F463805

General Info

Members Datasets Scaffolds Average Seq Length
561 276 1122 329

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10017102|Ga0081455_100171022
Length 318
Sequence VTRYLARKVVIYLVTFFVAVTIDWAIPRFMPGDPVEGLLSRMQAQPGSVEELSGYYTQAFGFDVPIWQQYLNFWAALLNGDLGRSIANYPTPVSELIMGALPYTLALLVPAVLLSFWAGNKVGALAARRKALDNTVLPASYALTATPQMWLGIVLAWLFASTWAIFPVSGAYALDIQPSWSLEFAHSALFLVAFGGWAIGMRNMIIYELEADYSNYLASLGAPTKLVRKYAYRNALLPQITGLALALGAVVAGAIVVEIVFSYPGLGTLTLKAIQNRDYFLIQGIFLFLITGVLIANFLIDIFYVVVDPRTRIGMQGS

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
177 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
178 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
179 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
272 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
273 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
274 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
275 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
276 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.18
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 6.24
Rhizosphere 92.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10017102 3300005937 Bacteria 6968
2 2214859106 2209111006 Bacteria 1599
3 ARcpr5oldR_c000569 3300000041 Bacteria 4549
4 ARcpr5yngRDRAFT_c000519 3300000043 Bacteria 4963
5 ARSoilOldRDRAFT_c000374 3300000044 Bacteria 5579
6 ARCol0yngRDRAFT_1000467 3300000652 Bacteria 4855
7 JGI24743J22301_10010145 3300001991 Bacteria 1677
8 JGI24745J21846_1003840 3300002073 Bacteria 1587
9 JGI24738J21930_10004267 3300002075 Bacteria 3520
10 JGI24738J21930_10022337 3300002075 Bacteria 1308
11 Ga0070658_10044664 3300005327 Bacteria 3581
12 Ga0070676_10123544 3300005328 Bacteria 1628
13 Ga0070683_100023502 3300005329 Bacteria 5514
14 Ga0070683_100060657 3300005329 Bacteria 3515
15 Ga0070683_100098500 3300005329 Bacteria 2751
16 Ga0070683_100147436 3300005329 Bacteria 2230
17 Ga0070683_100352449 3300005329 Bacteria 1402
18 Ga0070670_100000779 3300005331 Bacteria 24797
19 Ga0070670_100089874 3300005331 Bacteria 2640
20 Ga0068869_100040355 3300005334 Bacteria 3337
21 Ga0070680_100007563 3300005336 Bacteria 8284
22 Ga0070680_100039956 3300005336 Bacteria 3796
23 Ga0070680_100084877 3300005336 Bacteria 2615
24 Ga0070682_100050557 3300005337 Bacteria 2596
25 Ga0070682_100079273 3300005337 Bacteria 2120
26 Ga0068868_100024862 3300005338 Bacteria 4548
27 Ga0070660_100021237 3300005339 Bacteria 4784
28 Ga0070660_100048242 3300005339 Bacteria 3270
29 Ga0070660_100052971 3300005339 Bacteria 3129
30 Ga0070660_100107821 3300005339 Bacteria 2213
31 Ga0070689_100017813 3300005340 Bacteria 5223
32 Ga0070691_10014737 3300005341 Bacteria 3589
33 Ga0070691_10026999 3300005341 Bacteria 2678
34 Ga0070661_100040503 3300005344 Bacteria 3399
35 Ga0070661_100112240 3300005344 Bacteria 2036
36 Ga0070661_100145593 3300005344 Bacteria 1788
37 Ga0070692_10011739 3300005345 Bacteria 4032
38 Ga0070692_10030574 3300005345 Bacteria 2693
39 Ga0070692_10034615 3300005345 Bacteria 2552
40 Ga0070675_100039203 3300005354 Bacteria 3865
41 Ga0070675_100193424 3300005354 Bacteria 1763
42 Ga0070671_100013829 3300005355 Bacteria 6512
43 Ga0070674_100005560 3300005356 Bacteria 7291
44 Ga0070674_100100129 3300005356 Bacteria 2109
45 Ga0070673_100036018 3300005364 Bacteria 3757
46 Ga0070673_100052638 3300005364 Bacteria 3195
47 Ga0070688_100020479 3300005365 Bacteria 3847
48 Ga0070659_100029729 3300005366 Bacteria 4223
49 Ga0070659_100044401 3300005366 Bacteria 3479
50 Ga0070659_100045581 3300005366 Bacteria 3435
51 Ga0070659_100047377 3300005366 Bacteria 3371
52 Ga0070659_100351792 3300005366 Bacteria 1236
53 Ga0070701_10060569 3300005438 Bacteria 1993
54 Ga0070705_100012872 3300005440 Bacteria 4267
55 Ga0070694_100040069 3300005444 Bacteria 3122
56 Ga0070708_100342376 3300005445 Bacteria 1409
57 Ga0070662_100043544 3300005457 Bacteria 3212
58 Ga0070681_10095800 3300005458 Bacteria 2916
59 Ga0070681_10135491 3300005458 Bacteria 2393
60 Ga0070681_10185021 3300005458 Bacteria 2004
61 Ga0068867_100123201 3300005459 Bacteria 2006
62 Ga0068867_100135316 3300005459 Bacteria 1920
63 Ga0070685_10001347 3300005466 Bacteria 12883
64 Ga0070685_10032918 3300005466 Bacteria 2907
65 Ga0070679_100043156 3300005530 Bacteria 4492
66 Ga0070679_100239892 3300005530 Bacteria 1770
67 Ga0070684_100027955 3300005535 Bacteria 4766
68 Ga0070684_100047429 3300005535 Bacteria 3723
69 Ga0070684_100073081 3300005535 Bacteria 3021
70 Ga0070684_100089328 3300005535 Bacteria 2738
71 Ga0070684_100195328 3300005535 Bacteria 1842
72 Ga0068853_100215765 3300005539 Bacteria 1750
73 Ga0070672_100071109 3300005543 Bacteria 2767
74 Ga0070686_100024054 3300005544 Bacteria 3648
75 Ga0070696_100014568 3300005546 Bacteria 5277
76 Ga0070696_100019660 3300005546 Bacteria 4575
77 Ga0070693_100022292 3300005547 Bacteria 3364
78 Ga0070665_100033118 3300005548 Bacteria 5199
79 Ga0070704_100005859 3300005549 Bacteria 7198
80 Ga0070704_100006183 3300005549 Bacteria 7036
81 Ga0068855_100145196 3300005563 Bacteria 2702
82 Ga0070664_100013910 3300005564 Bacteria 6559
83 Ga0070664_100067626 3300005564 Bacteria 3053
84 Ga0070664_100284235 3300005564 Bacteria 1492
85 Ga0070664_100314400 3300005564 Bacteria 1418
86 Ga0068857_100100379 3300005577 Bacteria 2596
87 Ga0068857_100110094 3300005577 Bacteria 2475
88 Ga0068857_100138740 3300005577 Bacteria 2197
89 Ga0068854_100003120 3300005578 Bacteria 10311
90 Ga0068854_100018309 3300005578 Bacteria 4701
91 Ga0068856_100037332 3300005614 Bacteria 4768
92 Ga0068856_100061886 3300005614 Bacteria 3697
93 Ga0068852_100029553 3300005616 Bacteria 4504
94 Ga0068852_100183992 3300005616 Bacteria 1966
95 Ga0068852_100202368 3300005616 Bacteria 1879
96 Ga0068859_100047480 3300005617 Bacteria 4314
97 Ga0068864_100005943 3300005618 Bacteria 10011
98 Ga0068864_100238019 3300005618 Bacteria 1686
99 Ga0068866_10044136 3300005718 Bacteria 2229
100 Ga0068861_100085440 3300005719 Bacteria 2478
101 Ga0068861_100099802 3300005719 Bacteria 2306
102 Ga0068870_10000391 3300005840 Bacteria 16494
103 Ga0068870_10020319 3300005840 Bacteria 3232
104 Ga0068858_100003600 3300005842 Bacteria 15334
105 Ga0068860_100018493 3300005843 Bacteria 6777
106 Ga0068862_100090454 3300005844 Bacteria 2665
107 Ga0081455_10010944 3300005937 Bacteria 9146
108 Ga0081455_10122782 3300005937 Bacteria 2044
109 Ga0081455_10143796 3300005937 Bacteria 1848
110 Ga0081538_10011237 3300005981 Bacteria 7267
111 Ga0081538_10015639 3300005981 Bacteria 5862
112 Ga0081538_10015863 3300005981 Bacteria 5809
113 Ga0075365_10002270 3300006038 Bacteria 9328
114 Ga0075364_10002037 3300006051 Bacteria 11271
115 Ga0075364_10003525 3300006051 Bacteria 8903
116 Ga0075432_10001548 3300006058 Bacteria 7535
117 Ga0097621_100064403 3300006237 Bacteria 3014
118 Ga0068871_100125206 3300006358 Bacteria 2175
119 Ga0075428_100002822 3300006844 Bacteria 18917
120 Ga0075428_100007380 3300006844 Bacteria 12190
121 Ga0075428_100159110 3300006844 Bacteria 2452
122 Ga0075430_100005525 3300006846 Bacteria 10681
123 Ga0075430_100108703 3300006846 Bacteria 2313
124 Ga0075430_100183864 3300006846 Bacteria 1738
125 Ga0075431_100024961 3300006847 Bacteria 6127
126 Ga0075431_100033707 3300006847 Bacteria 5277
127 Ga0075434_100000750 3300006871 Bacteria 25547
128 Ga0075429_100001007 3300006880 Bacteria 22430
129 Ga0075429_100056225 3300006880 Bacteria 3425
130 Ga0075436_100252580 3300006914 Bacteria 1256
131 Ga0097620_100047480 3300006931 Bacteria 4314
132 Ga0111539_10009610 3300009094 Bacteria 12209
133 Ga0111539_10010900 3300009094 Bacteria 11442
134 Ga0111539_10014331 3300009094 Bacteria 9898
135 Ga0111539_10138730 3300009094 Bacteria 2847
136 Ga0105245_10023746 3300009098 Bacteria 5382
137 Ga0105245_10181551 3300009098 Bacteria 2011
138 Ga0105247_10008284 3300009101 Bacteria 6340
139 Ga0114129_10015238 3300009147 Bacteria 10942
140 Ga0114129_10025174 3300009147 Bacteria 8434
141 Ga0114129_10131094 3300009147 Bacteria 3443
142 Ga0114129_10132295 3300009147 Bacteria 3425
143 Ga0114129_10257329 3300009147 Bacteria 2341
144 Ga0114129_10469138 3300009147 Bacteria 1649
145 Ga0105243_10005354 3300009148 Bacteria 10013
146 Ga0105243_10147203 3300009148 Bacteria 2016
147 Ga0105243_10366276 3300009148 Bacteria 1328
148 Ga0105241_10019566 3300009174 Bacteria 4993
149 Ga0105242_10102110 3300009176 Bacteria 2431
150 Ga0105248_10118296 3300009177 Bacteria 2989
151 Ga0105237_10072225 3300009545 Bacteria 3445
152 Ga0105238_10014512 3300009551 Bacteria 7966
153 Ga0105238_10061458 3300009551 Bacteria 3759
154 Ga0105238_10206495 3300009551 Bacteria 1940
155 Ga0105249_10288263 3300009553 Bacteria 1642
156 Ga0105239_10016422 3300010375 Bacteria 8185
157 Ga0105239_10325418 3300010375 Bacteria 1734
158 Ga0105239_10333891 3300010375 Bacteria 1710
159 Ga0105246_10005838 3300011119 Bacteria 7506
160 Ga0105246_10111230 3300011119 Bacteria 2012
161 Ga0105246_10173646 3300011119 Bacteria 1653
162 Ga0105246_10174210 3300011119 Bacteria 1650
163 Ga0105246_10306018 3300011119 Bacteria 1285
164 Ga0157373_10094274 3300013100 Bacteria 2108
165 Ga0157371_10008624 3300013102 Bacteria 8097
166 Ga0157371_10041558 3300013102 Bacteria 3280
167 Ga0157371_10056415 3300013102 Bacteria 2787
168 Ga0157370_10007815 3300013104 Bacteria 11586
169 Ga0157370_10054635 3300013104 Bacteria 3807
170 Ga0157369_10015149 3300013105 Bacteria 8702
171 Ga0157369_10019578 3300013105 Bacteria 7573
172 Ga0163162_10064503 3300013306 Bacteria 3707
173 Ga0163162_10065604 3300013306 Bacteria 3678
174 Ga0163162_10091896 3300013306 Bacteria 3118
175 Ga0157372_10018156 3300013307 Bacteria 7563
176 Ga0157372_10044852 3300013307 Bacteria 4901
177 Ga0157372_10288592 3300013307 Bacteria 1908
178 Ga0157372_10467853 3300013307 Bacteria 1469
179 Ga0157375_10053420 3300013308 Bacteria 3975
180 Ga0163163_10260027 3300014325 Bacteria 1787
181 Ga0157380_10023704 3300014326 Bacteria 4633
182 Ga0157377_10042855 3300014745 Bacteria 2516
183 Ga0157377_10078174 3300014745 Bacteria 1928
184 Ga0157377_10083104 3300014745 Bacteria 1875
185 Ga0157376_10066889 3300014969 Bacteria 3038
186 Ga0157376_10229337 3300014969 Bacteria 1724
187 Ga0206356_10164439 3300020070 Bacteria 3692
188 Ga0207656_10084401 3300025321 Bacteria 1433
189 Ga0207688_10013385 3300025901 Bacteria 4456
190 Ga0207688_10016905 3300025901 Bacteria 3962
191 Ga0207688_10037730 3300025901 Bacteria 2680
192 Ga0207647_10033603 3300025904 Bacteria 3284
193 Ga0207645_10008705 3300025907 Bacteria 7064
194 Ga0207645_10132432 3300025907 Bacteria 1623
195 Ga0207643_10017677 3300025908 Bacteria 3902
196 Ga0207643_10069683 3300025908 Bacteria 2022
197 Ga0207705_10036171 3300025909 Bacteria 3533
198 Ga0207705_10337537 3300025909 Bacteria 1160
199 Ga0207654_10009686 3300025911 Bacteria 4901
200 Ga0207707_10027347 3300025912 Bacteria 4989
201 Ga0207707_10053257 3300025912 Bacteria 3523
202 Ga0207707_10067721 3300025912 Bacteria 3110
203 Ga0207707_10093558 3300025912 Bacteria 2626
204 Ga0207695_10215565 3300025913 Bacteria 1829
205 Ga0207660_10015417 3300025917 Bacteria 5044
206 Ga0207660_10093581 3300025917 Bacteria 2233
207 Ga0207660_10182955 3300025917 Bacteria 1628
208 Ga0207662_10015712 3300025918 Bacteria 4263
209 Ga0207657_10027117 3300025919 Bacteria 5252
210 Ga0207657_10028324 3300025919 Bacteria 5112
211 Ga0207657_10057144 3300025919 Bacteria 3364
212 Ga0207657_10098814 3300025919 Bacteria 2425
213 Ga0207649_10045224 3300025920 Bacteria 2698
214 Ga0207649_10075566 3300025920 Bacteria 2166
215 Ga0207649_10096056 3300025920 Bacteria 1951
216 Ga0207649_10112289 3300025920 Bacteria 1823
217 Ga0207652_10028842 3300025921 Bacteria 4633
218 Ga0207652_10030555 3300025921 Bacteria 4512
219 Ga0207652_10130765 3300025921 Bacteria 2239
220 Ga0207652_10233384 3300025921 Bacteria 1658
221 Ga0207694_10133306 3300025924 Bacteria 1993
222 Ga0207650_10004279 3300025925 Bacteria 9741
223 Ga0207650_10023615 3300025925 Bacteria 4363
224 Ga0207650_10104493 3300025925 Bacteria 2185
225 Ga0207650_10118125 3300025925 Bacteria 2061
226 Ga0207659_10012250 3300025926 Bacteria 5446
227 Ga0207659_10046475 3300025926 Bacteria 3066
228 Ga0207687_10007132 3300025927 Bacteria 7370
229 Ga0207687_10026830 3300025927 Bacteria 3859
230 Ga0207687_10082136 3300025927 Bacteria 2331
231 Ga0207664_10092114 3300025929 Bacteria 2487
232 Ga0207690_10034491 3300025932 Bacteria 3261
233 Ga0207690_10088771 3300025932 Bacteria 2178
234 Ga0207706_10018703 3300025933 Bacteria 6234
235 Ga0207706_10027232 3300025933 Bacteria 5112
236 Ga0207686_10103071 3300025934 Bacteria 1908
237 Ga0207709_10006518 3300025935 Bacteria 6557
238 Ga0207669_10034166 3300025937 Bacteria 2878
239 Ga0207704_10006199 3300025938 Bacteria 5558
240 Ga0207704_10155002 3300025938 Bacteria 1622
241 Ga0207691_10075781 3300025940 Bacteria 3032
242 Ga0207689_10032437 3300025942 Bacteria 4346
243 Ga0207661_10049394 3300025944 Bacteria 3348
244 Ga0207661_10051029 3300025944 Bacteria 3299
245 Ga0207661_10058001 3300025944 Bacteria 3115
246 Ga0207661_10064867 3300025944 Bacteria 2962
247 Ga0207661_10073348 3300025944 Bacteria 2802
248 Ga0207661_10098069 3300025944 Bacteria 2455
249 Ga0207661_10355736 3300025944 Bacteria 1322
250 Ga0207679_10009634 3300025945 Bacteria 6190
251 Ga0207679_10117859 3300025945 Bacteria 2108
252 Ga0207667_10175604 3300025949 Bacteria 2201
253 Ga0207651_10030085 3300025960 Bacteria 3452
254 Ga0207712_10085524 3300025961 Bacteria 2308
255 Ga0207712_10161654 3300025961 Bacteria 1741
256 Ga0207640_10016122 3300025981 Bacteria 4339
257 Ga0207640_10020233 3300025981 Bacteria 3950
258 Ga0207677_10031163 3300026023 Bacteria 3413
259 Ga0207703_10161617 3300026035 Bacteria 1962
260 Ga0207639_10180536 3300026041 Bacteria 1795
261 Ga0207678_10096027 3300026067 Bacteria 2533
262 Ga0207678_10169917 3300026067 Bacteria 1861
263 Ga0207708_10005911 3300026075 Bacteria 9052
264 Ga0207702_10036515 3300026078 Bacteria 4111
265 Ga0207702_10085826 3300026078 Bacteria 2744
266 Ga0207648_10075940 3300026089 Bacteria 2929
267 Ga0207648_10252012 3300026089 Bacteria 1574
268 Ga0207676_10059303 3300026095 Bacteria 3021
269 Ga0207676_10555489 3300026095 Bacteria 1097
270 Ga0207674_10085145 3300026116 Bacteria 3157
271 Ga0207674_10141411 3300026116 Bacteria 2366
272 Ga0207674_10238061 3300026116 Bacteria 1767
273 Ga0207675_100087369 3300026118 Bacteria 2928
274 Ga0207675_100117872 3300026118 Bacteria 2510
275 Ga0207683_10025244 3300026121 Bacteria 5125
276 Ga0207698_10089980 3300026142 Bacteria 2509
277 Ga0207698_10184671 3300026142 Bacteria 1851
278 Ga0207698_10218249 3300026142 Bacteria 1721
279 Ga0207698_10250612 3300026142 Bacteria 1620
280 Ga0207428_10003934 3300027907 Bacteria 14244
281 Ga0207428_10012776 3300027907 Bacteria 7365
282 Ga0207428_10030132 3300027907 Bacteria 4488
283 Ga0265319_1000528 3300028563 Bacteria 26190
284 Ga0265319_1004905 3300028563 Bacteria 6539
285 Ga0265334_10010876 3300028573 Bacteria 3841
286 Ga0265334_10039959 3300028573 Bacteria 1839
287 Ga0265318_10001202 3300028577 Bacteria 15789
288 Ga0265322_10001672 3300028654 Bacteria 7065
289 Ga0265338_10004638 3300028800 Bacteria 18470
290 Ga0265338_10021103 3300028800 Bacteria 6808
291 Ga0265338_10032441 3300028800 Bacteria 5094
292 Ga0265338_10056803 3300028800 Bacteria 3467
293 Ga0265328_10002649 3300031239 Bacteria 8002
294 Ga0265320_10010317 3300031240 Bacteria 5569
295 Ga0265320_10026230 3300031240 Bacteria 3053
296 Ga0265320_10067327 3300031240 Bacteria 1695
297 Ga0265325_10019559 3300031241 Bacteria 3741
298 Ga0265327_10015089 3300031251 Bacteria 5010
299 Ga0265327_10018675 3300031251 Bacteria 4289
300 Ga0265316_10018690 3300031344 Bacteria 5952
301 Ga0265313_10004921 3300031595 Bacteria 10009
302 Ga0265314_10018529 3300031711 Bacteria 5425
303 Ga0265314_10193648 3300031711 Bacteria 1207
304 Ga0265342_10004476 3300031712 Bacteria 10981
305 Ga0307413_10023217 3300031824 Bacteria 3358
306 Ga0307410_10051945 3300031852 Bacteria 2765
307 Ga0307410_10099471 3300031852 Bacteria 2082
308 Ga0307410_10325217 3300031852 Bacteria 1221
309 Ga0307406_10050155 3300031901 Bacteria 2644
310 Ga0307406_10065684 3300031901 Bacteria 2358
311 Ga0307406_10175770 3300031901 Bacteria 1554
312 Ga0307407_10016507 3300031903 Bacteria 3677
313 Ga0307412_10009650 3300031911 Bacteria 5541
314 Ga0307409_100007838 3300031995 Bacteria 6426
315 Ga0307409_100041981 3300031995 Bacteria 3421
316 Ga0307416_100064903 3300032002 Bacteria 2997
317 Ga0307416_100158766 3300032002 Bacteria 2086
318 Ga0307415_100002737 3300032126 Bacteria 8811
319 Ga0307415_100007395 3300032126 Bacteria 6005
320 Ga0307415_100047037 3300032126 Bacteria 2902
321 Ga0373959_0028132 3300034820 Bacteria 1121
322 Ga0373939_0009171 3300035114 Bacteria 2448
323 Ga0373960_0029654 3300035121 Bacteria 1518
324 Ga0373955_0088465 3300035172 Bacteria 1762
325 Ga0373955_0101592 3300035172 Bacteria 1652
326 Ga0373947_0005418 3300035725 Bacteria 7451
327 Ga0373947_0083293 3300035725 Bacteria 1983
328 Ga0373937_0071684 3300036401 Bacteria 3195
329 Ga0373925_0306888 3300037068 Bacteria 1282
330 Ga0395900_0005824 3300037418 Bacteria 12875
331 Ga0395898_0053774 3300037466 Bacteria 3931
332 Ga0395905_0061565 3300037471 Bacteria 3511
333 Ga0395901_0053524 3300038443 Bacteria 4193
334 Ga0439453_0009007 3300041408 Bacteria 1618
335 Ga0439455_0021194 3300042012 Bacteria 1547
336 Ga0450915_000026 3300042119 Bacteria 2652
337 Ga0450920_014309 3300042122 Bacteria 1500
338 Ga0466963_0024303 3300044694 Bacteria 3857
339 Ga0495592_0052657 3300046454 Bacteria 3021
340 Ga0495592_0145673 3300046454 Bacteria 1643
341 Ga0495592_0277803 3300046454 Bacteria 1096
342 Ga0495603_0000455 3300046455 Bacteria 22463
343 Ga0495629_0011041 3300046459 Bacteria 6563
344 Ga0495629_0324171 3300046459 Bacteria 1053
345 Ga0495641_0050990 3300046461 Bacteria 1891
346 Ga0495641_0106283 3300046461 Bacteria 1252
347 Ga0495641_0138307 3300046461 Bacteria 1087
348 Ga0495651_0094723 3300046462 Bacteria 2234
349 Ga0495653_0046685 3300046463 Bacteria 3353
350 Ga0495582_0088917 3300046473 Bacteria 1721
351 Ga0495585_0058104 3300046492 Bacteria 2134
352 Ga0495594_0002018 3300046499 Bacteria 10573
353 Ga0495608_0071542 3300046511 Bacteria 2263
354 Ga0495608_0137704 3300046511 Bacteria 1559
355 Ga0495618_0237900 3300046514 Bacteria 1145
356 Ga0495630_0020682 3300046517 Bacteria 4854
357 Ga0495630_0037928 3300046517 Bacteria 3603
358 Ga0495652_0134199 3300046529 Bacteria 1955
359 Ga0495640_0023434 3300046533 Bacteria 4497
360 Ga0495586_0005447 3300046535 Bacteria 6807
361 Ga0495645_0002901 3300046543 Bacteria 11636
362 Ga0495667_0043174 3300046559 Bacteria 2988
363 Ga0495667_0051033 3300046559 Bacteria 2729
364 Ga0495634_0096174 3300046642 Bacteria 1918
365 Ga0495635_0098375 3300046663 Bacteria 2000
366 Ga0495657_0065115 3300046675 Bacteria 2398
367 Ga0495623_0155304 3300046679 Bacteria 1349
368 Ga0495646_0085773 3300046680 Bacteria 1827
369 Ga0495658_0173663 3300046683 Bacteria 1335
370 Ga0495613_0130309 3300046689 Bacteria 1801
371 Ga0495600_0039532 3300046809 Bacteria 3072
372 Ga0495600_0076314 3300046809 Bacteria 2188
373 Ga0495604_0177407 3300047317 Bacteria 1492
374 Ga0495604_0178519 3300047317 Bacteria 1487
375 Ga0495674_0000208 3300047319 Bacteria 48267
376 Ga0495676_0012013 3300047321 Bacteria 7810
377 Ga0495676_0245283 3300047321 Bacteria 1225
378 Ga0495680_0039421 3300047322 Bacteria 3769
379 Ga0495680_0131980 3300047322 Bacteria 1835
380 Ga0495680_0151635 3300047322 Bacteria 1689
381 Ga0495684_0095585 3300047471 Bacteria 2249
382 Ga0495684_0308338 3300047471 Bacteria 1135
383 Ga0495602_0073230 3300048088 Bacteria 2917
384 Ga0496100_0322260 3300048903 Bacteria 1161
385 Ga0496101_0037959 3300048904 Bacteria 3419
386 Ga0496102_0346800 3300048905 Bacteria 1398
387 Ga0496103_0166194 3300048906 Bacteria 1416
388 Ga0496104_0001500 3300048907 Bacteria 20137
389 Ga0496104_0005885 3300048907 Bacteria 10738
390 Ga0496105_0002019 3300048908 Bacteria 14658
391 Ga0496105_0043833 3300048908 Bacteria 3690
392 Ga0496105_0071450 3300048908 Bacteria 2868
393 Ga0496106_0006858 3300048909 Bacteria 8430
394 Ga0496106_0165706 3300048909 Bacteria 1749
395 Ga0496107_0246020 3300048910 Bacteria 1331
396 Ga0496107_0295553 3300048910 Bacteria 1205
397 Ga0496108_0002150 3300048911 Bacteria 15791
398 Ga0496108_0013508 3300048911 Bacteria 6663
399 Ga0496108_0070778 3300048911 Bacteria 2943
400 Ga0496108_0348859 3300048911 Bacteria 1291
401 Ga0496109_0004335 3300048912 Bacteria 11856
402 Ga0496109_0005661 3300048912 Bacteria 10452
403 Ga0496109_0040309 3300048912 Bacteria 4230
404 Ga0496109_0511415 3300048912 Bacteria 1133
405 Ga0496110_0000458 3300048913 Bacteria 27729
406 Ga0496110_0016162 3300048913 Bacteria 6223
407 Ga0496110_0037304 3300048913 Bacteria 4224
408 Ga0496110_0213549 3300048913 Bacteria 1754
409 Ga0496111_0000956 3300048914 Bacteria 15811
410 Ga0496111_0045058 3300048914 Bacteria 3172
411 Ga0496112_0222223 3300048915 Bacteria 1844
412 Ga0496112_0519587 3300048915 Bacteria 1125
413 Ga0496113_0093000 3300048916 Bacteria 2327
414 Ga0496113_0134058 3300048916 Bacteria 1945
415 Ga0496113_0321495 3300048916 Bacteria 1240
416 Ga0496114_0023029 3300048917 Bacteria 5077
417 Ga0496115_0166876 3300048918 Bacteria 1821
418 Ga0496115_0196298 3300048918 Bacteria 1668
419 Ga0501031_0002988 3300049568 Bacteria 10823
420 Ga0501031_0003464 3300049568 Bacteria 10125
421 Ga0501032_0028238 3300049569 Bacteria 3855
422 Ga0501033_0002483 3300049570 Bacteria 15636
423 Ga0501033_0089779 3300049570 Bacteria 2248
424 Ga0501033_0198902 3300049570 Bacteria 1432
425 Ga0501036_0014763 3300049572 Bacteria 6514
426 Ga0501036_0028360 3300049572 Bacteria 4731
427 Ga0501036_0099719 3300049572 Bacteria 2456
428 Ga0501036_0221421 3300049572 Bacteria 1589
429 Ga0501036_0477992 3300049572 Bacteria 1037
430 Ga0501037_0089907 3300049573 Bacteria 2222
431 Ga0501038_0008091 3300049574 Bacteria 9676
432 Ga0501038_0225050 3300049574 Bacteria 1495
433 Ga0501039_0002083 3300049575 Bacteria 14830
434 Ga0501039_0060306 3300049575 Bacteria 2938
435 Ga0501040_0003382 3300049576 Bacteria 10296
436 Ga0501040_0016506 3300049576 Bacteria 4890
437 Ga0501040_0042145 3300049576 Bacteria 3108
438 Ga0501040_0083608 3300049576 Bacteria 2214
439 Ga0501040_0100572 3300049576 Bacteria 2016
440 Ga0501040_0170173 3300049576 Bacteria 1542
441 Ga0501040_0179576 3300049576 Bacteria 1500
442 Ga0501040_0328537 3300049576 Bacteria 1094
443 Ga0501041_0000551 3300049577 Bacteria 19413
444 Ga0501041_0021703 3300049577 Bacteria 3845
445 Ga0501042_0003535 3300049578 Bacteria 9831
446 Ga0501042_0019014 3300049578 Bacteria 4767
447 Ga0501042_0118604 3300049578 Bacteria 1905
448 Ga0501043_0000789 3300049579 Bacteria 28178
449 Ga0501043_0011277 3300049579 Bacteria 6998
450 Ga0501046_0001480 3300049580 Bacteria 22508
451 Ga0501046_0152395 3300049580 Bacteria 1743
452 Ga0501048_0000790 3300049582 Bacteria 23204
453 Ga0501048_0043804 3300049582 Bacteria 3202
454 Ga0501067_0025986 3300049583 Bacteria 3245
455 Ga0501067_0252281 3300049583 Bacteria 982
456 Ga0501068_0003371 3300049584 Bacteria 8586
457 Ga0501069_0000210 3300049585 Bacteria 25997
458 Ga0501069_0127287 3300049585 Bacteria 1457
459 Ga0501070_0006667 3300049586 Bacteria 9832
460 Ga0501070_0334267 3300049586 Bacteria 1231
461 Ga0501071_0003192 3300049587 Bacteria 10208
462 Ga0501071_0013520 3300049587 Bacteria 5564
463 Ga0501071_0038436 3300049587 Bacteria 3420
464 Ga0501071_0044734 3300049587 Bacteria 3176
465 Ga0501071_0048200 3300049587 Bacteria 3063
466 Ga0501071_0106167 3300049587 Bacteria 2074
467 Ga0501072_0012017 3300049588 Bacteria 6615
468 Ga0501072_0142984 3300049588 Bacteria 1908
469 Ga0501073_0004150 3300049589 Bacteria 10866
470 Ga0501073_0072076 3300049589 Bacteria 2406
471 Ga0501073_0123998 3300049589 Bacteria 1791
472 Ga0501073_0136080 3300049589 Bacteria 1703
473 Ga0501074_0003275 3300049590 Bacteria 11449
474 Ga0501074_0095465 3300049590 Bacteria 2129
475 Ga0501074_0250939 3300049590 Bacteria 1258
476 Ga0501075_0006942 3300049591 Bacteria 7823
477 Ga0501075_0037933 3300049591 Bacteria 3602
478 Ga0501075_0353567 3300049591 Bacteria 1120
479 Ga0501076_0004193 3300049592 Bacteria 10205
480 Ga0501076_0021863 3300049592 Bacteria 4911
481 Ga0501076_0026524 3300049592 Bacteria 4489
482 Ga0501076_0062683 3300049592 Bacteria 2961
483 Ga0501076_0072954 3300049592 Bacteria 2747
484 Ga0501077_0004559 3300049593 Bacteria 8425
485 Ga0501077_0004727 3300049593 Bacteria 8276
486 Ga0501077_0013310 3300049593 Bacteria 5159
487 Ga0501077_0035842 3300049593 Bacteria 3159
488 Ga0501077_0104506 3300049593 Bacteria 1795
489 Ga0501077_0192816 3300049593 Bacteria 1295
490 Ga0501077_0301333 3300049593 Bacteria 1021
491 Ga0501079_0023667 3300049741 Bacteria 4713
492 Ga0501079_0033312 3300049741 Bacteria 3963
493 Ga0501079_0041219 3300049741 Bacteria 3563
494 Ga0501079_0095380 3300049741 Bacteria 2305
495 Ga0501080_0009951 3300049742 Bacteria 8689
496 Ga0501080_0022098 3300049742 Bacteria 5893
497 Ga0501080_0063585 3300049742 Bacteria 3434
498 Ga0501080_0063723 3300049742 Bacteria 3430
499 Ga0501080_0065160 3300049742 Bacteria 3389
500 Ga0501080_0146559 3300049742 Bacteria 2182
501 Ga0501081_0008304 3300049743 Bacteria 6738
502 Ga0501083_0000261 3300049744 Bacteria 33465
503 Ga0501083_0007749 3300049744 Bacteria 7607
504 Ga0501083_0096767 3300049744 Bacteria 1948
505 Ga0501083_0098667 3300049744 Bacteria 1927
506 Ga0501035_0018764 3300049822 Bacteria 6370
507 Ga0501045_0011175 3300049824 Bacteria 6294
508 Ga0501045_0041771 3300049824 Bacteria 3337
509 Ga0501045_0047821 3300049824 Bacteria 3116
510 Ga0501045_0047914 3300049824 Bacteria 3114
511 Ga0501045_0083895 3300049824 Bacteria 2350
512 nmdc:mga00v17_122810_c1 3300050491 Bacteria 1655
513 nmdc:mga05p37_115633_c1 3300050507 Bacteria 3297
514 nmdc:mga05p37_118677_c1 3300050507 Bacteria 3250
515 nmdc:mga05p37_3924_c1 3300050507 Bacteria 17423
516 nmdc:mga05p37_41382_c1 3300050507 Bacteria 3182
517 nmdc:mga09592_1673_c1 3300050508 Bacteria 17864
518 nmdc:mga09592_96229_c1 3300050508 Bacteria 2533
519 nmdc:mga0qj67_13148_c1 3300050509 Bacteria 6250
520 nmdc:mga0qj67_188777_c1 3300050509 Bacteria 1675
521 nmdc:mga0qj67_206597_c1 3300050509 Bacteria 1595
522 nmdc:mga06r32_184290_c1 3300050510 Bacteria 2074
523 nmdc:mga06r32_23584_c1 3300050510 Bacteria 5696
524 nmdc:mga08y16_102617_c1 3300050511 Bacteria 2978
525 nmdc:mga08y16_7890_c1 3300050511 Bacteria 11140
526 nmdc:mga0n895_74801_c1 3300050512 Bacteria 3366
527 nmdc:mga08x19_83369_c1 3300050514 Bacteria 2101
528 nmdc:mga0a205_132125_c1 3300050515 Bacteria 2397
529 Ga0495601_0092359 3300053077 Bacteria 1949
530 Ga0495601_0144916 3300053077 Bacteria 1550
531 Ga0495601_0369576 3300053077 Bacteria 931
532 Ga0495619_0003090 3300053085 Bacteria 10812
533 Ga0495619_0044247 3300053085 Bacteria 2922
534 Ga0495619_0150177 3300053085 Bacteria 1607
535 Ga0495619_0152875 3300053085 Bacteria 1592
536 Ga0501084_0004713 3300054114 Bacteria 11142
537 Ga0501084_0009162 3300054114 Bacteria 8187
538 Ga0501084_0013268 3300054114 Bacteria 6819
539 Ga0501084_0014422 3300054114 Bacteria 6548
540 Ga0501084_0027240 3300054114 Bacteria 4776
541 Ga0501084_0182493 3300054114 Bacteria 1772
542 Ga0501084_0205184 3300054114 Bacteria 1663
543 Ga0501084_0229719 3300054114 Bacteria 1566
544 Ga0501082_0014088 3300060353 Bacteria 6878
545 Ga0501082_0023671 3300060353 Bacteria 5296
546 Ga0501082_0053746 3300060353 Bacteria 3471
547 Ga0501082_0067659 3300060353 Bacteria 3076
548 Ga0501082_0162786 3300060353 Bacteria 1939
549 Ga0501082_0223336 3300060353 Bacteria 1639
550 Ga0501082_0351126 3300060353 Bacteria 1286
551 Ga0530510_0004373 3300061734 Bacteria 9777
552 Ga0530510_0013295 3300061734 Bacteria 5786
553 Ga0530510_0106055 3300061734 Bacteria 2056
554 Ga0530510_0147381 3300061734 Bacteria 1736
555 Ga0530510_0187933 3300061734 Bacteria 1533
556 Ga0530510_0385050 3300061734 Bacteria 1056
557 2676486480 2675903059 Bacteria 8644972
558 2856742726 2856741275 Bacteria 8096094
559 2891404226 2891395885 Bacteria 9251614
560 2891562050 2891554331 Bacteria 8812224
561 8056060342 8056060235 Bacteria 7259403
562 Ga0081455_10017102
563 2214859106
564 ARcpr5oldR_c000569
565 ARcpr5yngRDRAFT_c000519
566 ARSoilOldRDRAFT_c000374
567 ARCol0yngRDRAFT_1000467
568 JGI24743J22301_10010145
569 JGI24745J21846_1003840
570 JGI24738J21930_10004267
571 JGI24738J21930_10022337
572 Ga0070658_10044664
573 Ga0070676_10123544
574 Ga0070683_100023502
575 Ga0070683_100060657
576 Ga0070683_100098500
577 Ga0070683_100147436
578 Ga0070683_100352449
579 Ga0070670_100000779
580 Ga0070670_100089874
581 Ga0068869_100040355
582 Ga0070680_100007563
583 Ga0070680_100039956
584 Ga0070680_100084877
585 Ga0070682_100050557
586 Ga0070682_100079273
587 Ga0068868_100024862
588 Ga0070660_100021237
589 Ga0070660_100048242
590 Ga0070660_100052971
591 Ga0070660_100107821
592 Ga0070689_100017813
593 Ga0070691_10014737
594 Ga0070691_10026999
595 Ga0070661_100040503
596 Ga0070661_100112240
597 Ga0070661_100145593
598 Ga0070692_10011739
599 Ga0070692_10030574
600 Ga0070692_10034615
601 Ga0070675_100039203
602 Ga0070675_100193424
603 Ga0070671_100013829
604 Ga0070674_100005560
605 Ga0070674_100100129
606 Ga0070673_100036018
607 Ga0070673_100052638
608 Ga0070688_100020479
609 Ga0070659_100029729
610 Ga0070659_100044401
611 Ga0070659_100045581
612 Ga0070659_100047377
613 Ga0070659_100351792
614 Ga0070701_10060569
615 Ga0070705_100012872
616 Ga0070694_100040069
617 Ga0070708_100342376
618 Ga0070662_100043544
619 Ga0070681_10095800
620 Ga0070681_10135491
621 Ga0070681_10185021
622 Ga0068867_100123201
623 Ga0068867_100135316
624 Ga0070685_10001347
625 Ga0070685_10032918
626 Ga0070679_100043156
627 Ga0070679_100239892
628 Ga0070684_100027955
629 Ga0070684_100047429
630 Ga0070684_100073081
631 Ga0070684_100089328
632 Ga0070684_100195328
633 Ga0068853_100215765
634 Ga0070672_100071109
635 Ga0070686_100024054
636 Ga0070696_100014568
637 Ga0070696_100019660
638 Ga0070693_100022292
639 Ga0070665_100033118
640 Ga0070704_100005859
641 Ga0070704_100006183
642 Ga0068855_100145196
643 Ga0070664_100013910
644 Ga0070664_100067626
645 Ga0070664_100284235
646 Ga0070664_100314400
647 Ga0068857_100100379
648 Ga0068857_100110094
649 Ga0068857_100138740
650 Ga0068854_100003120
651 Ga0068854_100018309
652 Ga0068856_100037332
653 Ga0068856_100061886
654 Ga0068852_100029553
655 Ga0068852_100183992
656 Ga0068852_100202368
657 Ga0068859_100047480
658 Ga0068864_100005943
659 Ga0068864_100238019
660 Ga0068866_10044136
661 Ga0068861_100085440
662 Ga0068861_100099802
663 Ga0068870_10000391
664 Ga0068870_10020319
665 Ga0068858_100003600
666 Ga0068860_100018493
667 Ga0068862_100090454
668 Ga0081455_10010944
669 Ga0081455_10122782
670 Ga0081455_10143796
671 Ga0081538_10011237
672 Ga0081538_10015639
673 Ga0081538_10015863
674 Ga0075365_10002270
675 Ga0075364_10002037
676 Ga0075364_10003525
677 Ga0075432_10001548
678 Ga0097621_100064403
679 Ga0068871_100125206
680 Ga0075428_100002822
681 Ga0075428_100007380
682 Ga0075428_100159110
683 Ga0075430_100005525
684 Ga0075430_100108703
685 Ga0075430_100183864
686 Ga0075431_100024961
687 Ga0075431_100033707
688 Ga0075434_100000750
689 Ga0075429_100001007
690 Ga0075429_100056225
691 Ga0075436_100252580
692 Ga0097620_100047480
693 Ga0111539_10009610
694 Ga0111539_10010900
695 Ga0111539_10014331
696 Ga0111539_10138730
697 Ga0105245_10023746
698 Ga0105245_10181551
699 Ga0105247_10008284
700 Ga0114129_10015238
701 Ga0114129_10025174
702 Ga0114129_10131094
703 Ga0114129_10132295
704 Ga0114129_10257329
705 Ga0114129_10469138
706 Ga0105243_10005354
707 Ga0105243_10147203
708 Ga0105243_10366276
709 Ga0105241_10019566
710 Ga0105242_10102110
711 Ga0105248_10118296
712 Ga0105237_10072225
713 Ga0105238_10014512
714 Ga0105238_10061458
715 Ga0105238_10206495
716 Ga0105249_10288263
717 Ga0105239_10016422
718 Ga0105239_10325418
719 Ga0105239_10333891
720 Ga0105246_10005838
721 Ga0105246_10111230
722 Ga0105246_10173646
723 Ga0105246_10174210
724 Ga0105246_10306018
725 Ga0157373_10094274
726 Ga0157371_10008624
727 Ga0157371_10041558
728 Ga0157371_10056415
729 Ga0157370_10007815
730 Ga0157370_10054635
731 Ga0157369_10015149
732 Ga0157369_10019578
733 Ga0163162_10064503
734 Ga0163162_10065604
735 Ga0163162_10091896
736 Ga0157372_10018156
737 Ga0157372_10044852
738 Ga0157372_10288592
739 Ga0157372_10467853
740 Ga0157375_10053420
741 Ga0163163_10260027
742 Ga0157380_10023704
743 Ga0157377_10042855
744 Ga0157377_10078174
745 Ga0157377_10083104
746 Ga0157376_10066889
747 Ga0157376_10229337
748 Ga0206356_10164439
749 Ga0207656_10084401
750 Ga0207688_10013385
751 Ga0207688_10016905
752 Ga0207688_10037730
753 Ga0207647_10033603
754 Ga0207645_10008705
755 Ga0207645_10132432
756 Ga0207643_10017677
757 Ga0207643_10069683
758 Ga0207705_10036171
759 Ga0207705_10337537
760 Ga0207654_10009686
761 Ga0207707_10027347
762 Ga0207707_10053257
763 Ga0207707_10067721
764 Ga0207707_10093558
765 Ga0207695_10215565
766 Ga0207660_10015417
767 Ga0207660_10093581
768 Ga0207660_10182955
769 Ga0207662_10015712
770 Ga0207657_10027117
771 Ga0207657_10028324
772 Ga0207657_10057144
773 Ga0207657_10098814
774 Ga0207649_10045224
775 Ga0207649_10075566
776 Ga0207649_10096056
777 Ga0207649_10112289
778 Ga0207652_10028842
779 Ga0207652_10030555
780 Ga0207652_10130765
781 Ga0207652_10233384
782 Ga0207694_10133306
783 Ga0207650_10004279
784 Ga0207650_10023615
785 Ga0207650_10104493
786 Ga0207650_10118125
787 Ga0207659_10012250
788 Ga0207659_10046475
789 Ga0207687_10007132
790 Ga0207687_10026830
791 Ga0207687_10082136
792 Ga0207664_10092114
793 Ga0207690_10034491
794 Ga0207690_10088771
795 Ga0207706_10018703
796 Ga0207706_10027232
797 Ga0207686_10103071
798 Ga0207709_10006518
799 Ga0207669_10034166
800 Ga0207704_10006199
801 Ga0207704_10155002
802 Ga0207691_10075781
803 Ga0207689_10032437
804 Ga0207661_10049394
805 Ga0207661_10051029
806 Ga0207661_10058001
807 Ga0207661_10064867
808 Ga0207661_10073348
809 Ga0207661_10098069
810 Ga0207661_10355736
811 Ga0207679_10009634
812 Ga0207679_10117859
813 Ga0207667_10175604
814 Ga0207651_10030085
815 Ga0207712_10085524
816 Ga0207712_10161654
817 Ga0207640_10016122
818 Ga0207640_10020233
819 Ga0207677_10031163
820 Ga0207703_10161617
821 Ga0207639_10180536
822 Ga0207678_10096027
823 Ga0207678_10169917
824 Ga0207708_10005911
825 Ga0207702_10036515
826 Ga0207702_10085826
827 Ga0207648_10075940
828 Ga0207648_10252012
829 Ga0207676_10059303
830 Ga0207676_10555489
831 Ga0207674_10085145
832 Ga0207674_10141411
833 Ga0207674_10238061
834 Ga0207675_100087369
835 Ga0207675_100117872
836 Ga0207683_10025244
837 Ga0207698_10089980
838 Ga0207698_10184671
839 Ga0207698_10218249
840 Ga0207698_10250612
841 Ga0207428_10003934
842 Ga0207428_10012776
843 Ga0207428_10030132
844 Ga0265319_1000528
845 Ga0265319_1004905
846 Ga0265334_10010876
847 Ga0265334_10039959
848 Ga0265318_10001202
849 Ga0265322_10001672
850 Ga0265338_10004638
851 Ga0265338_10021103
852 Ga0265338_10032441
853 Ga0265338_10056803
854 Ga0265328_10002649
855 Ga0265320_10010317
856 Ga0265320_10026230
857 Ga0265320_10067327
858 Ga0265325_10019559
859 Ga0265327_10015089
860 Ga0265327_10018675
861 Ga0265316_10018690
862 Ga0265313_10004921
863 Ga0265314_10018529
864 Ga0265314_10193648
865 Ga0265342_10004476
866 Ga0307413_10023217
867 Ga0307410_10051945
868 Ga0307410_10099471
869 Ga0307410_10325217
870 Ga0307406_10050155
871 Ga0307406_10065684
872 Ga0307406_10175770
873 Ga0307407_10016507
874 Ga0307412_10009650
875 Ga0307409_100007838
876 Ga0307409_100041981
877 Ga0307416_100064903
878 Ga0307416_100158766
879 Ga0307415_100002737
880 Ga0307415_100007395
881 Ga0307415_100047037
882 Ga0373959_0028132
883 Ga0373939_0009171
884 Ga0373960_0029654
885 Ga0373955_0088465
886 Ga0373955_0101592
887 Ga0373947_0005418
888 Ga0373947_0083293
889 Ga0373937_0071684
890 Ga0373925_0306888
891 Ga0395900_0005824
892 Ga0395898_0053774
893 Ga0395905_0061565
894 Ga0395901_0053524
895 Ga0439453_0009007
896 Ga0439455_0021194
897 Ga0450915_000026
898 Ga0450920_014309
899 Ga0466963_0024303
900 Ga0495592_0052657
901 Ga0495592_0145673
902 Ga0495592_0277803
903 Ga0495603_0000455
904 Ga0495629_0011041
905 Ga0495629_0324171
906 Ga0495641_0050990
907 Ga0495641_0106283
908 Ga0495641_0138307
909 Ga0495651_0094723
910 Ga0495653_0046685
911 Ga0495582_0088917
912 Ga0495585_0058104
913 Ga0495594_0002018
914 Ga0495608_0071542
915 Ga0495608_0137704
916 Ga0495618_0237900
917 Ga0495630_0020682
918 Ga0495630_0037928
919 Ga0495652_0134199
920 Ga0495640_0023434
921 Ga0495586_0005447
922 Ga0495645_0002901
923 Ga0495667_0043174
924 Ga0495667_0051033
925 Ga0495634_0096174
926 Ga0495635_0098375
927 Ga0495657_0065115
928 Ga0495623_0155304
929 Ga0495646_0085773
930 Ga0495658_0173663
931 Ga0495613_0130309
932 Ga0495600_0039532
933 Ga0495600_0076314
934 Ga0495604_0177407
935 Ga0495604_0178519
936 Ga0495674_0000208
937 Ga0495676_0012013
938 Ga0495676_0245283
939 Ga0495680_0039421
940 Ga0495680_0131980
941 Ga0495680_0151635
942 Ga0495684_0095585
943 Ga0495684_0308338
944 Ga0495602_0073230
945 Ga0496100_0322260
946 Ga0496101_0037959
947 Ga0496102_0346800
948 Ga0496103_0166194
949 Ga0496104_0001500
950 Ga0496104_0005885
951 Ga0496105_0002019
952 Ga0496105_0043833
953 Ga0496105_0071450
954 Ga0496106_0006858
955 Ga0496106_0165706
956 Ga0496107_0246020
957 Ga0496107_0295553
958 Ga0496108_0002150
959 Ga0496108_0013508
960 Ga0496108_0070778
961 Ga0496108_0348859
962 Ga0496109_0004335
963 Ga0496109_0005661
964 Ga0496109_0040309
965 Ga0496109_0511415
966 Ga0496110_0000458
967 Ga0496110_0016162
968 Ga0496110_0037304
969 Ga0496110_0213549
970 Ga0496111_0000956
971 Ga0496111_0045058
972 Ga0496112_0222223
973 Ga0496112_0519587
974 Ga0496113_0093000
975 Ga0496113_0134058
976 Ga0496113_0321495
977 Ga0496114_0023029
978 Ga0496115_0166876
979 Ga0496115_0196298
980 Ga0501031_0002988
981 Ga0501031_0003464
982 Ga0501032_0028238
983 Ga0501033_0002483
984 Ga0501033_0089779
985 Ga0501033_0198902
986 Ga0501036_0014763
987 Ga0501036_0028360
988 Ga0501036_0099719
989 Ga0501036_0221421
990 Ga0501036_0477992
991 Ga0501037_0089907
992 Ga0501038_0008091
993 Ga0501038_0225050
994 Ga0501039_0002083
995 Ga0501039_0060306
996 Ga0501040_0003382
997 Ga0501040_0016506
998 Ga0501040_0042145
999 Ga0501040_0083608
1000 Ga0501040_0100572
1001 Ga0501040_0170173
1002 Ga0501040_0179576
1003 Ga0501040_0328537
1004 Ga0501041_0000551
1005 Ga0501041_0021703
1006 Ga0501042_0003535
1007 Ga0501042_0019014
1008 Ga0501042_0118604
1009 Ga0501043_0000789
1010 Ga0501043_0011277
1011 Ga0501046_0001480
1012 Ga0501046_0152395
1013 Ga0501048_0000790
1014 Ga0501048_0043804
1015 Ga0501067_0025986
1016 Ga0501067_0252281
1017 Ga0501068_0003371
1018 Ga0501069_0000210
1019 Ga0501069_0127287
1020 Ga0501070_0006667
1021 Ga0501070_0334267
1022 Ga0501071_0003192
1023 Ga0501071_0013520
1024 Ga0501071_0038436
1025 Ga0501071_0044734
1026 Ga0501071_0048200
1027 Ga0501071_0106167
1028 Ga0501072_0012017
1029 Ga0501072_0142984
1030 Ga0501073_0004150
1031 Ga0501073_0072076
1032 Ga0501073_0123998
1033 Ga0501073_0136080
1034 Ga0501074_0003275
1035 Ga0501074_0095465
1036 Ga0501074_0250939
1037 Ga0501075_0006942
1038 Ga0501075_0037933
1039 Ga0501075_0353567
1040 Ga0501076_0004193
1041 Ga0501076_0021863
1042 Ga0501076_0026524
1043 Ga0501076_0062683
1044 Ga0501076_0072954
1045 Ga0501077_0004559
1046 Ga0501077_0004727
1047 Ga0501077_0013310
1048 Ga0501077_0035842
1049 Ga0501077_0104506
1050 Ga0501077_0192816
1051 Ga0501077_0301333
1052 Ga0501079_0023667
1053 Ga0501079_0033312
1054 Ga0501079_0041219
1055 Ga0501079_0095380
1056 Ga0501080_0009951
1057 Ga0501080_0022098
1058 Ga0501080_0063585
1059 Ga0501080_0063723
1060 Ga0501080_0065160
1061 Ga0501080_0146559
1062 Ga0501081_0008304
1063 Ga0501083_0000261
1064 Ga0501083_0007749
1065 Ga0501083_0096767
1066 Ga0501083_0098667
1067 Ga0501035_0018764
1068 Ga0501045_0011175
1069 Ga0501045_0041771
1070 Ga0501045_0047821
1071 Ga0501045_0047914
1072 Ga0501045_0083895
1073 nmdc:mga00v17_122810_c1
1074 nmdc:mga05p37_115633_c1
1075 nmdc:mga05p37_118677_c1
1076 nmdc:mga05p37_3924_c1
1077 nmdc:mga05p37_41382_c1
1078 nmdc:mga09592_1673_c1
1079 nmdc:mga09592_96229_c1
1080 nmdc:mga0qj67_13148_c1
1081 nmdc:mga0qj67_188777_c1
1082 nmdc:mga0qj67_206597_c1
1083 nmdc:mga06r32_184290_c1
1084 nmdc:mga06r32_23584_c1
1085 nmdc:mga08y16_102617_c1
1086 nmdc:mga08y16_7890_c1
1087 nmdc:mga0n895_74801_c1
1088 nmdc:mga08x19_83369_c1
1089 nmdc:mga0a205_132125_c1
1090 Ga0495601_0092359
1091 Ga0495601_0144916
1092 Ga0495601_0369576
1093 Ga0495619_0003090
1094 Ga0495619_0044247
1095 Ga0495619_0150177
1096 Ga0495619_0152875
1097 Ga0501084_0004713
1098 Ga0501084_0009162
1099 Ga0501084_0013268
1100 Ga0501084_0014422
1101 Ga0501084_0027240
1102 Ga0501084_0182493
1103 Ga0501084_0205184
1104 Ga0501084_0229719
1105 Ga0501082_0014088
1106 Ga0501082_0023671
1107 Ga0501082_0053746
1108 Ga0501082_0067659
1109 Ga0501082_0162786
1110 Ga0501082_0223336
1111 Ga0501082_0351126
1112 Ga0530510_0004373
1113 Ga0530510_0013295
1114 Ga0530510_0106055
1115 Ga0530510_0147381
1116 Ga0530510_0187933
1117 Ga0530510_0385050
1118 2676486480
1119 2856742726
1120 2891404226
1121 2891562050
1122 8056060342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

111

313

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.817 95 318
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8028 93 318
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7892 95 318
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.7702 94 308
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7632 93 318
ID Description Score Start End Superfamily
af_Q2FZQ9_85_310_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8675 91 314 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.863 87 321 1.10.3720.10
af_Q2FZQ9_85_310_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8571 91 314 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8522 87 321 1.10.3720.10
af_P0AGH3_48_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8519 75 319 1.10.3720.10
ID Description Score Start End GO Terms
AF-R6RMP5-F1-model_v4 deleted 0.9122 6 314
AF-A0A355BJE6-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9079 3 314 GO:0005886
GO:0055085
AF-F2L338-F1-model_v4 Dipeptide ABC transporter, permease protein 0.9058 4 321 GO:0005886
GO:0055085
AF-A0A418KVJ6-F1-model_v4 ABC transporter permease 0.9033 1 322 GO:0005886
GO:0055085
AF-A0A2G5W2D9-F1-model_v4 Peptide ABC transporter permease 0.8995 3 324 GO:0005886
GO:0055085

Map