207661_10758868
719 Ga0207667_10022223
720 Ga0207667_10437256
721 Ga0207667_10766557
722 Ga0207667_10920797
723 Ga0207640_10225231
724 Ga0207658_10025319
725 Ga0207639_10306675
726 Ga0207678_10115589
727 Ga0207678_10121434
728 Ga0207702_10884423
729 Ga0207648_10862127
730 Ga0207674_10501387
731 Ga0207674_10549353
732 Ga0207698_10022316
733 Ga0207698_10660359
734 Ga0268266_10634985
735 Ga0265319_1008145
736 Ga0265319_1153302
737 Ga0265318_10002190
738 Ga0265318_10125961
739 Ga0265322_10004220
740 Ga0265336_10124329
741 Ga0265338_10004174
742 Ga0265338_10038128
743 Ga0265338_10123946
744 Ga0265332_10138186
745 Ga0265328_10077675
746 Ga0265325_10090227
747 Ga0265340_10030967
748 Ga0265340_10060332
749 Ga0265339_10053229
750 Ga0265327_10099359
751 Ga0265316_10019031
752 Ga0307408_100408343
753 Ga0307408_100609324
754 Ga0307408_101252180
755 Ga0265313_10003963
756 Ga0265314_10100305
757 Ga0265314_10277273
758 Ga0265314_10433223
759 Ga0265342_10035581
760 Ga0307405_10770256
761 Ga0307413_10024576
762 Ga0307410_10077552
763 Ga0307406_10182677
764 Ga0307406_10568018
765 Ga0307412_10099531
766 Ga0307416_100609721
767 Ga0307415_100071974
768 Ga0307415_100366325
769 Ga0307415_100407594
770 Ga0373926_0018045
771 Ga0373944_0009800
772 Ga0373936_0054332
773 Ga0373945_0010432
774 Ga0373945_0092462
775 Ga0373953_0010913
776 Ga0373954_0157555
777 Ga0373957_0058982
778 Ga0373957_0371515
779 Ga0373943_0003051
780 Ga0373943_0042932
781 Ga0373943_0281994
782 Ga0373946_0022627
783 Ga0373946_0071595
784 Ga0373955_0203786
785 Ga0373924_0058440
786 Ga0373935_0014714
787 Ga0373935_0071933
788 Ga0373927_0077418
789 Ga0373927_0188212
790 Ga0373933_0061946
791 Ga0373947_0003670
792 Ga0373947_0023692
793 Ga0373947_0050927
794 Ga0373947_0316463
795 Ga0373925_0001927
796 Ga0373925_0038494
797 Ga0373925_0465147
798 Ga0395899_0048412
799 Ga0395899_0114620
800 Ga0395900_0065979
801 Ga0395900_0111344
802 Ga0395900_0176249
803 Ga0395900_0202415
804 Ga0395900_0276158
805 Ga0395900_0425409
806 Ga0395900_0485940
807 Ga0395900_0608418
808 Ga0395900_0627291
809 Ga0395900_1001835
810 Ga0395900_1080322
811 Ga0395898_0011468
812 Ga0395898_0127884
813 Ga0395898_0168235
814 Ga0395898_0215198
815 Ga0395898_0267195
816 Ga0395898_0336726
817 Ga0395898_0532108
818 Ga0395898_0728143
819 Ga0395905_0059050
820 Ga0395905_0294703
821 Ga0395905_0316434
822 Ga0395905_0847145
823 Ga0436364_1197349
824 Ga0395901_0002305
825 Ga0395901_0043388
826 Ga0395901_0082086
827 Ga0395901_0175135
828 Ga0395901_0497505
829 Ga0395901_0743910
830 Ga0436365_1409002
831 Ga0436360_0785050
832 Ga0436360_1309909
833 Ga0436363_1321101
834 Ga0436362_0807812
835 Ga0439448_0097098
836 Ga0439464_0085371
837 Ga0466969_0107321
838 Ga0466972_0177400
839 Ga0466965_0207400
840 Ga0466966_0160532
841 Ga0466966_0251608
842 Ga0466966_0360234
843 Ga0466966_0426075
844 Ga0466961_0004222
845 Ga0466961_0021563
846 Ga0466961_0176249
847 Ga0466963_0002146
848 Ga0466963_0016884
849 Ga0466963_0053628
850 Ga0466963_0099665
851 Ga0466963_0286670
852 Ga0466963_0629834
853 Ga0466964_0019033
854 Ga0466964_0019511
855 Ga0466964_0020457
856 Ga0466964_0057880
857 Ga0466964_0163863
858 Ga0466968_0029093
859 Ga0466968_0032425
860 Ga0466968_0267478
861 Ga0466970_0104760
862 Ga0466957_0002423
863 Ga0466957_0128329
864 Ga0466957_0276177
865 Ga0466960_0351435
866 Ga0466959_0145240
867 Ga0466959_0287998
868 Ga0466959_0356202
869 Ga0466959_0380757
870 Ga0466959_0395096
871 Ga0451576_0413169
872 Ga0466958_0011053
873 Ga0466958_0102068
874 Ga0466958_0159053
875 Ga0466958_0624644
876 Ga0466967_0041992
877 Ga0466967_0106280
878 Ga0466967_0135865
879 Ga0466967_0165245
880 Ga0466967_0245796
881 Ga0466967_0327176
882 Ga0466967_0340127
883 Ga0466967_0419194
884 Ga0466967_0445592
885 Ga0466967_0454549
886 Ga0466967_0549674
887 Ga0466967_0733313
888 Ga0466967_1187085
889 Ga0495592_0083588
890 Ga0495592_0199882
891 Ga0495629_0003111
892 Ga0495629_0018686
893 Ga0495629_0163976
894 Ga0495641_0005595
895 Ga0495651_0040316
896 Ga0495651_0143247
897 Ga0495653_0080723
898 Ga0495653_0099561
899 Ga0495653_0482740
900 Ga0495580_0092752
901 Ga0495582_0001042
902 Ga0495582_0158926
903 Ga0495605_0094704
904 Ga0495639_0000659
905 Ga0495639_0036144
906 Ga0495662_0013107
907 Ga0495664_0019228
908 Ga0495664_0137344
909 Ga0495584_0016012
910 Ga0495608_0001775
911 Ga0495608_0032301
912 Ga0495628_0042660
913 Ga0495628_0146222
914 Ga0495628_0514090
915 Ga0495630_0021343
916 Ga0495630_0162444
917 Ga0495630_0167682
918 Ga0495630_0628145
919 Ga0495644_0071619
920 Ga0495666_0019220
921 Ga0495652_0066022
922 Ga0495652_0226187
923 Ga0495652_0296504
924 Ga0495652_0423739
925 Ga0495665_0001383
926 Ga0495665_0126708
927 Ga0495640_0003882
928 Ga0495640_0104912
929 Ga0495640_0203513
930 Ga0495640_0302306
931 Ga0495586_0009444
932 Ga0495586_0250019
933 Ga0495587_0034355
934 Ga0495587_0070974
935 Ga0495645_0127473
936 Ga0495667_0021446
937 Ga0495667_0230604
938 Ga0495667_0575711
939 Ga0495634_0030492
940 Ga0495634_0130933
941 Ga0495635_0024980
942 Ga0495635_0058878
943 Ga0495635_0159590
944 Ga0495659_0071386
945 Ga0495588_0037146
946 Ga0495657_0014241
947 Ga0495657_0147778
948 Ga0495657_0201433
949 Ga0495599_0106758
950 Ga0495646_0128008
951 Ga0495647_0015559
952 Ga0495658_0001453
953 Ga0495658_0014164
954 Ga0495658_0072334
955 Ga0495669_0202491
956 Ga0495613_0037957
957 Ga0495613_0051821
958 Ga0495613_0138547
959 Ga0495613_0234973
960 Ga0495613_0664440
961 Ga0495624_0011405
962 Ga0495624_0108818
963 Ga0495624_0309337
964 Ga0495670_0364191
965 Ga0495600_0036020
966 Ga0495600_0103473
967 Ga0495600_0191095
968 Ga0495581_0003962
969 Ga0495604_0098481
970 Ga0495604_0470157
971 Ga0495674_0011281
972 Ga0495674_0110334
973 Ga0495674_0141228
974 Ga0495674_0322801
975 Ga0495676_0015831
976 Ga0495676_0081260
977 Ga0495676_0675793
978 Ga0495680_0004202
979 Ga0495680_0016961
980 Ga0495680_0091809
981 Ga0495680_0092674
982 Ga0495680_0485700
983 Ga0495680_0613317
984 Ga0495675_0210456
985 Ga0495675_0229515
986 Ga0495675_0470848
987 Ga0495684_0044889
988 Ga0495684_0141096
989 Ga0495684_0192226
990 Ga0495593_0015905
991 Ga0495593_0212159
992 Ga0495602_0021873
993 Ga0495602_0145408
994 Ga0495614_0010011
995 Ga0495614_0140512
996 Ga0496100_0001629
997 Ga0496100_0063470
998 Ga0496100_0168987
999 Ga0496100_0970659
1000 Ga0496101_0006287
1001 Ga0496101_0226806
1002 Ga0496101_0272151
1003 Ga0496101_0784604
1004 Ga0496101_1136877
1005 Ga0496102_0012038
1006 Ga0496102_0041439
1007 Ga0496102_1373156
1008 Ga0496103_0095009
1009 Ga0496104_0044390
1010 Ga0496104_0138734
1011 Ga0496104_0348179
1012 Ga0496104_0528624
1013 Ga0496104_0637326
1014 Ga0496104_0709900
1015 Ga0496104_0742955
1016 Ga0496105_0003457
1017 Ga0496105_0122783
1018 Ga0496105_0274019
1019 Ga0496105_0294348
1020 Ga0496106_0023466
1021 Ga0496106_0040118
1022 Ga0496106_0193546
1023 Ga0496106_0297574
1024 Ga0496107_0012081
1025 Ga0496107_0019364
1026 Ga0496107_0024809
1027 Ga0496107_0122299
1028 Ga0496107_0414272
1029 Ga0496108_0010786
1030 Ga0496108_0088819
1031 Ga0496108_0111525
1032 Ga0496108_0169935
1033 Ga0496109_0007432
1034 Ga0496110_0038139
1035 Ga0496110_0244713
1036 Ga0496110_0281443
1037 Ga0496110_0321100
1038 Ga0496111_0064352
1039 Ga0496111_0591154
1040 Ga0496112_0159440
1041 Ga0496112_0216953
1042 Ga0496112_0312113
1043 Ga0496112_0369088
1044 Ga0496112_0720051
1045 Ga0496113_0040087
1046 Ga0496113_0396854
1047 Ga0496114_0006470
1048 Ga0496114_0050391
1049 Ga0496114_0059182
1050 Ga0496114_0309106
1051 Ga0496114_0859688
1052 Ga0496114_0879718
1053 Ga0496115_0005162
1054 Ga0496115_0083607
1055 Ga0496115_0262128
1056 Ga0496115_0414767
1057 Ga0501306_009104
1058 Ga0501031_0686252
1059 Ga0501036_0439144
1060 Ga0501040_0127326
1061 Ga0501043_0564932
1062 Ga0501046_0298642
1063 Ga0501047_0046149
1064 Ga0501047_0421313
1065 Ga0501047_0656613
1066 Ga0501067_0040805
1067 Ga0501067_0064058
1068 Ga0501067_0140963
1069 Ga0501068_0238293
1070 Ga0501069_0161570
1071 Ga0501070_0201710
1072 Ga0501070_0724099
1073 Ga0501072_0277722
1074 Ga0501074_0079710
1075 Ga0501077_0106529
1076 Ga0501079_0320097
1077 Ga0501080_0132927
1078 Ga0501080_0142901
1079 Ga0501081_0260204
1080 Ga0501035_0315282
1081 Ga0501035_0496173
1082 Ga0501044_0297681
1083 Ga0501044_0535425
1084 Ga0501044_0873493
1085 Ga0501045_0124958
1086 nmdc:mga08y16_310496_c1
1087 nmdc:mga0n895_54812_c1
1088 nmdc:mga0rr50_358017_c1
1089 nmdc:mga0rr50_66441_c1
1090 nmdc:mga0a205_178135_c1
1091 nmdc:mga0a205_465787_c1
1092 Ga0495601_0025629
1093 Ga0495601_0185415
1094 Ga0495601_0201860
1095 Ga0495601_0266070
1096 Ga0495601_0337637
1097 Ga0495612_0025956
1098 Ga0495655_0253951
1099 Ga0495595_0027663
1100 Ga0495595_0034907
1101 Ga0495595_0190393
1102 Ga0495619_0006091
1103 Ga0495619_0053195
1104 Ga0495619_0054686
1105 Ga0495619_0356556
1106 Ga0587084_024129
1107 Ga0587066_026283
1108 Ga0587073_0030893
1109 Ga0587082_040117
1110 Ga0587083_0043321
1111 Ga0587085_016846
1112 Ga0587088_046296
1113 Ga0587091_035515
1114 Ga0587122_014903
1115 Ga0587075_034721
1116 Ga0587079_043477
1117 Ga0587107_064538
1118 Ga0501082_0488812
1119 Ga0466962_0003007
1120 Ga0530510_0123473
1121 Ga0530510_0500867
1122 Ga0530510_0540287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

69

172

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9176 4 208
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9124 3 208
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.9085 3 208
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.9034 3 208
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9015 4 208
ID Description Score Start End Superfamily
1vw3C01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9348 3 205 2.40.30.10
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8785 36 94 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8661 36 97 3.30.160.810
1vw3C02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8469 34 97 3.30.160.810
af_P60438_33_95_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8444 36 90 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A7K0RZX3-F1-model_v4 50S ribosomal protein L3 0.9403 5 98 GO:0003735
GO:0006412
GO:0022625
AF-A0A2V5X3H4-F1-model_v4 50S ribosomal protein L3 0.9336 5 106 GO:0003735
GO:0006412
GO:0022625
AF-A0A7Y1SZQ3-F1-model_v4 50S ribosomal protein L3 0.9056 5 103 GO:0003735
GO:0005840
GO:0006412
AF-A0A7K0RZX3-F1-model_v4 50S ribosomal protein L3 0.8856 5 98 GO:0003735
GO:0006412
GO:0022625
AF-A0A7V5VUP8-F1-model_v4 50S ribosomal protein L3 0.8728 5 125 GO:0003735
GO:0006412
GO:0022625

Map