F463797

General Info

Members Datasets Scaffolds Average Seq Length
561 235 1122 101

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100176846|Ga0070686_1001768463
Length 112
Sequence MRPEEFQRHVQAALDRLPPELARALDNVAVVVEDENPEDPDLFGLYLGVPLPERGTGYFGQLPDQIAIYRLPLEDEFPDRDELVEEIRITVLHELAHYFGIDEDRLAELGYE

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
137 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
138 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
141 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
142 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
168 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
179 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 1.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 12.12
Rhizosphere 86.81
Stem 0
Stem Tuber 0
Unclassified 11.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100176846 3300005544 Unclassified 1513
2 Ga0070658_10050615 3300005327 Bacteria 3367
3 Ga0070658_10122191 3300005327 Bacteria 2164
4 Ga0070658_10186633 3300005327 Bacteria 1746
5 Ga0070658_10324093 3300005327 Bacteria 1316
6 Ga0070658_10534912 3300005327 Bacteria 1014
7 Ga0070676_11513468 3300005328 Unclassified 517
8 Ga0070683_100020571 3300005329 Bacteria 5872
9 Ga0070683_100134847 3300005329 Bacteria 2338
10 Ga0070683_100314442 3300005329 Bacteria 1490
11 Ga0070683_100501544 3300005329 Bacteria 1159
12 Ga0070680_100034413 3300005336 Bacteria 4084
13 Ga0070680_100131435 3300005336 Bacteria 2095
14 Ga0070680_100414695 3300005336 Bacteria 1149
15 Ga0070680_100590068 3300005336 Bacteria 953
16 Ga0070680_100686791 3300005336 Bacteria 881
17 Ga0070680_100797261 3300005336 Unclassified 814
18 Ga0070680_101197668 3300005336 Unclassified 657
19 Ga0070682_100574899 3300005337 Bacteria 886
20 Ga0070682_100604348 3300005337 Bacteria 867
21 Ga0068868_100519846 3300005338 Bacteria 1045
22 Ga0068868_100560777 3300005338 Bacteria 1008
23 Ga0068868_100613675 3300005338 Unclassified 965
24 Ga0070660_100010753 3300005339 Bacteria 6479
25 Ga0070660_100099004 3300005339 Bacteria 2308
26 Ga0070660_100635325 3300005339 Bacteria 894
27 Ga0070660_100728123 3300005339 Bacteria 832
28 Ga0070660_101290704 3300005339 Bacteria 619
29 Ga0070660_101749603 3300005339 Bacteria 529
30 Ga0070691_10222211 3300005341 Bacteria 1001
31 Ga0070661_100026708 3300005344 Bacteria 4153
32 Ga0070661_100047595 3300005344 Bacteria 3139
33 Ga0070661_100088372 3300005344 Bacteria 2293
34 Ga0070661_100318321 3300005344 Bacteria 1215
35 Ga0070668_100005655 3300005347 Bacteria 9267
36 Ga0070671_102013954 3300005355 Bacteria 514
37 Ga0070659_100074090 3300005366 Bacteria 2711
38 Ga0070659_100367045 3300005366 Bacteria 1210
39 Ga0070659_100408860 3300005366 Bacteria 1147
40 Ga0070659_100725525 3300005366 Bacteria 861
41 Ga0070714_100350830 3300005435 Bacteria 1386
42 Ga0070714_100378805 3300005435 Bacteria 1333
43 Ga0070714_101286726 3300005435 Bacteria 714
44 Ga0070713_100209069 3300005436 Bacteria 1766
45 Ga0070713_100667827 3300005436 Bacteria 991
46 Ga0070713_101662666 3300005436 Bacteria 620
47 Ga0070710_10597125 3300005437 Unclassified 768
48 Ga0070710_10708574 3300005437 Bacteria 711
49 Ga0070711_100673962 3300005439 Bacteria 869
50 Ga0070705_100173808 3300005440 Unclassified 1452
51 Ga0070705_100707360 3300005440 Archaea 792
52 Ga0070708_100087600 3300005445 Bacteria 2830
53 Ga0070708_100285087 3300005445 Bacteria 1555
54 Ga0070662_100006236 3300005457 Bacteria 7679
55 Ga0070681_10002637 3300005458 Bacteria 16464
56 Ga0070681_10006033 3300005458 Bacteria 11742
57 Ga0070681_10009016 3300005458 Bacteria 9805
58 Ga0070681_10088542 3300005458 Bacteria 3047
59 Ga0070681_10230969 3300005458 Bacteria 1765
60 Ga0070681_10292266 3300005458 Bacteria 1539
61 Ga0070681_10309694 3300005458 Bacteria 1488
62 Ga0070681_10598751 3300005458 Bacteria 1017
63 Ga0070681_10738911 3300005458 Bacteria 900
64 Ga0070685_10452916 3300005466 Unclassified 899
65 Ga0070706_100063585 3300005467 Bacteria 3410
66 Ga0070706_100075009 3300005467 Bacteria 3130
67 Ga0070706_100237312 3300005467 Bacteria 1703
68 Ga0070706_100331666 3300005467 Bacteria 1419
69 Ga0070707_100002425 3300005468 Bacteria 17768
70 Ga0070707_100215801 3300005468 Bacteria 1870
71 Ga0070707_100537128 3300005468 Bacteria 1131
72 Ga0070707_101009002 3300005468 Unclassified 798
73 Ga0070698_100080378 3300005471 Bacteria 3255
74 Ga0070698_100192879 3300005471 Bacteria 1974
75 Ga0070698_100287962 3300005471 Bacteria 1574
76 Ga0070698_101096225 3300005471 Bacteria 745
77 Ga0070698_101255664 3300005471 Bacteria 690
78 Ga0070699_100005859 3300005518 Bacteria 10730
79 Ga0070699_100042021 3300005518 Bacteria 3955
80 Ga0070699_101959152 3300005518 Unclassified 536
81 Ga0070679_100003184 3300005530 Bacteria 14999
82 Ga0070679_100020221 3300005530 Bacteria 6489
83 Ga0070679_100066650 3300005530 Bacteria 3589
84 Ga0070679_100075317 3300005530 Bacteria 3365
85 Ga0070679_100247485 3300005530 Bacteria 1739
86 Ga0070684_100128756 3300005535 Bacteria 2282
87 Ga0070684_100131482 3300005535 Bacteria 2258
88 Ga0070684_100359639 3300005535 Bacteria 1340
89 Ga0070684_100376918 3300005535 Bacteria 1306
90 Ga0070684_100403434 3300005535 Bacteria 1261
91 Ga0070697_100166610 3300005536 Bacteria 1863
92 Ga0070672_100342113 3300005543 Bacteria 1274
93 Ga0070695_100853832 3300005545 Bacteria 733
94 Ga0070696_100062017 3300005546 Unclassified 2616
95 Ga0070696_100320500 3300005546 Bacteria 1193
96 Ga0070696_101985292 3300005546 Bacteria 505
97 Ga0070693_100489185 3300005547 Bacteria 871
98 Ga0070665_100031500 3300005548 Bacteria 5337
99 Ga0070665_100455104 3300005548 Bacteria 1290
100 Ga0070704_100322967 3300005549 Unclassified 1294
101 Ga0068855_100008848 3300005563 Bacteria 12171
102 Ga0068855_100025569 3300005563 Bacteria 7061
103 Ga0068855_100103891 3300005563 Bacteria 3268
104 Ga0068855_100169663 3300005563 Bacteria 2472
105 Ga0068855_100213627 3300005563 Bacteria 2166
106 Ga0068855_102115198 3300005563 Unclassified 566
107 Ga0070664_101566435 3300005564 Bacteria 624
108 Ga0068857_100021870 3300005577 Bacteria 5628
109 Ga0068857_100207253 3300005577 Bacteria 1788
110 Ga0068856_100009210 3300005614 Bacteria 9598
111 Ga0068856_100084884 3300005614 Bacteria 3146
112 Ga0068856_100846910 3300005614 Bacteria 933
113 Ga0068856_100934399 3300005614 Bacteria 886
114 Ga0068856_101325934 3300005614 Bacteria 735
115 Ga0068852_100122474 3300005616 Bacteria 2384
116 Ga0068852_100299316 3300005616 Bacteria 1556
117 Ga0068852_101936730 3300005616 Bacteria 611
118 Ga0068861_100072716 3300005719 Bacteria 2668
119 Ga0068851_10453307 3300005834 Unclassified 763
120 Ga0068862_100299178 3300005844 Bacteria 1480
121 Ga0081455_10050008 3300005937 Bacteria 3598
122 Ga0070717_10538858 3300006028 Bacteria 1057
123 Ga0075365_10075189 3300006038 Bacteria 2279
124 Ga0075432_10167839 3300006058 Bacteria 852
125 Ga0070715_10070665 3300006163 Bacteria 1559
126 Ga0070715_11055901 3300006163 Bacteria 509
127 Ga0070716_100197317 3300006173 Bacteria 1335
128 Ga0070716_100525006 3300006173 Unclassified 878
129 Ga0070712_100060008 3300006175 Bacteria 2681
130 Ga0070712_100452108 3300006175 Bacteria 1070
131 Ga0075367_10367785 3300006178 Bacteria 908
132 Ga0097621_100489691 3300006237 Bacteria 1113
133 Ga0075431_100307089 3300006847 Bacteria 1602
134 Ga0075431_100418609 3300006847 Unclassified 1339
135 Ga0075433_10032576 3300006852 Bacteria 4464
136 Ga0075434_100008855 3300006871 Bacteria 9368
137 Ga0075434_100876792 3300006871 Bacteria 913
138 Ga0075434_101130509 3300006871 Bacteria 796
139 Ga0075429_100813820 3300006880 Bacteria 818
140 Ga0075436_100003758 3300006914 Bacteria 10404
141 Ga0075435_100004861 3300007076 Bacteria 9304
142 Ga0105240_10026386 3300009093 Bacteria 7621
143 Ga0105240_10044617 3300009093 Bacteria 5631
144 Ga0105240_10090329 3300009093 Bacteria 3744
145 Ga0105240_10121599 3300009093 Bacteria 3143
146 Ga0105240_10891208 3300009093 Bacteria 958
147 Ga0105240_11355358 3300009093 Bacteria 749
148 Ga0105240_11386485 3300009093 Bacteria 739
149 Ga0105240_11596779 3300009093 Unclassified 682
150 Ga0105240_12023319 3300009093 Unclassified 598
151 Ga0111539_10161096 3300009094 Bacteria 2624
152 Ga0105245_10035981 3300009098 Bacteria 4396
153 Ga0105245_10096779 3300009098 Bacteria 2725
154 Ga0105245_10172207 3300009098 Bacteria 2062
155 Ga0105245_10674128 3300009098 Bacteria 1066
156 Ga0105245_10847126 3300009098 Unclassified 954
157 Ga0105245_11506806 3300009098 Bacteria 723
158 Ga0105245_11625374 3300009098 Bacteria 698
159 Ga0114129_10051501 3300009147 Bacteria 5780
160 Ga0114129_10083758 3300009147 Bacteria 4428
161 Ga0105243_10412813 3300009148 Bacteria 1257
162 Ga0105243_11325667 3300009148 Bacteria 738
163 Ga0105241_10660774 3300009174 Bacteria 950
164 Ga0105242_10081652 3300009176 Bacteria 2704
165 Ga0105248_10298900 3300009177 Bacteria 1813
166 Ga0105248_10334035 3300009177 Bacteria 1707
167 Ga0105248_11084576 3300009177 Bacteria 905
168 Ga0105248_11416805 3300009177 Unclassified 786
169 Ga0105237_10094048 3300009545 Bacteria 2987
170 Ga0105237_10337214 3300009545 Bacteria 1512
171 Ga0105238_11500888 3300009551 Bacteria 703
172 Ga0105238_11535804 3300009551 Bacteria 695
173 Ga0105238_12894510 3300009551 Bacteria 516
174 Ga0105249_10052030 3300009553 Bacteria 3739
175 Ga0105239_10144757 3300010375 Bacteria 2650
176 Ga0105239_10806051 3300010375 Bacteria 1076
177 Ga0105239_11528657 3300010375 Bacteria 771
178 Ga0105239_12027762 3300010375 Unclassified 668
179 Ga0105239_12230101 3300010375 Unclassified 637
180 Ga0157371_10967005 3300013102 Unclassified 648
181 Ga0157370_10042839 3300013104 Bacteria 4359
182 Ga0157370_10093650 3300013104 Bacteria 2819
183 Ga0157370_10202926 3300013104 Bacteria 1839
184 Ga0157370_10437861 3300013104 Bacteria 1202
185 Ga0157370_10508229 3300013104 Bacteria 1106
186 Ga0157370_10535809 3300013104 Bacteria 1074
187 Ga0157369_10009136 3300013105 Bacteria 11343
188 Ga0157369_10062331 3300013105 Bacteria 4019
189 Ga0157369_10093408 3300013105 Bacteria 3211
190 Ga0157369_10128341 3300013105 Bacteria 2687
191 Ga0157369_10362901 3300013105 Bacteria 1504
192 Ga0157369_11591686 3300013105 Bacteria 664
193 Ga0157374_10052148 3300013296 Bacteria 3809
194 Ga0157374_10331288 3300013296 Bacteria 1510
195 Ga0157374_10390746 3300013296 Bacteria 1387
196 Ga0157374_11354704 3300013296 Unclassified 734
197 Ga0157378_11034393 3300013297 Bacteria 856
198 Ga0163162_10020387 3300013306 Bacteria 6514
199 Ga0157372_10155013 3300013307 Bacteria 2645
200 Ga0157372_10222008 3300013307 Bacteria 2190
201 Ga0157372_10329807 3300013307 Unclassified 1777
202 Ga0157372_10427340 3300013307 Bacteria 1544
203 Ga0157372_10927753 3300013307 Bacteria 1009
204 Ga0157372_11456873 3300013307 Bacteria 789
205 Ga0157375_10112595 3300013308 Bacteria 2822
206 Ga0157375_10382709 3300013308 Bacteria 1574
207 Ga0157375_10791972 3300013308 Bacteria 1097
208 Ga0163163_11113419 3300014325 Bacteria 852
209 Ga0157380_10201203 3300014326 Bacteria 1767
210 Ga0157380_10969562 3300014326 Unclassified 881
211 Ga0182008_10947949 3300014497 Unclassified 510
212 Ga0157377_10191015 3300014745 Bacteria 1294
213 Ga0157379_10878196 3300014968 Bacteria 850
214 Ga0157379_12638299 3300014968 Bacteria 503
215 Ga0182007_10077008 3300015262 Bacteria 1093
216 Ga0163161_10225356 3300017792 Bacteria 1453
217 Ga0197907_10848292 3300020069 Bacteria 782
218 Ga0197907_11205344 3300020069 Unclassified 774
219 Ga0206356_11512664 3300020070 Bacteria 1756
220 Ga0206354_10518964 3300020081 Bacteria 6378
221 Ga0206353_11022866 3300020082 Bacteria 1110
222 Ga0206353_11683046 3300020082 Bacteria 2874
223 Ga0206353_11947549 3300020082 Bacteria 957
224 Ga0213873_10128903 3300021358 Bacteria 748
225 Ga0207656_10188725 3300025321 Bacteria 992
226 Ga0207692_10854779 3300025898 Bacteria 597
227 Ga0207692_11098176 3300025898 Bacteria 527
228 Ga0207685_10023009 3300025905 Archaea 2115
229 Ga0207705_10045053 3300025909 Bacteria 3170
230 Ga0207705_10417844 3300025909 Bacteria 1038
231 Ga0207705_10511029 3300025909 Bacteria 933
232 Ga0207705_10545681 3300025909 Bacteria 901
233 Ga0207684_10072819 3300025910 Bacteria 2918
234 Ga0207684_10192989 3300025910 Bacteria 1757
235 Ga0207684_10669703 3300025910 Unclassified 883
236 Ga0207684_10734042 3300025910 Unclassified 838
237 Ga0207654_10635200 3300025911 Bacteria 764
238 Ga0207707_10004771 3300025912 Bacteria 11890
239 Ga0207707_10054775 3300025912 Bacteria 3471
240 Ga0207707_10068426 3300025912 Bacteria 3094
241 Ga0207707_10227913 3300025912 Bacteria 1621
242 Ga0207707_10347881 3300025912 Bacteria 1277
243 Ga0207707_10395634 3300025912 Bacteria 1187
244 Ga0207707_10799492 3300025912 Bacteria 786
245 Ga0207707_10864700 3300025912 Unclassified 749
246 Ga0207707_10999111 3300025912 Bacteria 687
247 Ga0207707_11180949 3300025912 Unclassified 620
248 Ga0207695_10303659 3300025913 Bacteria 1487
249 Ga0207695_10717549 3300025913 Bacteria 880
250 Ga0207671_10167432 3300025914 Bacteria 1705
251 Ga0207671_10427630 3300025914 Bacteria 1054
252 Ga0207693_10191469 3300025915 Bacteria 1609
253 Ga0207693_10532908 3300025915 Bacteria 916
254 Ga0207663_10889228 3300025916 Bacteria 712
255 Ga0207663_11492581 3300025916 Bacteria 544
256 Ga0207660_10029435 3300025917 Bacteria 3767
257 Ga0207660_10080672 3300025917 Bacteria 2390
258 Ga0207660_10184845 3300025917 Bacteria 1620
259 Ga0207660_10411212 3300025917 Bacteria 1090
260 Ga0207660_10575659 3300025917 Bacteria 916
261 Ga0207657_10001335 3300025919 Bacteria 26208
262 Ga0207657_10006912 3300025919 Bacteria 11704
263 Ga0207657_10009706 3300025919 Bacteria 9652
264 Ga0207657_10282297 3300025919 Bacteria 1318
265 Ga0207657_10532419 3300025919 Bacteria 919
266 Ga0207657_10589618 3300025919 Bacteria 868
267 Ga0207649_10056126 3300025920 Bacteria 2458
268 Ga0207649_10065746 3300025920 Bacteria 2297
269 Ga0207649_10131499 3300025920 Bacteria 1700
270 Ga0207649_10222673 3300025920 Bacteria 1345
271 Ga0207652_10088699 3300025921 Bacteria 2714
272 Ga0207652_10178723 3300025921 Bacteria 1906
273 Ga0207652_10375972 3300025921 Bacteria 1282
274 Ga0207652_10551141 3300025921 Bacteria 1036
275 Ga0207652_11128752 3300025921 Bacteria 685
276 Ga0207646_10002167 3300025922 Bacteria 23455
277 Ga0207646_10341702 3300025922 Bacteria 1352
278 Ga0207646_10594581 3300025922 Bacteria 993
279 Ga0207694_11610974 3300025924 Unclassified 547
280 Ga0207687_10166207 3300025927 Unclassified 1697
281 Ga0207687_10721441 3300025927 Bacteria 847
282 Ga0207687_11006695 3300025927 Unclassified 715
283 Ga0207700_10140105 3300025928 Bacteria 1986
284 Ga0207700_10490273 3300025928 Bacteria 1087
285 Ga0207700_11154864 3300025928 Bacteria 692
286 Ga0207644_11173632 3300025931 Bacteria 645
287 Ga0207690_10070270 3300025932 Bacteria 2411
288 Ga0207690_10499954 3300025932 Bacteria 983
289 Ga0207690_10787576 3300025932 Bacteria 785
290 Ga0207706_10005271 3300025933 Bacteria 12055
291 Ga0207686_10213243 3300025934 Bacteria 1389
292 Ga0207709_10052863 3300025935 Bacteria 2497
293 Ga0207670_10228163 3300025936 Bacteria 1429
294 Ga0207665_10224095 3300025939 Bacteria 1379
295 Ga0207665_10399031 3300025939 Bacteria 1047
296 Ga0207665_10537448 3300025939 Archaea 907
297 Ga0207665_10857294 3300025939 Unclassified 719
298 Ga0207691_10418617 3300025940 Bacteria 1142
299 Ga0207711_10434658 3300025941 Unclassified 1221
300 Ga0207711_10541526 3300025941 Bacteria 1086
301 Ga0207661_10316006 3300025944 Bacteria 1403
302 Ga0207661_10483741 3300025944 Bacteria 1130
303 Ga0207661_10568628 3300025944 Unclassified 1039
304 Ga0207661_10599521 3300025944 Bacteria 1011
305 Ga0207661_11007053 3300025944 Bacteria 767
306 Ga0207679_10411653 3300025945 Bacteria 1191
307 Ga0207667_10045388 3300025949 Bacteria 4654
308 Ga0207667_10224526 3300025949 Bacteria 1924
309 Ga0207667_10228831 3300025949 Bacteria 1904
310 Ga0207667_10241872 3300025949 Bacteria 1847
311 Ga0207667_10566217 3300025949 Bacteria 1148
312 Ga0207667_10596032 3300025949 Bacteria 1115
313 Ga0207667_11587121 3300025949 Bacteria 623
314 Ga0207712_10016540 3300025961 Bacteria 4780
315 Ga0207677_10326147 3300026023 Bacteria 1278
316 Ga0207677_10532673 3300026023 Unclassified 1021
317 Ga0207639_10056760 3300026041 Bacteria 3002
318 Ga0207639_10965273 3300026041 Bacteria 798
319 Ga0207678_10100820 3300026067 Bacteria 2466
320 Ga0207702_10026075 3300026078 Bacteria 4853
321 Ga0207702_10335717 3300026078 Bacteria 1443
322 Ga0207702_11490409 3300026078 Bacteria 670
323 Ga0207641_11499334 3300026088 Bacteria 676
324 Ga0207648_10181497 3300026089 Bacteria 1863
325 Ga0207674_10018031 3300026116 Bacteria 7688
326 Ga0207674_10899010 3300026116 Bacteria 853
327 Ga0207675_100000664 3300026118 Bacteria 33832
328 Ga0207683_11561632 3300026121 Bacteria 609
329 Ga0207698_10084400 3300026142 Bacteria 2575
330 Ga0207698_10343177 3300026142 Bacteria 1407
331 Ga0207698_12613707 3300026142 Bacteria 514
332 Ga0207428_10259598 3300027907 Unclassified 1294
333 Ga0268266_10338948 3300028379 Bacteria 1411
334 Ga0268266_10404355 3300028379 Bacteria 1291
335 Ga0268265_11621076 3300028380 Bacteria 652
336 Ga0265337_1078561 3300028556 Unclassified 904
337 Ga0265326_10010223 3300028558 Bacteria 2789
338 Ga0265326_10092832 3300028558 Bacteria 855
339 Ga0265319_1004104 3300028563 Bacteria 7329
340 Ga0265334_10015955 3300028573 Bacteria 3114
341 Ga0265318_10000220 3300028577 Bacteria 49763
342 Ga0265322_10002759 3300028654 Bacteria 5371
343 Ga0265322_10023263 3300028654 Bacteria 1772
344 Ga0265336_10183132 3300028666 Bacteria 623
345 Ga0265336_10246634 3300028666 Unclassified 531
346 Ga0265338_10015604 3300028800 Bacteria 8325
347 Ga0265338_10155536 3300028800 Bacteria 1771
348 Ga0265338_10250383 3300028800 Bacteria 1307
349 Ga0265338_10556431 3300028800 Bacteria 802
350 Ga0265324_10084124 3300029957 Unclassified 1082
351 Ga0265330_10002778 3300031235 Bacteria 9395
352 Ga0265330_10220928 3300031235 Bacteria 800
353 Ga0265330_10463774 3300031235 Bacteria 538
354 Ga0265332_10003330 3300031238 Bacteria 7794
355 Ga0265328_10029907 3300031239 Bacteria 2031
356 Ga0265320_10004689 3300031240 Bacteria 8920
357 Ga0265325_10002188 3300031241 Bacteria 13300
358 Ga0265325_10026185 3300031241 Bacteria 3162
359 Ga0265325_10143425 3300031241 Bacteria 1134
360 Ga0265329_10008893 3300031242 Bacteria 3782
361 Ga0265329_10039955 3300031242 Bacteria 1506
362 Ga0265340_10048177 3300031247 Bacteria 2073
363 Ga0265339_10037888 3300031249 Bacteria 2692
364 Ga0265339_10095216 3300031249 Bacteria 1555
365 Ga0265331_10044454 3300031250 Bacteria 2148
366 Ga0265331_10124646 3300031250 Bacteria 1177
367 Ga0265327_10004096 3300031251 Bacteria 13173
368 Ga0265327_10032367 3300031251 Bacteria 2927
369 Ga0265327_10068889 3300031251 Bacteria 1778
370 Ga0265316_10012728 3300031344 Bacteria 7520
371 Ga0265316_10015767 3300031344 Bacteria 6590
372 Ga0265316_10343601 3300031344 Bacteria 1081
373 Ga0307408_101230401 3300031548 Bacteria 699
374 Ga0265313_10115353 3300031595 Unclassified 1177
375 Ga0265314_10003582 3300031711 Bacteria 14953
376 Ga0265314_10004402 3300031711 Bacteria 13086
377 Ga0265314_10045418 3300031711 Bacteria 3106
378 Ga0265342_10022633 3300031712 Bacteria 3992
379 Ga0265342_10122444 3300031712 Bacteria 1463
380 Ga0316576_10033796 3300031727 Bacteria 3642
381 Ga0316578_10093884 3300031728 Bacteria 1794
382 Ga0316578_10193241 3300031728 Unclassified 1226
383 Ga0307405_10108747 3300031731 Bacteria 1874
384 Ga0316577_10120371 3300031733 Bacteria 1475
385 Ga0307412_10078946 3300031911 Bacteria 2269
386 Ga0307416_100129998 3300032002 Bacteria 2265
387 Ga0307415_100395073 3300032126 Bacteria 1179
388 Ga0316580_10037238 3300032139 Bacteria 1505
389 Ga0316580_10055587 3300032139 Bacteria 1217
390 Ga0316588_1127229 3300033528 Bacteria 646
391 Ga0316574_0029677 3300035398 Bacteria 3305
392 Ga0316574_0119887 3300035398 Bacteria 1689
393 Ga0316574_0293133 3300035398 Bacteria 1035
394 Ga0316574_0446839 3300035398 Bacteria 810
395 Ga0373935_0800476 3300035692 Bacteria 696
396 Ga0316584_0552034 3300036712 Bacteria 804
397 Ga0395899_0066149 3300037312 Bacteria 2654
398 Ga0395899_0116877 3300037312 Bacteria 1913
399 Ga0395899_0152060 3300037312 Bacteria 1639
400 Ga0395899_0221159 3300037312 Bacteria 1312
401 Ga0395899_0259856 3300037312 Bacteria 1188
402 Ga0395899_0304804 3300037312 Bacteria 1077
403 Ga0395899_0400832 3300037312 Bacteria 908
404 Ga0395900_0028944 3300037418 Bacteria 5679
405 Ga0395900_0039294 3300037418 Bacteria 4875
406 Ga0395900_0129346 3300037418 Bacteria 2588
407 Ga0395900_0231489 3300037418 Bacteria 1858
408 Ga0395900_0343024 3300037418 Bacteria 1469
409 Ga0395900_0665505 3300037418 Unclassified 977
410 Ga0395900_0690788 3300037418 Bacteria 954
411 Ga0395900_0718956 3300037418 Bacteria 931
412 Ga0395900_0802234 3300037418 Bacteria 869
413 Ga0395900_1075061 3300037418 Unclassified 722
414 Ga0395898_0012323 3300037466 Bacteria 8841
415 Ga0395898_0085549 3300037466 Bacteria 3039
416 Ga0395898_0127601 3300037466 Bacteria 2437
417 Ga0395898_0291581 3300037466 Bacteria 1556
418 Ga0395898_0380179 3300037466 Bacteria 1347
419 Ga0395898_0396698 3300037466 Bacteria 1315
420 Ga0395905_0110755 3300037471 Bacteria 2578
421 Ga0395905_0125713 3300037471 Bacteria 2411
422 Ga0395905_0223252 3300037471 Bacteria 1763
423 Ga0395905_0445682 3300037471 Bacteria 1192
424 Ga0395905_0681400 3300037471 Bacteria 930
425 Ga0395905_0831030 3300037471 Bacteria 826
426 Ga0395905_1004583 3300037471 Bacteria 737
427 Ga0395905_1007744 3300037471 Bacteria 736
428 Ga0436364_0264077 3300037853 Bacteria 1194
429 Ga0395901_0019506 3300038443 Bacteria 6933
430 Ga0395901_0024547 3300038443 Bacteria 6190
431 Ga0395901_0172826 3300038443 Bacteria 2267
432 Ga0395901_0206688 3300038443 Bacteria 2056
433 Ga0395901_0225731 3300038443 Bacteria 1956
434 Ga0395901_0376937 3300038443 Bacteria 1461
435 Ga0395901_0524816 3300038443 Bacteria 1202
436 Ga0395901_0556343 3300038443 Bacteria 1162
437 Ga0395901_1037261 3300038443 Bacteria 794
438 Ga0395901_1345110 3300038443 Bacteria 674
439 Ga0436362_0320037 3300039453 Bacteria 2081
440 Ga0439453_0024183 3300041408 Bacteria 1113
441 Ga0451853_0721965 3300041512 Bacteria 1293
442 Ga0439448_0062238 3300042005 Bacteria 1235
443 Ga0439448_0117847 3300042005 Bacteria 910
444 Ga0466963_0094195 3300044694 Bacteria 2042
445 Ga0466963_0111583 3300044694 Bacteria 1877
446 Ga0466964_0074613 3300044706 Unclassified 1442
447 Ga0466964_0615281 3300044706 Bacteria 597
448 Ga0466964_0703384 3300044706 Unclassified 563
449 Ga0466968_0272164 3300044735 Unclassified 809
450 Ga0466968_0369832 3300044735 Bacteria 699
451 Ga0466957_0344624 3300044842 Bacteria 1010
452 Ga0466958_0374602 3300045836 Archaea 917
453 Ga0466967_0002045 3300045976 Bacteria 12321
454 Ga0466967_0033159 3300045976 Bacteria 4369
455 Ga0466967_1318109 3300045976 Bacteria 719
456 Ga0495629_0842829 3300046459 Unclassified 603
457 Ga0495641_0474125 3300046461 Unclassified 570
458 Ga0495582_0414107 3300046473 Unclassified 777
459 Ga0495584_0039143 3300046491 Bacteria 2396
460 Ga0495584_0387420 3300046491 Bacteria 710
461 Ga0495585_0107091 3300046492 Bacteria 1490
462 Ga0495616_0340961 3300046513 Unclassified 626
463 Ga0495663_0074401 3300046525 Bacteria 1086
464 Ga0495656_0019975 3300046615 Bacteria 2593
465 Ga0495634_0032659 3300046642 Bacteria 3579
466 Ga0495661_0439069 3300046665 Bacteria 630
467 Ga0495588_0295000 3300046674 Bacteria 854
468 Ga0495658_0087607 3300046683 Unclassified 1839
469 Ga0495670_0137072 3300046691 Bacteria 1278
470 Ga0495677_0142446 3300047445 Bacteria 921
471 Ga0496100_0076845 3300048903 Bacteria 2243
472 Ga0496100_0145168 3300048903 Bacteria 1686
473 Ga0496100_0154649 3300048903 Bacteria 1639
474 Ga0496100_1291764 3300048903 Unclassified 576
475 Ga0496100_1455077 3300048903 Bacteria 541
476 Ga0496101_0021507 3300048904 Bacteria 4432
477 Ga0496101_0050877 3300048904 Bacteria 2984
478 Ga0496101_0340422 3300048904 Bacteria 1178
479 Ga0496101_0534599 3300048904 Bacteria 927
480 Ga0496102_0492871 3300048905 Bacteria 1147
481 Ga0496102_0493244 3300048905 Bacteria 1146
482 Ga0496102_0523508 3300048905 Bacteria 1108
483 Ga0496102_0548716 3300048905 Bacteria 1079
484 Ga0496102_1033505 3300048905 Unclassified 742
485 Ga0496102_1228890 3300048905 Bacteria 669
486 Ga0496103_0046688 3300048906 Bacteria 2675
487 Ga0496104_0020197 3300048907 Bacteria 6103
488 Ga0496104_0038552 3300048907 Bacteria 4472
489 Ga0496104_0326238 3300048907 Bacteria 1448
490 Ga0496104_0340675 3300048907 Bacteria 1412
491 Ga0496104_1140168 3300048907 Bacteria 683
492 Ga0496104_1476198 3300048907 Unclassified 583
493 Ga0496105_0008190 3300048908 Bacteria 8125
494 Ga0496105_0259541 3300048908 Bacteria 1405
495 Ga0496105_0367260 3300048908 Bacteria 1147
496 Ga0496106_0181477 3300048909 Bacteria 1671
497 Ga0496106_0423104 3300048909 Bacteria 1070
498 Ga0496106_0709440 3300048909 Bacteria 801
499 Ga0496107_0261197 3300048910 Bacteria 1288
500 Ga0496107_0344639 3300048910 Bacteria 1109
501 Ga0496107_0580463 3300048910 Bacteria 829
502 Ga0496107_0744530 3300048910 Bacteria 719
503 Ga0496108_0009106 3300048911 Bacteria 8037
504 Ga0496108_0025760 3300048911 Bacteria 4849
505 Ga0496109_0002279 3300048912 Bacteria 15952
506 Ga0496109_0003057 3300048912 Bacteria 13945
507 Ga0496109_0078129 3300048912 Bacteria 3047
508 Ga0496109_0216854 3300048912 Bacteria 1799
509 Ga0496109_0360809 3300048912 Bacteria 1373
510 Ga0496109_0402921 3300048912 Bacteria 1292
511 Ga0496109_0410520 3300048912 Bacteria 1279
512 Ga0496109_0705204 3300048912 Bacteria 947
513 Ga0496110_0000634 3300048913 Bacteria 24060
514 Ga0496110_0102243 3300048913 Bacteria 2570
515 Ga0496110_0137072 3300048913 Bacteria 2212
516 Ga0496110_0732105 3300048913 Unclassified 892
517 Ga0496111_0002902 3300048914 Bacteria 10471
518 Ga0496111_0016275 3300048914 Bacteria 5122
519 Ga0496111_0027859 3300048914 Bacteria 4001
520 Ga0496111_0047901 3300048914 Bacteria 3079
521 Ga0496111_0359241 3300048914 Bacteria 1078
522 Ga0496112_0007068 3300048915 Bacteria 9916
523 Ga0496112_0040412 3300048915 Bacteria 4560
524 Ga0496112_0059292 3300048915 Bacteria 3771
525 Ga0496112_0161273 3300048915 Bacteria 2209
526 Ga0496112_0179587 3300048915 Bacteria 2080
527 Ga0496112_0518926 3300048915 Bacteria 1126
528 Ga0496113_0014668 3300048916 Bacteria 5356
529 Ga0496113_0698055 3300048916 Unclassified 810
530 Ga0496113_0741238 3300048916 Unclassified 783
531 Ga0496113_0869930 3300048916 Bacteria 714
532 Ga0496113_1408666 3300048916 Bacteria 540
533 Ga0496114_0028080 3300048917 Bacteria 4615
534 Ga0496114_0085165 3300048917 Bacteria 2677
535 Ga0496114_0373519 3300048917 Bacteria 1262
536 Ga0496114_0621425 3300048917 Bacteria 952
537 Ga0496115_0235373 3300048918 Bacteria 1510
538 Ga0496115_0766479 3300048918 Unclassified 753
539 Ga0501038_0493641 3300049574 Bacteria 937
540 Ga0501067_0001085 3300049583 Bacteria 14676
541 Ga0501067_0028228 3300049583 Bacteria 3109
542 Ga0501068_0111093 3300049584 Bacteria 1704
543 Ga0501069_0010293 3300049585 Bacteria 4952
544 Ga0501069_0766911 3300049585 Archaea 584
545 Ga0501070_0334270 3300049586 Bacteria 1231
546 nmdc:mga0yw44_52642_c1 3300050492 Bacteria 2469
547 nmdc:mga06z11_187406_c1 3300050494 Bacteria 1196
548 nmdc:mga05p37_470775_c1 3300050507 Unclassified 1450
549 nmdc:mga05p37_56542_c1 3300050507 Bacteria 4831
550 nmdc:mga09592_732289_c1 3300050508 Bacteria 840
551 nmdc:mga06r32_139246_c1 3300050510 Bacteria 2402
552 nmdc:mga08y16_1776606_c1 3300050511 Unclassified 570
553 nmdc:mga08y16_508238_c1 3300050511 Bacteria 1223
554 nmdc:mga0n895_314600_c1 3300050512 Bacteria 1587
555 nmdc:mga0n895_87044_c1 3300050512 Bacteria 3121
556 nmdc:mga0rr50_37688_c1 3300050513 Bacteria 3493
557 nmdc:mga08x19_103012_c1 3300050514 Bacteria 1896
558 nmdc:mga0a205_23218_c1 3300050515 Bacteria 5883
559 Ga0501084_1163575 3300054114 Bacteria 647
560 Ga0590077_079737 3300059426 Bacteria 753
561 Ga0501082_0509195 3300060353 Bacteria 1052
562 Ga0070686_100176846
563 Ga0070658_10050615
564 Ga0070658_10122191
565 Ga0070658_10186633
566 Ga0070658_10324093
567 Ga0070658_10534912
568 Ga0070676_11513468
569 Ga0070683_100020571
570 Ga0070683_100134847
571 Ga0070683_100314442
572 Ga0070683_100501544
573 Ga0070680_100034413
574 Ga0070680_100131435
575 Ga0070680_100414695
576 Ga0070680_100590068
577 Ga0070680_100686791
578 Ga0070680_100797261
579 Ga0070680_101197668
580 Ga0070682_100574899
581 Ga0070682_100604348
582 Ga0068868_100519846
583 Ga0068868_100560777
584 Ga0068868_100613675
585 Ga0070660_100010753
586 Ga0070660_100099004
587 Ga0070660_100635325
588 Ga0070660_100728123
589 Ga0070660_101290704
590 Ga0070660_101749603
591 Ga0070691_10222211
592 Ga0070661_100026708
593 Ga0070661_100047595
594 Ga0070661_100088372
595 Ga0070661_100318321
596 Ga0070668_100005655
597 Ga0070671_102013954
598 Ga0070659_100074090
599 Ga0070659_100367045
600 Ga0070659_100408860
601 Ga0070659_100725525
602 Ga0070714_100350830
603 Ga0070714_100378805
604 Ga0070714_101286726
605 Ga0070713_100209069
606 Ga0070713_100667827
607 Ga0070713_101662666
608 Ga0070710_10597125
609 Ga0070710_10708574
610 Ga0070711_100673962
611 Ga0070705_100173808
612 Ga0070705_100707360
613 Ga0070708_100087600
614 Ga0070708_100285087
615 Ga0070662_100006236
616 Ga0070681_10002637
617 Ga0070681_10006033
618 Ga0070681_10009016
619 Ga0070681_10088542
620 Ga0070681_10230969
621 Ga0070681_10292266
622 Ga0070681_10309694
623 Ga0070681_10598751
624 Ga0070681_10738911
625 Ga0070685_10452916
626 Ga0070706_100063585
627 Ga0070706_100075009
628 Ga0070706_100237312
629 Ga0070706_100331666
630 Ga0070707_100002425
631 Ga0070707_100215801
632 Ga0070707_100537128
633 Ga0070707_101009002
634 Ga0070698_100080378
635 Ga0070698_100192879
636 Ga0070698_100287962
637 Ga0070698_101096225
638 Ga0070698_101255664
639 Ga0070699_100005859
640 Ga0070699_100042021
641 Ga0070699_101959152
642 Ga0070679_100003184
643 Ga0070679_100020221
644 Ga0070679_100066650
645 Ga0070679_100075317
646 Ga0070679_100247485
647 Ga0070684_100128756
648 Ga0070684_100131482
649 Ga0070684_100359639
650 Ga0070684_100376918
651 Ga0070684_100403434
652 Ga0070697_100166610
653 Ga0070672_100342113
654 Ga0070695_100853832
655 Ga0070696_100062017
656 Ga0070696_100320500
657 Ga0070696_101985292
658 Ga0070693_100489185
659 Ga0070665_100031500
660 Ga0070665_100455104
661 Ga0070704_100322967
662 Ga0068855_100008848
663 Ga0068855_100025569
664 Ga0068855_100103891
665 Ga0068855_100169663
666 Ga0068855_100213627
667 Ga0068855_102115198
668 Ga0070664_101566435
669 Ga0068857_100021870
670 Ga0068857_100207253
671 Ga0068856_100009210
672 Ga0068856_100084884
673 Ga0068856_100846910
674 Ga0068856_100934399
675 Ga0068856_101325934
676 Ga0068852_100122474
677 Ga0068852_100299316
678 Ga0068852_101936730
679 Ga0068861_100072716
680 Ga0068851_10453307
681 Ga0068862_100299178
682 Ga0081455_10050008
683 Ga0070717_10538858
684 Ga0075365_10075189
685 Ga0075432_10167839
686 Ga0070715_10070665
687 Ga0070715_11055901
688 Ga0070716_100197317
689 Ga0070716_100525006
690 Ga0070712_100060008
691 Ga0070712_100452108
692 Ga0075367_10367785
693 Ga0097621_100489691
694 Ga0075431_100307089
695 Ga0075431_100418609
696 Ga0075433_10032576
697 Ga0075434_100008855
698 Ga0075434_100876792
699 Ga0075434_101130509
700 Ga0075429_100813820
701 Ga0075436_100003758
702 Ga0075435_100004861
703 Ga0105240_10026386
704 Ga0105240_10044617
705 Ga0105240_10090329
706 Ga0105240_10121599
707 Ga0105240_10891208
708 Ga0105240_11355358
709 Ga0105240_11386485
710 Ga0105240_11596779
711 Ga0105240_12023319
712 Ga0111539_10161096
713 Ga0105245_10035981
714 Ga0105245_10096779
715 Ga0105245_10172207
716 Ga0105245_10674128
717 Ga0105245_10847126
718 Ga0105245_11506806
719 Ga0105245_11625374
720 Ga0114129_10051501
721 Ga0114129_10083758
722 Ga0105243_10412813
723 Ga0105243_11325667
724 Ga0105241_10660774
725 Ga0105242_10081652
726 Ga0105248_10298900
727 Ga0105248_10334035
728 Ga0105248_11084576
729 Ga0105248_11416805
730 Ga0105237_10094048
731 Ga0105237_10337214
732 Ga0105238_11500888
733 Ga0105238_11535804
734 Ga0105238_12894510
735 Ga0105249_10052030
736 Ga0105239_10144757
737 Ga0105239_10806051
738 Ga0105239_11528657
739 Ga0105239_12027762
740 Ga0105239_12230101
741 Ga0157371_10967005
742 Ga0157370_10042839
743 Ga0157370_10093650
744 Ga0157370_10202926
745 Ga0157370_10437861
746 Ga0157370_10508229
747 Ga0157370_10535809
748 Ga0157369_10009136
749 Ga0157369_10062331
750 Ga0157369_10093408
751 Ga0157369_10128341
752 Ga0157369_10362901
753 Ga0157369_11591686
754 Ga0157374_10052148
755 Ga0157374_10331288
756 Ga0157374_10390746
757 Ga0157374_11354704
758 Ga0157378_11034393
759 Ga0163162_10020387
760 Ga0157372_10155013
761 Ga0157372_10222008
762 Ga0157372_10329807
763 Ga0157372_10427340
764 Ga0157372_10927753
765 Ga0157372_11456873
766 Ga0157375_10112595
767 Ga0157375_10382709
768 Ga0157375_10791972
769 Ga0163163_11113419
770 Ga0157380_10201203
771 Ga0157380_10969562
772 Ga0182008_10947949
773 Ga0157377_10191015
774 Ga0157379_10878196
775 Ga0157379_12638299
776 Ga0182007_10077008
777 Ga0163161_10225356
778 Ga0197907_10848292
779 Ga0197907_11205344
780 Ga0206356_11512664
781 Ga0206354_10518964
782 Ga0206353_11022866
783 Ga0206353_11683046
784 Ga0206353_11947549
785 Ga0213873_10128903
786 Ga0207656_10188725
787 Ga0207692_10854779
788 Ga0207692_11098176
789 Ga0207685_10023009
790 Ga0207705_10045053
791 Ga0207705_10417844
792 Ga0207705_10511029
793 Ga0207705_10545681
794 Ga0207684_10072819
795 Ga0207684_10192989
796 Ga0207684_10669703
797 Ga0207684_10734042
798 Ga0207654_10635200
799 Ga0207707_10004771
800 Ga0207707_10054775
801 Ga0207707_10068426
802 Ga0207707_10227913
803 Ga0207707_10347881
804 Ga0207707_10395634
805 Ga0207707_10799492
806 Ga0207707_10864700
807 Ga0207707_10999111
808 Ga0207707_11180949
809 Ga0207695_10303659
810 Ga0207695_10717549
811 Ga0207671_10167432
812 Ga0207671_10427630
813 Ga0207693_10191469
814 Ga0207693_10532908
815 Ga0207663_10889228
816 Ga0207663_11492581
817 Ga0207660_10029435
818 Ga0207660_10080672
819 Ga0207660_10184845
820 Ga0207660_10411212
821 Ga0207660_10575659
822 Ga0207657_10001335
823 Ga0207657_10006912
824 Ga0207657_10009706
825 Ga0207657_10282297
826 Ga0207657_10532419
827 Ga0207657_10589618
828 Ga0207649_10056126
829 Ga0207649_10065746
830 Ga0207649_10131499
831 Ga0207649_10222673
832 Ga0207652_10088699
833 Ga0207652_10178723
834 Ga0207652_10375972
835 Ga0207652_10551141
836 Ga0207652_11128752
837 Ga0207646_10002167
838 Ga0207646_10341702
839 Ga0207646_10594581
840 Ga0207694_11610974
841 Ga0207687_10166207
842 Ga0207687_10721441
843 Ga0207687_11006695
844 Ga0207700_10140105
845 Ga0207700_10490273
846 Ga0207700_11154864
847 Ga0207644_11173632
848 Ga0207690_10070270
849 Ga0207690_10499954
850 Ga0207690_10787576
851 Ga0207706_10005271
852 Ga0207686_10213243
853 Ga0207709_10052863
854 Ga0207670_10228163
855 Ga0207665_10224095
856 Ga0207665_10399031
857 Ga0207665_10537448
858 Ga0207665_10857294
859 Ga0207691_10418617
860 Ga0207711_10434658
861 Ga0207711_10541526
862 Ga0207661_10316006
863 Ga0207661_10483741
864 Ga0207661_10568628
865 Ga0207661_10599521
866 Ga0207661_11007053
867 Ga0207679_10411653
868 Ga0207667_10045388
869 Ga0207667_10224526
870 Ga0207667_10228831
871 Ga0207667_10241872
872 Ga0207667_10566217
873 Ga0207667_10596032
874 Ga0207667_11587121
875 Ga0207712_10016540
876 Ga0207677_10326147
877 Ga0207677_10532673
878 Ga0207639_10056760
879 Ga0207639_10965273
880 Ga0207678_10100820
881 Ga0207702_10026075
882 Ga0207702_10335717
883 Ga0207702_11490409
884 Ga0207641_11499334
885 Ga0207648_10181497
886 Ga0207674_10018031
887 Ga0207674_10899010
888 Ga0207675_100000664
889 Ga0207683_11561632
890 Ga0207698_10084400
891 Ga0207698_10343177
892 Ga0207698_12613707
893 Ga0207428_10259598
894 Ga0268266_10338948
895 Ga0268266_10404355
896 Ga0268265_11621076
897 Ga0265337_1078561
898 Ga0265326_10010223
899 Ga0265326_10092832
900 Ga0265319_1004104
901 Ga0265334_10015955
902 Ga0265318_10000220
903 Ga0265322_10002759
904 Ga0265322_10023263
905 Ga0265336_10183132
906 Ga0265336_10246634
907 Ga0265338_10015604
908 Ga0265338_10155536
909 Ga0265338_10250383
910 Ga0265338_10556431
911 Ga0265324_10084124
912 Ga0265330_10002778
913 Ga0265330_10220928
914 Ga0265330_10463774
915 Ga0265332_10003330
916 Ga0265328_10029907
917 Ga0265320_10004689
918 Ga0265325_10002188
919 Ga0265325_10026185
920 Ga0265325_10143425
921 Ga0265329_10008893
922 Ga0265329_10039955
923 Ga0265340_10048177
924 Ga0265339_10037888
925 Ga0265339_10095216
926 Ga0265331_10044454
927 Ga0265331_10124646
928 Ga0265327_10004096
929 Ga0265327_10032367
930 Ga0265327_10068889
931 Ga0265316_10012728
932 Ga0265316_10015767
933 Ga0265316_10343601
934 Ga0307408_101230401
935 Ga0265313_10115353
936 Ga0265314_10003582
937 Ga0265314_10004402
938 Ga0265314_10045418
939 Ga0265342_10022633
940 Ga0265342_10122444
941 Ga0316576_10033796
942 Ga0316578_10093884
943 Ga0316578_10193241
944 Ga0307405_10108747
945 Ga0316577_10120371
946 Ga0307412_10078946
947 Ga0307416_100129998
948 Ga0307415_100395073
949 Ga0316580_10037238
950 Ga0316580_10055587
951 Ga0316588_1127229
952 Ga0316574_0029677
953 Ga0316574_0119887
954 Ga0316574_0293133
955 Ga0316574_0446839
956 Ga0373935_0800476
957 Ga0316584_0552034
958 Ga0395899_0066149
959 Ga0395899_0116877
960 Ga0395899_0152060
961 Ga0395899_0221159
962 Ga0395899_0259856
963 Ga0395899_0304804
964 Ga0395899_0400832
965 Ga0395900_0028944
966 Ga0395900_0039294
967 Ga0395900_0129346
968 Ga0395900_0231489
969 Ga0395900_0343024
970 Ga0395900_0665505
971 Ga0395900_0690788
972 Ga0395900_0718956
973 Ga0395900_0802234
974 Ga0395900_1075061
975 Ga0395898_0012323
976 Ga0395898_0085549
977 Ga0395898_0127601
978 Ga0395898_0291581
979 Ga0395898_0380179
980 Ga0395898_0396698
981 Ga0395905_0110755
982 Ga0395905_0125713
983 Ga0395905_0223252
984 Ga0395905_0445682
985 Ga0395905_0681400
986 Ga0395905_0831030
987 Ga0395905_1004583
988 Ga0395905_1007744
989 Ga0436364_0264077
990 Ga0395901_0019506
991 Ga0395901_0024547
992 Ga0395901_0172826
993 Ga0395901_0206688
994 Ga0395901_0225731
995 Ga0395901_0376937
996 Ga0395901_0524816
997 Ga0395901_0556343
998 Ga0395901_1037261
999 Ga0395901_1345110
1000 Ga0436362_0320037
1001 Ga0439453_0024183
1002 Ga0451853_0721965
1003 Ga0439448_0062238
1004 Ga0439448_0117847
1005 Ga0466963_0094195
1006 Ga0466963_0111583
1007 Ga0466964_0074613
1008 Ga0466964_0615281
1009 Ga0466964_0703384
1010 Ga0466968_0272164
1011 Ga0466968_0369832
1012 Ga0466957_0344624
1013 Ga0466958_0374602
1014 Ga0466967_0002045
1015 Ga0466967_0033159
1016 Ga0466967_1318109
1017 Ga0495629_0842829
1018 Ga0495641_0474125
1019 Ga0495582_0414107
1020 Ga0495584_0039143
1021 Ga0495584_0387420
1022 Ga0495585_0107091
1023 Ga0495616_0340961
1024 Ga0495663_0074401
1025 Ga0495656_0019975
1026 Ga0495634_0032659
1027 Ga0495661_0439069
1028 Ga0495588_0295000
1029 Ga0495658_0087607
1030 Ga0495670_0137072
1031 Ga0495677_0142446
1032 Ga0496100_0076845
1033 Ga0496100_0145168
1034 Ga0496100_0154649
1035 Ga0496100_1291764
1036 Ga0496100_1455077
1037 Ga0496101_0021507
1038 Ga0496101_0050877
1039 Ga0496101_0340422
1040 Ga0496101_0534599
1041 Ga0496102_0492871
1042 Ga0496102_0493244
1043 Ga0496102_0523508
1044 Ga0496102_0548716
1045 Ga0496102_1033505
1046 Ga0496102_1228890
1047 Ga0496103_0046688
1048 Ga0496104_0020197
1049 Ga0496104_0038552
1050 Ga0496104_0326238
1051 Ga0496104_0340675
1052 Ga0496104_1140168
1053 Ga0496104_1476198
1054 Ga0496105_0008190
1055 Ga0496105_0259541
1056 Ga0496105_0367260
1057 Ga0496106_0181477
1058 Ga0496106_0423104
1059 Ga0496106_0709440
1060 Ga0496107_0261197
1061 Ga0496107_0344639
1062 Ga0496107_0580463
1063 Ga0496107_0744530
1064 Ga0496108_0009106
1065 Ga0496108_0025760
1066 Ga0496109_0002279
1067 Ga0496109_0003057
1068 Ga0496109_0078129
1069 Ga0496109_0216854
1070 Ga0496109_0360809
1071 Ga0496109_0402921
1072 Ga0496109_0410520
1073 Ga0496109_0705204
1074 Ga0496110_0000634
1075 Ga0496110_0102243
1076 Ga0496110_0137072
1077 Ga0496110_0732105
1078 Ga0496111_0002902
1079 Ga0496111_0016275
1080 Ga0496111_0027859
1081 Ga0496111_0047901
1082 Ga0496111_0359241
1083 Ga0496112_0007068
1084 Ga0496112_0040412
1085 Ga0496112_0059292
1086 Ga0496112_0161273
1087 Ga0496112_0179587
1088 Ga0496112_0518926
1089 Ga0496113_0014668
1090 Ga0496113_0698055
1091 Ga0496113_0741238
1092 Ga0496113_0869930
1093 Ga0496113_1408666
1094 Ga0496114_0028080
1095 Ga0496114_0085165
1096 Ga0496114_0373519
1097 Ga0496114_0621425
1098 Ga0496115_0235373
1099 Ga0496115_0766479
1100 Ga0501038_0493641
1101 Ga0501067_0001085
1102 Ga0501067_0028228
1103 Ga0501068_0111093
1104 Ga0501069_0010293
1105 Ga0501069_0766911
1106 Ga0501070_0334270
1107 nmdc:mga0yw44_52642_c1
1108 nmdc:mga06z11_187406_c1
1109 nmdc:mga05p37_470775_c1
1110 nmdc:mga05p37_56542_c1
1111 nmdc:mga09592_732289_c1
1112 nmdc:mga06r32_139246_c1
1113 nmdc:mga08y16_1776606_c1
1114 nmdc:mga08y16_508238_c1
1115 nmdc:mga0n895_314600_c1
1116 nmdc:mga0n895_87044_c1
1117 nmdc:mga0rr50_37688_c1
1118 nmdc:mga08x19_103012_c1
1119 nmdc:mga0a205_23218_c1
1120 Ga0501084_1163575
1121 Ga0590077_079737
1122 Ga0501082_0509195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06262

Zincin_1

Zincin-like metallopeptidase

25

111

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7942 2 98
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7728 2 98
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6711 3 87
8g2y-assembly1.cif.gz_A cryo-em structure of adgrf1 coupled to minigs/q 0.637 17 56
2ejq-assembly2.cif.gz_B conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6126 3 95
ID Description Score Start End Superfamily
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7835 2 98 3.30.2010.20
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7686 3 94 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7624 2 98 3.30.2010.20
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7132 3 94 3.30.2010.20
2ejqA00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6711 3 87 3.30.2010.20
ID Description Score Start End GO Terms
AF-A0A7V9DFP5-F1-model_v4 Metallopeptidase family protein 0.9876 2 75
AF-A0A398D0C8-F1-model_v4 Metallopeptidase family protein 0.9165 3 95
AF-A0A7W0TT64-F1-model_v4 Metallopeptidase family protein 0.9154 1 99
AF-A0A2V7YLB6-F1-model_v4 Uncharacterized protein 0.9084 3 75
AF-M1V0M2-F1-model_v4 Metallopeptidase family protein 0.9072 2 99

Map