F463729

General Info

Members Datasets Scaffolds Average Seq Length
560 411 413 488

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0008734|Ga0466967_0008734_5660_7183
Length 507
Sequence LKLHRYRPHFRKDRKMSAESQLKTKEAEFAPEENLLSQIVAATRQTEPDRAQDLLRTLTDQALKGTVTYDRNLTVTLNKAIAELDRKISRQLAAIMQSPEFTKLEGSWRGLQYLVKNSETSVNLKIRVLNASKRDVSKDLAKAVEFDQSRLFKSIYEDEFGTPGGEPMGALIGDYEFDNSFDDVQTLQAISSIAAAAFAPFISAASPRMFGFDDYRELARPRDLEKIFETVEYAKWRSLRESEDSRFVTLALPRVLARMPYGPKTNPIDDFAFDETDHSKTGELEHNSYCWMNAAYVMGTRLTDAFAQSGWCTAIRGAENGGKVENLPMHIFSSDDGDLDLKCPTEVGITDRRDAELGKLGFLPLCHYKNTDYAVFFGAQTTHKPKVYDKPEATANAAVSARLPYMMATSRFAHYLKVMGRDKIGSFMEAQDCENWLNRWIANYVNANDDAGEESRAKYPLRDAKVTVQEVPGKPGSYNAVAWMRPWLQMEELTTSLRMVARIPSKN

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
4 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
5 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
6 2516143018 Ensifer sp. BR816 Isolate Nodule
7 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
8 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
9 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
10 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
11 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
12 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
13 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
14 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
15 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
16 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
17 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
18 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
19 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
20 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
21 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
22 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
23 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
24 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
25 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
26 2643221568 Rhizobium sp. Root564 Isolate Unclassified
27 2643221582 Rhizobium sp. Root651 Isolate Unclassified
28 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
29 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
30 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
31 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
32 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
33 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
34 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
35 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
36 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
37 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
38 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
39 2791355256 Rhizobium sp. M10 Isolate Nodule
40 2791355261 Rhizobium sp. J15 Isolate Nodule
41 2791355265 Rhizobium sp. H4 Isolate Nodule
42 2791355266 Rhizobium sp. L43 Isolate Nodule
43 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
44 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
45 2802429633 Rhizobium anhuiense J3 Isolate Nodule
46 2802429634 Rhizobium anhuiense S10 Isolate Nodule
47 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
48 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
49 2802429637 Rhizobium anhuiense C15 Isolate Nodule
50 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
51 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
52 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
53 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
54 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
55 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
56 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
57 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
58 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
59 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
60 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
61 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
62 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
63 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
64 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
65 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
66 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
67 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
68 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
69 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
70 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
71 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
72 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
73 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
74 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
75 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
76 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
77 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
78 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
79 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
80 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
81 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
82 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
83 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
84 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
85 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
86 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
87 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
88 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
89 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
90 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
91 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
92 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
93 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
94 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
95 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
96 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
97 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
98 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
99 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
100 2909042592 Labrys sp. LIt4 Isolate Nodule
101 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
102 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
103 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
104 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
105 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
106 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
107 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
108 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
109 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
110 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
111 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
112 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
113 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
114 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
115 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
116 2936381700 Rhizobium chutanense C16 Isolate Unclassified
117 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
118 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
119 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
120 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
121 2996893221 Rhizobium sp. R635 Isolate Nodule
122 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
123 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
124 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
125 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
126 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
127 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
128 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
129 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
130 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
131 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
132 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
133 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
134 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
135 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
136 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
137 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
138 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
139 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
140 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
141 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
142 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
143 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
144 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
145 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
146 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
147 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
148 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
149 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
150 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
151 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
152 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
153 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
154 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
155 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
156 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
157 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
158 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
159 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
160 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
161 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
162 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
163 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
164 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
165 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
166 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
167 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
168 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
169 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
170 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
171 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
172 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
173 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
174 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
175 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
176 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
177 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
178 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
179 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
180 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
181 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
182 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
183 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
184 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
185 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
186 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
187 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
188 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
189 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
190 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
191 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
192 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
193 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
194 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
195 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
199 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
200 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
201 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
202 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
203 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
204 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
205 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
206 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
207 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
208 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
209 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
210 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
211 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
212 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
213 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
214 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
215 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
217 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
218 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
219 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
221 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
223 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
225 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
228 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
256 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
259 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
260 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
261 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
262 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
265 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
266 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
267 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
268 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
269 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
270 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
273 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
274 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
275 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
276 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
277 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
278 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
279 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
280 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
284 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
285 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
288 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
289 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
290 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
291 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
292 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
293 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
294 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
295 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
296 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
297 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
298 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
299 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
300 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
301 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
302 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
320 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
334 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
363 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
370 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
371 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
372 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
373 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
374 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
377 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
391 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
392 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
393 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
394 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
395 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
396 8005382845 Rhizobium sp. R634 Isolate Nodule
397 8005395548 Rhizobium sp. R339 Isolate Nodule
398 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
399 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
400 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
401 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
402 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
403 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
404 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
405 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
406 8024501048 Rhizobium sp. H4 Isolate Nodule
407 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
408 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
409 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
410 8056382006 Rhizobium croatiense 13T Isolate Nodule
411 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.54
Metatranscriptomes 3.21
Isolates 26.25

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 17.32
Nodule 13.93
Rhizoplane 2.68
Rhizosphere 45.54
Stem 0
Stem Tuber 0
Unclassified 20.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000095 3300001979 Bacteria 31058
2 JGI25155J39150_1000047 3300002704 Bacteria 80068
3 JGI25156J39149_1000069 3300002705 Bacteria 81255
4 JGI25154J39366_1000091 3300002738 Bacteria 80948
5 JGI25157J39369_1000085 3300002741 Bacteria 81255
6 JGI25159J45721_1007752 3300002987 Bacteria 3036
7 JGI25151J46595_10000143 3300003187 Bacteria 95160
8 JGI25151J46595_10000712 3300003187 Bacteria 27814
9 JGI25406J46586_10000305 3300003203 Bacteria 22022
10 JGI25165J46597_1000076 3300003214 Bacteria 179537
11 JGI25153J46596_10003762 3300003215 Bacteria 8375
12 JGI25153J46596_10025914 3300003215 Bacteria 2086
13 rootH2_10267173 3300003320 Bacteria 5042
14 JGI25160J50197_1000081 3300003354 Bacteria 99495
15 JGI25160J50197_1005290 3300003354 Bacteria 5399
16 JGI25161J50226_1000063 3300003374 Bacteria 99495
17 JGI25161J50226_1002456 3300003374 Bacteria 4740
18 JGI25404J52841_10000302 3300003659 Bacteria 6458
19 Ga0055526_1001883 3300003771 Bacteria 14541
20 Ga0055524_1003318 3300003775 Bacteria 7862
21 Ga0055528_1003407 3300003790 Bacteria 7996
22 Ga0055528_1004899 3300003790 Bacteria 6321
23 Ga0055530_10015911 3300003791 Bacteria 2428
24 Ga0055540_1000077 3300003792 Bacteria 114283
25 Ga0055540_1000095 3300003792 Bacteria 97555
26 Ga0055540_1002126 3300003792 Bacteria 10814
27 Ga0055540_1018625 3300003792 Bacteria 1897
28 Ga0055531_10001320 3300003794 Bacteria 18600
29 Ga0058692_1001371 3300003856 Bacteria 9029
30 Ga0058692_1005398 3300003856 Bacteria 3646
31 Ga0055543_1000088 3300004625 Bacteria 80513
32 Ga0055543_1001594 3300004625 Bacteria 8716
33 Ga0065165_1000426 3300005262 Bacteria 66367
34 Ga0065165_1013169 3300005262 Bacteria 3308
35 Ga0070683_100022087 3300005329 Bacteria 5683
36 Ga0068869_100004251 3300005334 Bacteria 8880
37 Ga0070689_100218086 3300005340 Bacteria 1564
38 Ga0070668_100000660 3300005347 Bacteria 23338
39 Ga0070675_100029669 3300005354 Bacteria 4412
40 Ga0070671_100004670 3300005355 Bacteria 10867
41 Ga0070688_100117038 3300005365 Bacteria 1780
42 Ga0070667_100000531 3300005367 Bacteria 38196
43 Ga0070709_10028989 3300005434 Bacteria 3306
44 Ga0070714_100039802 3300005435 Bacteria 3959
45 Ga0070713_100158231 3300005436 Bacteria 2020
46 Ga0070711_100104795 3300005439 Bacteria 2064
47 Ga0070708_100027950 3300005445 Bacteria 4847
48 Ga0070662_100011152 3300005457 Bacteria 5921
49 Ga0070681_10099247 3300005458 Bacteria 2858
50 Ga0070706_100048257 3300005467 Bacteria 3930
51 Ga0070707_100006370 3300005468 Bacteria 10975
52 Ga0070698_100002839 3300005471 Bacteria 19063
53 Ga0070698_100020829 3300005471 Bacteria 6872
54 Ga0070698_100024358 3300005471 Bacteria 6316
55 Ga0070699_100017429 3300005518 Bacteria 6165
56 Ga0070699_100020618 3300005518 Bacteria 5688
57 Ga0070697_100007582 3300005536 Bacteria 8448
58 Ga0070665_100049052 3300005548 Bacteria 4238
59 Ga0070665_100081295 3300005548 Bacteria 3246
60 Ga0068854_100117872 3300005578 Bacteria 2011
61 Ga0068856_100001848 3300005614 Bacteria 22133
62 Ga0068860_100000070 3300005843 Bacteria 178676
63 Ga0068860_100024580 3300005843 Bacteria 5819
64 Ga0068860_100040575 3300005843 Bacteria 4448
65 Ga0068860_100060174 3300005843 Bacteria 3610
66 Ga0081455_10012731 3300005937 Bacteria 8368
67 Ga0081538_10044266 3300005981 Bacteria 2779
68 Ga0081540_1000692 3300005983 Bacteria 31422
69 Ga0081540_1040957 3300005983 Bacteria 2407
70 Ga0081539_10000209 3300005985 Bacteria 136637
71 Ga0081539_10000778 3300005985 Bacteria 62140
72 Ga0081539_10001101 3300005985 Bacteria 49064
73 Ga0081539_10004855 3300005985 Bacteria 14377
74 Ga0075365_10001970 3300006038 Bacteria 9700
75 Ga0075368_10018555 3300006042 Bacteria 2615
76 Ga0075363_100003538 3300006048 Bacteria 6666
77 Ga0075363_100003769 3300006048 Bacteria 6530
78 Ga0075363_100021818 3300006048 Bacteria 3232
79 Ga0075364_10094742 3300006051 Bacteria 1984
80 Ga0070712_100056596 3300006175 Bacteria 2751
81 Ga0075362_10001965 3300006177 Bacteria 6754
82 Ga0075367_10004351 3300006178 Bacteria 6901
83 Ga0075367_10062222 3300006178 Bacteria 2229
84 Ga0075369_10002552 3300006186 Bacteria 6517
85 Ga0075369_10003966 3300006186 Bacteria 5429
86 Ga0075369_10012961 3300006186 Bacteria 3299
87 Ga0075366_10009995 3300006195 Bacteria 5315
88 Ga0075366_10010809 3300006195 Bacteria 5133
89 Ga0075366_10024430 3300006195 Bacteria 3526
90 Ga0075366_10039134 3300006195 Bacteria 2802
91 Ga0075370_10011429 3300006353 Bacteria 4665
92 Ga0075428_100042582 3300006844 Unclassified 4992
93 Ga0075434_100058376 3300006871 Bacteria 3835
94 Ga0099826_10000495 3300006948 Bacteria 19214
95 Ga0075435_100079388 3300007076 Bacteria 2693
96 Ga0099794_10022117 3300007265 Bacteria 2897
97 Ga0105250_10000137 3300009092 Bacteria 63629
98 Ga0105240_10000214 3300009093 Bacteria 117038
99 Ga0105240_10001222 3300009093 Bacteria 44673
100 Ga0105240_10004391 3300009093 Bacteria 21528
101 Ga0111539_10069776 3300009094 Bacteria 4149
102 Ga0114129_10002939 3300009147 Bacteria 23851
103 Ga0105243_10031629 3300009148 Bacteria 4080
104 Ga0105242_10103472 3300009176 Bacteria 2416
105 Ga0105237_10002691 3300009545 Bacteria 21757
106 Ga0105237_10006591 3300009545 Bacteria 12841
107 Ga0105237_10078550 3300009545 Bacteria 3290
108 Ga0105238_10090886 3300009551 Bacteria 3040
109 Ga0105249_10021199 3300009553 Bacteria 5818
110 Ga0099796_10003304 3300010159 Bacteria 3719
111 Ga0105239_10000073 3300010375 Bacteria 140771
112 Ga0105239_10001559 3300010375 Bacteria 30321
113 Ga0105239_10059822 3300010375 Bacteria 4181
114 Ga0105239_10221850 3300010375 Bacteria 2120
115 Ga0105246_10057280 3300011119 Bacteria 2696
116 Ga0157371_10000005 3300013102 Bacteria 416456
117 Ga0157371_10005895 3300013102 Bacteria 10235
118 Ga0157370_10032595 3300013104 Bacteria 5087
119 Ga0157370_10069349 3300013104 Bacteria 3330
120 Ga0157369_10049007 3300013105 Bacteria 4581
121 Ga0157369_10064676 3300013105 Bacteria 3939
122 Ga0157369_10087514 3300013105 Bacteria 3326
123 Ga0182008_10019486 3300014497 Bacteria 3501
124 Ga0182007_10004456 3300015262 Bacteria 6347
125 Ga0182005_1004594 3300015265 Bacteria 4432
126 Ga0213876_10001665 3300021384 Bacteria 13559
127 Ga0213875_10003402 3300021388 Bacteria 9056
128 Ga0213875_10008267 3300021388 Bacteria 5337
129 Ga0209435_100058 3300025206 Bacteria 81307
130 Ga0209437_100232 3300025233 Bacteria 93949
131 Ga0207425_1003224 3300025245 Bacteria 5325
132 Ga0209646_1000178 3300025246 Bacteria 81307
133 Ga0209026_1000208 3300025250 Bacteria 81307
134 Ga0209677_101586 3300025253 Bacteria 9630
135 Ga0209759_1000242 3300025256 Bacteria 81307
136 Ga0209129_1000394 3300025258 Bacteria 34899
137 Ga0209233_1000010 3300025261 Bacteria 1194329
138 Ga0209233_1000235 3300025261 Bacteria 94254
139 Ga0209233_1000394 3300025261 Bacteria 36983
140 Ga0209673_1000799 3300025273 Bacteria 41728
141 Ga0209673_1003925 3300025273 Bacteria 8337
142 Ga0209130_1000160 3300025284 Bacteria 100965
143 Ga0209130_1000162 3300025284 Bacteria 99549
144 Ga0209130_1014604 3300025284 Bacteria 1964
145 Ga0209676_1006108 3300025292 Bacteria 6046
146 Ga0209025_1000299 3300025294 Bacteria 110988
147 Ga0209025_1001491 3300025294 Bacteria 30332
148 Ga0209564_1001594 3300025295 Bacteria 22176
149 Ga0209758_1000440 3300025297 Bacteria 69850
150 Ga0209758_1002677 3300025297 Bacteria 17598
151 Ga0209758_1002910 3300025297 Bacteria 16515
152 Ga0209758_1035629 3300025297 Bacteria 1958
153 Ga0209050_1009781 3300025298 Bacteria 4838
154 Ga0209256_1002541 3300025299 Bacteria 14607
155 Ga0207426_1000098 3300025302 Bacteria 264264
156 Ga0207426_1000126 3300025302 Bacteria 213341
157 Ga0207426_1000556 3300025302 Bacteria 51341
158 Ga0209051_1000027 3300025303 Bacteria 412172
159 Ga0209051_1004091 3300025303 Bacteria 9169
160 Ga0209051_1005327 3300025303 Bacteria 7566
161 Ga0209257_1000744 3300025304 Bacteria 49197
162 Ga0209257_1003038 3300025304 Bacteria 15153
163 Ga0207696_1000132 3300025711 Bacteria 132096
164 Ga0207688_10054938 3300025901 Bacteria 2234
165 Ga0207680_10066884 3300025903 Bacteria 2212
166 Ga0207699_10031219 3300025906 Bacteria 2989
167 Ga0207684_10007944 3300025910 Bacteria 9481
168 Ga0207684_10092166 3300025910 Bacteria 2582
169 Ga0207707_10095149 3300025912 Bacteria 2603
170 Ga0207695_10000373 3300025913 Bacteria 101687
171 Ga0207695_10006334 3300025913 Bacteria 15398
172 Ga0207671_10000536 3300025914 Bacteria 51271
173 Ga0207671_10025013 3300025914 Bacteria 4487
174 Ga0207646_10071451 3300025922 Bacteria 3099
175 Ga0207700_10018091 3300025928 Bacteria 4725
176 Ga0207644_10033526 3300025931 Bacteria 3589
177 Ga0207706_10019567 3300025933 Bacteria 6090
178 Ga0207689_10009098 3300025942 Bacteria 8598
179 Ga0207661_10197217 3300025944 Bacteria 1768
180 Ga0207651_10103496 3300025960 Bacteria 2119
181 Ga0207668_10003286 3300025972 Bacteria 9476
182 Ga0207640_10084365 3300025981 Bacteria 2181
183 Ga0207658_10000993 3300025986 Bacteria 23279
184 Ga0207703_10035642 3300026035 Bacteria 3954
185 Ga0207678_10042957 3300026067 Bacteria 3912
186 Ga0207708_10029748 3300026075 Bacteria 4140
187 Ga0207641_10021886 3300026088 Bacteria 5256
188 Ga0207676_10135572 3300026095 Bacteria 2100
189 Ga0207675_100000690 3300026118 Bacteria 33345
190 Ga0207675_100117528 3300026118 Bacteria 2514
191 Ga0209371_1002587 3300027312 Bacteria 9953
192 Ga0209282_1000490 3300027666 Bacteria 19218
193 Ga0268265_10010640 3300028380 Bacteria 6212
194 Ga0268264_10000029 3300028381 Bacteria 419246
195 Ga0268264_10026628 3300028381 Bacteria 4726
196 Ga0268264_10115302 3300028381 Bacteria 2360
197 Ga0265337_1001011 3300028556 Bacteria 14625
198 Ga0265334_10000429 3300028573 Bacteria 22044
199 Ga0265334_10017547 3300028573 Bacteria 2955
200 Ga0265338_10044110 3300028800 Bacteria 4123
201 Ga0268256_1002945 3300030500 Bacteria 8110
202 Ga0265762_1004627 3300030760 Bacteria 2459
203 Ga0265777_100268 3300030877 Bacteria 2206
204 Ga0307509_10000027 3300031507 Bacteria 228470
205 Ga0307408_100000127 3300031548 Bacteria 84326
206 Ga0307408_100195107 3300031548 Bacteria 1634
207 Ga0316579_10000150 3300031691 Bacteria 19674
208 Ga0316579_10002127 3300031691 Bacteria 7425
209 Ga0307516_10038052 3300031730 Bacteria 4804
210 Ga0307406_10002006 3300031901 Bacteria 11108
211 Ga0316583_10020861 3300032133 Bacteria 2348
212 Ga0316593_10026657 3300032168 Bacteria 1849
213 Ga0316592_1009400 3300033524 Bacteria 1956
214 Ga0373945_0018979 3300035116 Bacteria 2344
215 Ga0373957_0027892 3300035120 Bacteria 2054
216 Ga0373960_0023944 3300035121 Bacteria 1648
217 Ga0373943_0037195 3300035170 Bacteria 2336
218 Ga0373927_0034831 3300035695 Bacteria 3274
219 Ga0373947_0085706 3300035725 Bacteria 1957
220 Ga0373937_0017239 3300036401 Bacteria 6429
221 Ga0373937_0040080 3300036401 Bacteria 4269
222 Ga0373937_0069881 3300036401 Bacteria 3238
223 Ga0316582_0002988 3300036647 Bacteria 8146
224 Ga0316584_0006775 3300036712 Bacteria 7774
225 Ga0373925_0008091 3300037068 Bacteria 7657
226 Ga0373925_0019779 3300037068 Bacteria 4901
227 Ga0395900_0001806 3300037418 Bacteria 24533
228 Ga0395900_0009611 3300037418 Bacteria 9916
229 Ga0395900_0092354 3300037418 Bacteria 3110
230 Ga0395905_0018025 3300037471 Bacteria 6703
231 Ga0395905_0045549 3300037471 Bacteria 4114
232 Ga0436364_0271401 3300037853 Bacteria 70772
233 Ga0436364_0635819 3300037853 Bacteria 4081
234 Ga0436364_1007676 3300037853 Bacteria 19097
235 Ga0436364_1064044 3300037853 Bacteria 2623
236 Ga0436364_1190373 3300037853 Bacteria 2620
237 Ga0400483_092352 3300039062 Bacteria 246443
238 Ga0400483_093934 3300039062 Bacteria 16235
239 Ga0400483_175476 3300039062 Bacteria 8667
240 Ga0400483_222800 3300039062 Bacteria 244239
241 Ga0400483_229198 3300039062 Bacteria 1424
242 Ga0436365_0904212 3300039437 Bacteria 3319
243 Ga0436365_0934609 3300039437 Bacteria 26465
244 Ga0436360_0483293 3300039438 Bacteria 14935
245 Ga0436360_0611086 3300039438 Bacteria 6580
246 Ga0436360_1231205 3300039438 Bacteria 4975
247 Ga0436361_0083698 3300039447 Bacteria 33592
248 Ga0436361_0445859 3300039447 Bacteria 5455
249 Ga0436362_0422974 3300039453 Bacteria 4826
250 Ga0436362_0804175 3300039453 Bacteria 5401
251 Ga0436362_0936557 3300039453 Bacteria 2033
252 Ga0439465_0013893 3300041413 Bacteria 2507
253 Ga0451804_0492287 3300041463 Bacteria 1642
254 Ga0451833_0023225 3300041491 Bacteria 44496
255 Ga0451835_0149410 3300041492 Bacteria 37210
256 Ga0451841_0973233 3300041498 Bacteria 4615
257 Ga0451845_0636556 3300041501 Bacteria 18930
258 Ga0451847_0042196 3300041503 Bacteria 36405
259 Ga0451849_0149307 3300041505 Bacteria 29770
260 Ga0451843_0907409 3300041509 Bacteria 38060
261 Ga0451853_2199883 3300041512 Bacteria 4867
262 Ga0439449_0061736 3300042007 Bacteria 1383
263 Ga0451577_0011809 3300042876 Bacteria 8242
264 Ga0451576_0004592 3300045051 Bacteria 17824
265 Ga0466967_0008734 3300045976 Bacteria 7463
266 Ga0495627_000278 3300046453 Bacteria 51546
267 Ga0495606_0035323 3300046507 Bacteria 3418
268 Ga0495610_0000022 3300046512 Bacteria 317107
269 Ga0495610_0000207 3300046512 Bacteria 65000
270 Ga0495620_0008591 3300046515 Bacteria 5479
271 Ga0495632_0001043 3300046519 Bacteria 23893
272 Ga0495643_0000077 3300046522 Bacteria 163843
273 Ga0495643_0015205 3300046522 Bacteria 4555
274 Ga0495666_0049978 3300046526 Bacteria 2010
275 Ga0495640_0088550 3300046533 Bacteria 2046
276 Ga0495645_0015415 3300046543 Bacteria 5436
277 Ga0495657_0073038 3300046675 Bacteria 2236
278 Ga0495599_0110902 3300046678 Bacteria 1709
279 Ga0495623_0092728 3300046679 Bacteria 1850
280 Ga0495646_0011239 3300046680 Bacteria 5685
281 Ga0495604_0132406 3300047317 Bacteria 1791
282 Ga0495680_0087376 3300047322 Bacteria 2345
283 Ga0495681_0000010 3300047470 Bacteria 203548
284 Ga0495681_0004906 3300047470 Bacteria 9040
285 Ga0495686_0000491 3300047472 Bacteria 58284
286 Ga0495602_0002298 3300048088 Bacteria 19320
287 Ga0496100_0001126 3300048903 Bacteria 12987
288 Ga0496102_0073562 3300048905 Bacteria 3140
289 Ga0496103_0009866 3300048906 Bacteria 5652
290 Ga0496103_0043235 3300048906 Bacteria 2774
291 Ga0496104_0018727 3300048907 Bacteria 6321
292 Ga0496106_0162685 3300048909 Bacteria 1765
293 Ga0496111_0000352 3300048914 Bacteria 22736
294 Ga0496112_0070278 3300048915 Bacteria 3460
295 Ga0496113_0062041 3300048916 Bacteria 2822
296 Ga0496116_0000042 3300048919 Bacteria 330516
297 Ga0496116_0022834 3300048919 Bacteria 4674
298 Ga0496117_0000489 3300048920 Bacteria 65533
299 Ga0496117_0014822 3300048920 Bacteria 6689
300 Ga0496118_0001334 3300048921 Bacteria 37487
301 Ga0496118_0017361 3300048921 Bacteria 6552
302 Ga0496118_0054318 3300048921 Bacteria 3035
303 Ga0496119_0000325 3300048922 Bacteria 67020
304 Ga0496119_0006327 3300048922 Bacteria 11024
305 Ga0496119_0011340 3300048922 Bacteria 7396
306 Ga0496119_0023558 3300048922 Bacteria 4359
307 Ga0496120_0000106 3300048923 Bacteria 140132
308 Ga0496120_0002863 3300048923 Bacteria 16599
309 Ga0496120_0005951 3300048923 Bacteria 9506
310 Ga0496121_0005428 3300048924 Bacteria 16358
311 Ga0496121_0147327 3300048924 Bacteria 1737
312 Ga0496122_0000737 3300048925 Bacteria 63852
313 Ga0496122_0002558 3300048925 Bacteria 25561
314 Ga0496122_0014272 3300048925 Bacteria 7695
315 Ga0496122_0016627 3300048925 Bacteria 6942
316 Ga0496122_0047385 3300048925 Bacteria 3318
317 Ga0496123_0000558 3300048926 Bacteria 63852
318 Ga0496123_0010781 3300048926 Bacteria 8020
319 Ga0496123_0016906 3300048926 Bacteria 5894
320 Ga0496123_0075488 3300048926 Bacteria 2080
321 Ga0496124_0000773 3300048927 Bacteria 52178
322 Ga0496124_0022309 3300048927 Bacteria 5806
323 Ga0496124_0060312 3300048927 Bacteria 3182
324 Ga0496125_0002110 3300048928 Bacteria 26706
325 Ga0496125_0010544 3300048928 Bacteria 9343
326 Ga0496125_0010669 3300048928 Bacteria 9275
327 Ga0496125_0014753 3300048928 Bacteria 7590
328 Ga0496125_0031237 3300048928 Bacteria 4749
329 Ga0496125_0043250 3300048928 Bacteria 3827
330 Ga0496125_0060171 3300048928 Bacteria 3055
331 Ga0496125_0105580 3300048928 Bacteria 2059
332 Ga0496126_0000053 3300048929 Bacteria 311989
333 Ga0496126_0006903 3300048929 Bacteria 12577
334 Ga0496126_0047991 3300048929 Bacteria 3907
335 Ga0496126_0066254 3300048929 Bacteria 3229
336 Ga0501316_000935 3300049532 Bacteria 2287
337 Ga0501031_0016782 3300049568 Bacteria 4756
338 Ga0501032_0009655 3300049569 Bacteria 6989
339 Ga0501033_0002786 3300049570 Bacteria 14656
340 Ga0501033_0003554 3300049570 Bacteria 12750
341 Ga0501033_0018023 3300049570 Bacteria 5332
342 Ga0501033_0057378 3300049570 Bacteria 2878
343 Ga0501037_0003652 3300049573 Bacteria 11163
344 Ga0501038_0177748 3300049574 Bacteria 1719
345 Ga0501041_0036706 3300049577 Bacteria 2969
346 Ga0501043_0001592 3300049579 Bacteria 19738
347 Ga0501047_0000475 3300049581 Bacteria 43718
348 Ga0501047_0047035 3300049581 Bacteria 4169
349 Ga0501070_0000455 3300049586 Bacteria 37179
350 Ga0501070_0000785 3300049586 Bacteria 28832
351 Ga0501070_0013197 3300049586 Bacteria 6964
352 Ga0501070_0080192 3300049586 Bacteria 2700
353 Ga0501074_0034052 3300049590 Bacteria 3693
354 Ga0501074_0130749 3300049590 Bacteria 1796
355 Ga0501076_0012848 3300049592 Bacteria 6265
356 Ga0501077_0010638 3300049593 Bacteria 5730
357 Ga0501257_005723 3300049686 Bacteria 2747
358 Ga0501080_0002692 3300049742 Bacteria 15565
359 Ga0501080_0159812 3300049742 Bacteria 2081
360 Ga0501083_0003173 3300049744 Bacteria 11437
361 Ga0501035_0001012 3300049822 Bacteria 29624
362 Ga0501035_0002205 3300049822 Bacteria 19338
363 Ga0501035_0030243 3300049822 Bacteria 4937
364 Ga0501044_0003449 3300049823 Bacteria 17806
365 Ga0501044_0013556 3300049823 Bacteria 8809
366 Ga0501044_0039273 3300049823 Bacteria 4938
367 Ga0501044_0080666 3300049823 Bacteria 3295
368 Ga0501044_0210149 3300049823 Bacteria 1900
369 Ga0501044_0253886 3300049823 Bacteria 1698
370 Ga0501045_0115972 3300049824 Bacteria 1987
371 nmdc:mga03683_1092_c1 3300050489 Bacteria 7936
372 nmdc:mga03683_12476_c1 3300050489 Bacteria 3106
373 nmdc:mga03683_1714_c2 3300050489 Bacteria 6244
374 nmdc:mga00v17_22_c1 3300050491 Bacteria 108510
375 nmdc:mga0yw44_315_c1 3300050492 Bacteria 16881
376 nmdc:mga0yw44_46_c1 3300050492 Bacteria 41723
377 nmdc:mga0yw44_64364_c1 3300050492 Bacteria 2257
378 nmdc:mga0yw44_782_c1 3300050492 Bacteria 11804
379 nmdc:mga0k408_11108_c1 3300050493 Bacteria 4894
380 nmdc:mga0k408_66783_c1 3300050493 Bacteria 2095
381 nmdc:mga06z11_18955_c1 3300050494 Bacteria 3154
382 nmdc:mga06z11_2145_c1 3300050494 Bacteria 7485
383 nmdc:mga06z11_5919_c1 3300050494 Bacteria 4941
384 nmdc:mga06z11_6192_c1 3300050494 Bacteria 4848
385 nmdc:mga04h51_45808_c1 3300050495 Bacteria 1448
386 nmdc:mga07m45_2815_c1 3300050496 Bacteria 6775
387 nmdc:mga08y16_54177_c1 3300050511 Bacteria 4191
388 nmdc:mga0n895_47222_c1 3300050512 Bacteria 4209
389 nmdc:mga0sz30_236_c1 3300050516 Bacteria 21153
390 nmdc:mga0sz30_444_c1 3300050516 Bacteria 15663
391 Ga0500595_014739 3300053119 Bacteria 2956
392 Ga0500618_000327 3300053125 Bacteria 34529
393 Ga0500658_0000080 3300053134 Bacteria 44662
394 Ga0500559_0062710 3300053136 Bacteria 1660
395 Ga0500561_0000059 3300053137 Bacteria 21801
396 Ga0500616_0000308 3300053153 Bacteria 70261
397 Ga0500636_0000009 3300053177 Bacteria 155504
398 Ga0500636_0001474 3300053177 Bacteria 12770
399 Ga0587084_004368 3300059477 Bacteria 1615
400 Ga0587084_004633 3300059477 Bacteria 1583
401 Ga0587093_003496 3300059478 Bacteria 1545
402 Ga0587066_005142 3300059490 Bacteria 1657
403 Ga0587082_001971 3300059504 Bacteria 2245
404 Ga0587083_0007437 3300059505 Bacteria 1677
405 Ga0587091_002400 3300059511 Bacteria 2213
406 Ga0587109_004090 3300059624 Bacteria 1997
407 Ga0587117_000818 3300059627 Bacteria 2356
408 Ga0587067_003076 3300059640 Bacteria 2054
409 Ga0587068_002186 3300059641 Bacteria 2340
410 Ga0587072_000494 3300059643 Bacteria 4014
411 Ga0587100_000820 3300059648 Bacteria 1645
412 Ga0501082_0004064 3300060353 Bacteria 12759
413 Ga0501082_0045568 3300060353 Bacteria 3782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005843 Ga0068860_100060174 Ga0068860_1000601742 397
2 3300026095 Ga0207676_10135572 Ga0207676_101355722 397
3 3300028381 Ga0268264_10115302 Ga0268264_101153023 397
4 3300042007 Ga0439449_0061736 Ga0439449_0061736_14_1252 397
5 3300048926 Ga0496123_0075488 Ga0496123_0075488_10_1248 397
6 3300050495 nmdc:mga04h51_45808_c1 nmdc:mga04h51_45808_c1_24_1262 397
7 3300039062 Ga0400483_229198 Ga0400483_229198_48_1319 405
8 3300036401 Ga0373937_0040080 Ga0373937_0040080_709_2025 414
9 3300003792 Ga0055540_1000077 Ga0055540_10000777 416
10 3300003792 Ga0055540_1000095 Ga0055540_100009550 416
11 3300025298 Ga0209050_1009781 Ga0209050_10097813 416
12 3300025303 Ga0209051_1000027 Ga0209051_1000027329 416
13 3300025304 Ga0209257_1000744 Ga0209257_100074435 416
14 3300041463 Ga0451804_0492287 Ga0451804_0492287_233_1537 416
15 3300049823 Ga0501044_0003449 Ga0501044_0003449_16403_17785 434
16 3300009545 Ga0105237_10078550 Ga0105237_100785502 438
17 3300010375 Ga0105239_10221850 Ga0105239_102218501 438
18 3300026088 Ga0207641_10021886 Ga0207641_100218861 438
19 3300048907 Ga0496104_0018727 Ga0496104_0018727_1005_2369 438
20 3300021384 Ga0213876_10001665 Ga0213876_100016653 440
21 3300039437 Ga0436365_0934609 Ga0436365_0934609_15222_16706 440
22 3300005458 Ga0070681_10099247 Ga0070681_100992472 443
23 3300025912 Ga0207707_10095149 Ga0207707_100951492 443
24 3300039437 Ga0436365_0904212 Ga0436365_0904212_1339_2757 447
25 3300039453 Ga0436362_0422974 Ga0436362_0422974_1359_2777 447
26 3300046526 Ga0495666_0049978 Ga0495666_0049978_103_1617 453
27 3300005468 Ga0070707_100006370 Ga0070707_10000637010 454
28 3300005471 Ga0070698_100024358 Ga0070698_1000243585 454
29 3300005518 Ga0070699_100020618 Ga0070699_1000206184 454
30 3300005536 Ga0070697_100007582 Ga0070697_1000075825 454
31 3300025297 Ga0209758_1002910 Ga0209758_10029107 454
32 3300025910 Ga0207684_10007944 Ga0207684_100079446 454
33 3300025922 Ga0207646_10071451 Ga0207646_100714512 454
34 3300039447 Ga0436361_0083698 Ga0436361_0083698_16930_18429 454
35 iso_pu_bacteria 2883577096 2883577208 454
36 3300037853 Ga0436364_1190373 Ga0436364_1190373_588_2075 456
37 3300005439 Ga0070711_100104795 Ga0070711_1001047952 457
38 3300009147 Ga0114129_10002939 Ga0114129_1000293915 457
39 3300039453 Ga0436362_0804175 Ga0436362_0804175_3419_4909 457
40 3300039453 Ga0436362_0936557 Ga0436362_0936557_257_1747 457
41 3300050512 nmdc:mga0n895_47222_c1 nmdc:mga0n895_47222_c1_1748_3178 457
42 3300005434 Ga0070709_10028989 Ga0070709_100289892 458
43 3300005435 Ga0070714_100039802 Ga0070714_1000398023 458
44 3300005436 Ga0070713_100158231 Ga0070713_1001582311 458
45 3300006175 Ga0070712_100056596 Ga0070712_1000565962 458
46 3300010159 Ga0099796_10003304 Ga0099796_100033042 458
47 3300013105 Ga0157369_10049007 Ga0157369_100490073 458
48 3300025906 Ga0207699_10031219 Ga0207699_100312192 458
49 3300025928 Ga0207700_10018091 Ga0207700_100180913 458
50 3300026118 Ga0207675_100117528 Ga0207675_1001175282 458
51 3300035120 Ga0373957_0027892 Ga0373957_0027892_531_2021 458
52 3300035725 Ga0373947_0085706 Ga0373947_0085706_227_1717 458
53 3300036401 Ga0373937_0017239 Ga0373937_0017239_93_1583 458
54 3300037068 Ga0373925_0019779 Ga0373925_0019779_1833_3323 458
55 3300037853 Ga0436364_0635819 Ga0436364_0635819_937_2430 458
56 3300046543 Ga0495645_0015415 Ga0495645_0015415_3723_5213 458
57 3300046675 Ga0495657_0073038 Ga0495657_0073038_659_2149 458
58 3300046679 Ga0495623_0092728 Ga0495623_0092728_90_1580 458
59 3300046680 Ga0495646_0011239 Ga0495646_0011239_655_2145 458
60 3300048088 Ga0495602_0002298 Ga0495602_0002298_3031_4521 458
61 3300059478 Ga0587093_003496 Ga0587093_003496_40_1533 458
62 3300003659 JGI25404J52841_10000302 JGI25404J52841_100003025 459
63 3300005334 Ga0068869_100004251 Ga0068869_1000042518 459
64 3300005457 Ga0070662_100011152 Ga0070662_1000111523 459
65 3300005471 Ga0070698_100020829 Ga0070698_1000208294 459
66 3300005843 Ga0068860_100040575 Ga0068860_1000405752 459
67 3300005937 Ga0081455_10012731 Ga0081455_100127316 459
68 3300005983 Ga0081540_1000692 Ga0081540_10006927 459
69 3300009176 Ga0105242_10103472 Ga0105242_101034722 459
70 3300009553 Ga0105249_10021199 Ga0105249_100211994 459
71 3300010375 Ga0105239_10059822 Ga0105239_100598224 459
72 3300025933 Ga0207706_10019567 Ga0207706_100195673 459
73 3300025942 Ga0207689_10009098 Ga0207689_100090984 459
74 3300026067 Ga0207678_10042957 Ga0207678_100429573 459
75 3300026075 Ga0207708_10029748 Ga0207708_100297483 459
76 3300026118 Ga0207675_100000690 Ga0207675_10000069013 459
77 3300031507 Ga0307509_10000027 Ga0307509_10000027101 459
78 3300039062 Ga0400483_093934 Ga0400483_093934_4357_5829 459
79 3300039062 Ga0400483_175476 Ga0400483_175476_4741_6213 459
80 3300048906 Ga0496103_0043235 Ga0496103_0043235_1238_2743 459
81 3300048921 Ga0496118_0054318 Ga0496118_0054318_1485_2990 459
82 3300039062 Ga0400483_092352 Ga0400483_092352_154363_155841 460
83 3300039062 Ga0400483_222800 Ga0400483_222800_231364_232842 460
84 3300037853 Ga0436364_1064044 Ga0436364_1064044_36_1532 461
85 3300021388 Ga0213875_10003402 Ga0213875_100034024 462
86 3300021388 Ga0213875_10008267 Ga0213875_100082674 462
87 3300037853 Ga0436364_0271401 Ga0436364_0271401_2945_4444 462
88 3300037853 Ga0436364_1007676 Ga0436364_1007676_3559_5055 462
89 3300036401 Ga0373937_0069881 Ga0373937_0069881_71_1564 463
90 3300037418 Ga0395900_0009611 Ga0395900_0009611_921_2417 463
91 3300046678 Ga0495599_0110902 Ga0495599_0110902_160_1653 463
92 3300047317 Ga0495604_0132406 Ga0495604_0132406_12_1505 463
93 3300047322 Ga0495680_0087376 Ga0495680_0087376_825_2318 463
94 3300035116 Ga0373945_0018979 Ga0373945_0018979_591_2084 464
95 3300035170 Ga0373943_0037195 Ga0373943_0037195_217_1710 464
96 3300035695 Ga0373927_0034831 Ga0373927_0034831_420_1913 464
97 3300037068 Ga0373925_0008091 Ga0373925_0008091_768_2261 464
98 3300048925 Ga0496122_0002558 Ga0496122_0002558_6623_8134 464
99 3300048928 Ga0496125_0060171 Ga0496125_0060171_1091_2602 464
100 3300037471 Ga0395905_0045549 Ga0395905_0045549_1280_2773 465
101 3300049577 Ga0501041_0036706 Ga0501041_0036706_520_2010 465
102 3300049592 Ga0501076_0012848 Ga0501076_0012848_979_2469 465
103 3300049593 Ga0501077_0010638 Ga0501077_0010638_883_2373 465
104 3300049686 Ga0501257_005723 Ga0501257_005723_1125_2618 465
105 3300049824 Ga0501045_0115972 Ga0501045_0115972_142_1632 465
106 3300060353 Ga0501082_0045568 Ga0501082_0045568_1039_2529 465
107 3300005985 Ga0081539_10000209 Ga0081539_1000020993 466
108 3300053136 Ga0500559_0062710 Ga0500559_0062710_23_1516 466
109 3300026035 Ga0207703_10035642 Ga0207703_100356422 467
110 3300037418 Ga0395900_0001806 Ga0395900_0001806_8771_10261 467
111 3300009092 Ga0105250_10000137 Ga0105250_1000013716 468
112 3300025711 Ga0207696_1000132 Ga0207696_100013254 468
113 3300039438 Ga0436360_1231205 Ga0436360_1231205_3131_4624 468
114 3300048915 Ga0496112_0070278 Ga0496112_0070278_1388_2881 468
115 3300049570 Ga0501033_0002786 Ga0501033_0002786_3760_5253 469
116 3300049574 Ga0501038_0177748 Ga0501038_0177748_46_1539 469
117 3300049581 Ga0501047_0000475 Ga0501047_0000475_31766_33259 469
118 3300049581 Ga0501047_0047035 Ga0501047_0047035_2171_3664 469
119 3300049586 Ga0501070_0000455 Ga0501070_0000455_105_1598 469
120 3300049586 Ga0501070_0000785 Ga0501070_0000785_10483_11976 469
121 3300049586 Ga0501070_0013197 Ga0501070_0013197_3803_5296 469
122 3300049586 Ga0501070_0080192 Ga0501070_0080192_454_1953 469
123 3300049590 Ga0501074_0034052 Ga0501074_0034052_1944_3437 469
124 3300049742 Ga0501080_0002692 Ga0501080_0002692_4640_6133 469
125 3300049742 Ga0501080_0159812 Ga0501080_0159812_68_1561 469
126 3300049822 Ga0501035_0001012 Ga0501035_0001012_645_2138 469
127 3300049822 Ga0501035_0002205 Ga0501035_0002205_16023_17522 469
128 3300049823 Ga0501044_0013556 Ga0501044_0013556_5633_7126 469
129 3300049823 Ga0501044_0080666 Ga0501044_0080666_1250_2743 469
130 iso_pu_bacteria 2511231027 2511393047 469
131 iso_pu_bacteria 2690315857 2691330679 469
132 iso_pu_bacteria 2842871566 2842872588 469
133 iso_pu_bacteria 2916178963 2916181484 469
134 iso_pu_bacteria 2919534386 2919535708 469
135 iso_pu_bacteria 8002745576 8002750070 469
136 iso_pu_bacteria 2738541276 2738714515 470
137 iso_pu_bacteria 2842775625 2842780033 470
138 iso_pu_bacteria 2894772417 2894775083 470
139 iso_pu_bacteria 2929199973 2929204262 470
140 iso_pu_bacteria 8054302542 8054305055 470
141 iso_pu_bacteria 8055909800 8055915119 470
142 3300005347 Ga0070668_100000660 Ga0070668_10000066016 471
143 3300005843 Ga0068860_100000070 Ga0068860_100000070122 471
144 3300025972 Ga0207668_10003286 Ga0207668_100032866 471
145 3300028380 Ga0268265_10010640 Ga0268265_100106404 471
146 3300028381 Ga0268264_10000029 Ga0268264_10000029147 471
147 3300028556 Ga0265337_1001011 Ga0265337_100101111 471
148 3300028573 Ga0265334_10000429 Ga0265334_1000042912 471
149 3300042876 Ga0451577_0011809 Ga0451577_0011809_4606_6078 471
150 3300048914 Ga0496111_0000352 Ga0496111_0000352_6618_8081 471
151 3300049569 Ga0501032_0009655 Ga0501032_0009655_4762_6255 471
152 3300049570 Ga0501033_0057378 Ga0501033_0057378_227_1726 471
153 3300049823 Ga0501044_0039273 Ga0501044_0039273_1817_3316 471
154 iso_pu_bacteria 2883577096 2883577209 471
155 3300003187 JGI25151J46595_10000143 JGI25151J46595_1000014355 472
156 3300025284 Ga0209130_1000160 Ga0209130_100016020 472
157 3300025294 Ga0209025_1000299 Ga0209025_100029953 472
158 3300025302 Ga0207426_1000098 Ga0207426_100009824 472
159 3300049568 Ga0501031_0016782 Ga0501031_0016782_1794_3287 472
160 3300049570 Ga0501033_0018023 Ga0501033_0018023_2647_4140 472
161 3300049573 Ga0501037_0003652 Ga0501037_0003652_2601_4094 472
162 3300049579 Ga0501043_0001592 Ga0501043_0001592_17347_18840 472
163 3300049822 Ga0501035_0030243 Ga0501035_0030243_2487_3980 472
164 3300049823 Ga0501044_0210149 Ga0501044_0210149_385_1878 472
165 iso_pu_bacteria 2671180531 2673161701 472
166 3300005340 Ga0070689_100218086 Ga0070689_1002180861 473
167 3300005354 Ga0070675_100029669 Ga0070675_1000296693 473
168 3300005365 Ga0070688_100117038 Ga0070688_1001170381 473
169 3300005445 Ga0070708_100027950 Ga0070708_1000279502 473
170 3300005467 Ga0070706_100048257 Ga0070706_1000482572 473
171 3300005471 Ga0070698_100002839 Ga0070698_10000283913 473
172 3300005518 Ga0070699_100017429 Ga0070699_1000174295 473
173 3300005985 Ga0081539_10004855 Ga0081539_100048552 473
174 3300006195 Ga0075366_10039134 Ga0075366_100391343 473
175 3300007265 Ga0099794_10022117 Ga0099794_100221172 473
176 3300009094 Ga0111539_10069776 Ga0111539_100697762 473
177 3300013104 Ga0157370_10069349 Ga0157370_100693492 473
178 3300025910 Ga0207684_10092166 Ga0207684_100921662 473
179 3300025960 Ga0207651_10103496 Ga0207651_101034962 473
180 3300031691 Ga0316579_10000150 Ga0316579_100001504 473
181 3300031691 Ga0316579_10002127 Ga0316579_100021273 473
182 3300032133 Ga0316583_10020861 Ga0316583_100208611 473
183 3300036647 Ga0316582_0002988 Ga0316582_0002988_862_2358 473
184 3300036712 Ga0316584_0006775 Ga0316584_0006775_3967_5463 473
185 3300039438 Ga0436360_0483293 Ga0436360_0483293_3403_4896 473
186 3300039438 Ga0436360_0611086 Ga0436360_0611086_565_2055 473
187 3300039447 Ga0436361_0445859 Ga0436361_0445859_2779_4272 473
188 3300048929 Ga0496126_0047991 Ga0496126_0047991_1065_2555 473
189 3300049570 Ga0501033_0003554 Ga0501033_0003554_568_2058 473
190 3300050493 nmdc:mga0k408_66783_c1 nmdc:mga0k408_66783_c1_114_1589 473
191 3300050511 nmdc:mga08y16_54177_c1 nmdc:mga08y16_54177_c1_753_2240 473
192 3300059477 Ga0587084_004633 Ga0587084_004633_56_1543 473
193 3300059624 Ga0587109_004090 Ga0587109_004090_493_1980 473
194 3300059627 Ga0587117_000818 Ga0587117_000818_127_1614 473
195 3300059641 Ga0587068_002186 Ga0587068_002186_566_2053 473
196 3300059648 Ga0587100_000820 Ga0587100_000820_111_1598 473
197 iso_pu_bacteria 2509276021 2509391331 473
198 iso_pu_bacteria 2510065019 2510136017 473
199 iso_pu_bacteria 2511231221 2512032886 473
200 iso_pu_bacteria 2513237093 2513630821 473
201 iso_pu_bacteria 2516143018 2516208338 473
202 iso_pu_bacteria 2524023250 2524609758 473
203 iso_pu_bacteria 2554235003 2554244216 473
204 iso_pu_bacteria 2582581308 2585282624 473
205 iso_pu_bacteria 2582581315 2585327767 473
206 iso_pu_bacteria 2582581316 2585331949 473
207 iso_pu_bacteria 2585427526 2585529921 473
208 iso_pu_bacteria 2585427527 2585537097 473
209 iso_pu_bacteria 2585427528 2585541751 473
210 iso_pu_bacteria 2585427530 2585556399 473
211 iso_pu_bacteria 2585427593 2585840030 473
212 iso_pu_bacteria 2585427634 2586004307 473
213 iso_pu_bacteria 2599185210 2599604806 473
214 iso_pu_bacteria 2599185236 2599719736 473
215 iso_pu_bacteria 2600255279 2601611511 473
216 iso_pu_bacteria 2600255308 2601748068 473
217 iso_pu_bacteria 2615840624 2616294957 473
218 iso_pu_bacteria 2615840626 2616310163 473
219 iso_pu_bacteria 2615840698 2616551327 473
220 iso_pu_bacteria 2617270742 2617385917 473
221 iso_pu_bacteria 2643221568 2643857129 473
222 iso_pu_bacteria 2643221582 2643922037 473
223 iso_pu_bacteria 2667528174 2671116143 473
224 iso_pu_bacteria 2718218232 2720610298 473
225 iso_pu_bacteria 2721755556 2723030252 473
226 iso_pu_bacteria 2721755685 2723569701 473
227 iso_pu_bacteria 2721755822 2724101248 473
228 iso_pu_bacteria 2728369352 2730110785 473
229 iso_pu_bacteria 2738541317 2738948618 473
230 iso_pu_bacteria 2738541333 2739036368 473
231 iso_pu_bacteria 2791355256 2793297255 473
232 iso_pu_bacteria 2791355261 2793327947 473
233 iso_pu_bacteria 2791355265 2793354483 473
234 iso_pu_bacteria 2791355266 2793362771 473
235 iso_pu_bacteria 2802429605 2805930251 473
236 iso_pu_bacteria 2802429606 2805934701 473
237 iso_pu_bacteria 2802429633 2806046471 473
238 iso_pu_bacteria 2802429634 2806052993 473
239 iso_pu_bacteria 2802429635 2806059800 473
240 iso_pu_bacteria 2802429636 2806068463 473
241 iso_pu_bacteria 2802429637 2806074887 473
242 iso_pu_bacteria 2818991448 2819612956 473
243 iso_pu_bacteria 2818991453 2819643872 473
244 iso_pu_bacteria 2818991461 2819686879 473
245 iso_pu_bacteria 2838668709 2838673036 473
246 iso_pu_bacteria 2838675328 2838678976 473
247 iso_pu_bacteria 2838680041 2838685414 473
248 iso_pu_bacteria 2838694306 2838699981 473
249 iso_pu_bacteria 2838701080 2838705760 473
250 iso_pu_bacteria 2838707686 2838713085 473
251 iso_pu_bacteria 2838714209 2838717927 473
252 iso_pu_bacteria 2838719591 2838723273 473
253 iso_pu_bacteria 2838724970 2838728644 473
254 iso_pu_bacteria 2841846520 2841851507 473
255 iso_pu_bacteria 2841859092 2841863595 473
256 iso_pu_bacteria 2842118031 2842124845 473
257 iso_pu_bacteria 2842124991 2842130091 473
258 iso_pu_bacteria 2842130223 2842133873 473
259 iso_pu_bacteria 2842152218 2842155863 473
260 iso_pu_bacteria 2842170452 2842174173 473
261 iso_pu_bacteria 2842175837 2842179487 473
262 iso_pu_bacteria 2842187318 2842191008 473
263 iso_pu_bacteria 2842192696 2842196714 473
264 iso_pu_bacteria 2842205361 2842209133 473
265 iso_pu_bacteria 2842211629 2842215323 473
266 iso_pu_bacteria 2842224351 2842228038 473
267 iso_pu_bacteria 2842237096 2842242498 473
268 iso_pu_bacteria 2842250916 2842255440 473
269 iso_pu_bacteria 2842278818 2842282821 473
270 iso_pu_bacteria 2842291075 2842296565 473
271 iso_pu_bacteria 2842317721 2842320379 473
272 iso_pu_bacteria 2842370503 2842374757 473
273 iso_pu_bacteria 2842377471 2842382966 473
274 iso_pu_bacteria 2842384541 2842390098 473
275 iso_pu_bacteria 2842489311 2842489346 473
276 iso_pu_bacteria 2842495871 2842498000 473
277 iso_pu_bacteria 2842515876 2842520378 473
278 iso_pu_bacteria 2844533157 2844539120 473
279 iso_pu_bacteria 2848858292 2848864328 473
280 iso_pu_bacteria 2854896431 2854897817 473
281 iso_pu_bacteria 2854916844 2854920598 473
282 iso_pu_bacteria 2857516855 2857518282 473
283 iso_pu_bacteria 2897803580 2897803945 473
284 iso_pu_bacteria 2899792073 2899793912 473
285 iso_pu_bacteria 2899803654 2899808551 473
286 iso_pu_bacteria 2899845264 2899848281 473
287 iso_pu_bacteria 2909042592 2909043191 473
288 iso_pu_bacteria 2913308742 2913313679 473
289 iso_pu_bacteria 2919114240 2919118208 473
290 iso_pu_bacteria 2919166419 2919170260 473
291 iso_pu_bacteria 2919171160 2919176478 473
292 iso_pu_bacteria 2926754445 2926757972 473
293 iso_pu_bacteria 2926760298 2926764909 473
294 iso_pu_bacteria 2933006813 2933010888 473
295 iso_pu_bacteria 2933011516 2933016070 473
296 iso_pu_bacteria 2933594066 2933599276 473
297 iso_pu_bacteria 2935894831 2935899458 473
298 iso_pu_bacteria 2936367885 2936370950 473
299 iso_pu_bacteria 2936375103 2936375790 473
300 iso_pu_bacteria 2936381700 2936383228 473
301 iso_pu_bacteria 2978969890 2978970020 473
302 iso_pu_bacteria 2979100975 2979102983 473
303 iso_pu_bacteria 2984587000 2984587038 473
304 iso_pu_bacteria 2996310559 2996311754 473
305 iso_pu_bacteria 2996893221 2996897307 473
306 iso_pu_bacteria 3005409236 3005412094 473
307 iso_pu_bacteria 3005416602 3005418080 473
308 iso_pu_bacteria 639633055 639645233 473
309 iso_pu_bacteria 650716007 650842320 473
310 iso_pu_bacteria 8005289223 8005295296 473
311 iso_pu_bacteria 8005314921 8005317925 473
312 iso_pu_bacteria 8005376324 8005380470 473
313 iso_pu_bacteria 8005382845 8005383029 473
314 iso_pu_bacteria 8005395548 8005398630 473
315 iso_pu_bacteria 8005484373 8005486155 473
316 iso_pu_bacteria 8005570704 8005572476 473
317 iso_pu_bacteria 8005658619 8005662163 473
318 iso_pu_bacteria 8005682033 8005686842 473
319 iso_pu_bacteria 8005695170 8005701122 473
320 iso_pu_bacteria 8018127388 8018129189 473
321 iso_pu_bacteria 8018150411 8018150706 473
322 iso_pu_bacteria 8024479707 8024485129 473
323 iso_pu_bacteria 8024501048 8024502867 473
324 iso_pu_bacteria 8054460903 8054465339 473
325 iso_pu_bacteria 8056382006 8056382239 473
326 iso_pu_bacteria 8057874678 8057878983 473
327 3300005355 Ga0070671_100004670 Ga0070671_1000046706 474
328 3300005367 Ga0070667_100000531 Ga0070667_10000053116 474
329 3300005843 Ga0068860_100024580 Ga0068860_1000245802 474
330 3300006844 Ga0075428_100042582 Ga0075428_1000425825 474
331 3300006871 Ga0075434_100058376 Ga0075434_1000583762 474
332 3300007076 Ga0075435_100079388 Ga0075435_1000793882 474
333 3300009545 Ga0105237_10006591 Ga0105237_100065919 474
334 3300009551 Ga0105238_10090886 Ga0105238_100908863 474
335 3300025914 Ga0207671_10025013 Ga0207671_100250132 474
336 3300025931 Ga0207644_10033526 Ga0207644_100335262 474
337 3300025986 Ga0207658_10000993 Ga0207658_1000099310 474
338 3300028381 Ga0268264_10026628 Ga0268264_100266282 474
339 3300031548 Ga0307408_100000127 Ga0307408_10000012720 474
340 3300031730 Ga0307516_10038052 Ga0307516_100380524 474
341 3300031901 Ga0307406_10002006 Ga0307406_100020064 474
342 3300046453 Ga0495627_000278 Ga0495627_000278_16753_18249 474
343 3300046507 Ga0495606_0035323 Ga0495606_0035323_41_1537 474
344 3300046512 Ga0495610_0000022 Ga0495610_0000022_63670_65166 474
345 3300046512 Ga0495610_0000207 Ga0495610_0000207_55119_56615 474
346 3300046515 Ga0495620_0008591 Ga0495620_0008591_1751_3247 474
347 3300046519 Ga0495632_0001043 Ga0495632_0001043_10987_12483 474
348 3300046522 Ga0495643_0000077 Ga0495643_0000077_55694_57190 474
349 3300046522 Ga0495643_0015205 Ga0495643_0015205_2785_4281 474
350 3300047470 Ga0495681_0000010 Ga0495681_0000010_191029_192525 474
351 3300047472 Ga0495686_0000491 Ga0495686_0000491_34490_35986 474
352 3300048922 Ga0496119_0000325 Ga0496119_0000325_42836_44344 474
353 3300048923 Ga0496120_0000106 Ga0496120_0000106_88305_89813 474
354 3300048926 Ga0496123_0010781 Ga0496123_0010781_1137_2633 474
355 3300048927 Ga0496124_0000773 Ga0496124_0000773_28506_30002 474
356 3300048927 Ga0496124_0022309 Ga0496124_0022309_495_1991 474
357 3300048928 Ga0496125_0105580 Ga0496125_0105580_150_1646 474
358 3300049532 Ga0501316_000935 Ga0501316_000935_425_1915 474
359 3300003203 JGI25406J46586_10000305 JGI25406J46586_100003055 475
360 3300005981 Ga0081538_10044266 Ga0081538_100442662 475
361 3300005985 Ga0081539_10000778 Ga0081539_1000077821 475
362 3300005985 Ga0081539_10001101 Ga0081539_1000110126 475
363 3300006048 Ga0075363_100003769 Ga0075363_1000037693 475
364 3300006178 Ga0075367_10004351 Ga0075367_100043515 475
365 3300006186 Ga0075369_10003966 Ga0075369_100039662 475
366 3300006195 Ga0075366_10024430 Ga0075366_100244302 475
367 3300009093 Ga0105240_10004391 Ga0105240_100043919 475
368 3300010375 Ga0105239_10000073 Ga0105239_1000007337 475
369 3300025901 Ga0207688_10054938 Ga0207688_100549381 475
370 3300028573 Ga0265334_10017547 Ga0265334_100175473 475
371 3300028800 Ga0265338_10044110 Ga0265338_100441103 475
372 3300030760 Ga0265762_1004627 Ga0265762_10046272 475
373 3300030877 Ga0265777_100268 Ga0265777_1002682 475
374 3300031548 Ga0307408_100195107 Ga0307408_1001951071 475
375 3300035121 Ga0373960_0023944 Ga0373960_0023944_136_1629 475
376 3300037418 Ga0395900_0092354 Ga0395900_0092354_1514_3001 475
377 3300046533 Ga0495640_0088550 Ga0495640_0088550_341_1831 475
378 3300049590 Ga0501074_0130749 Ga0501074_0130749_150_1637 475
379 3300049744 Ga0501083_0003173 Ga0501083_0003173_1603_3090 475
380 3300049823 Ga0501044_0253886 Ga0501044_0253886_102_1595 475
381 3300050489 nmdc:mga03683_1714_c2 nmdc:mga03683_1714_c2_1843_3336 475
382 3300050492 nmdc:mga0yw44_64364_c1 nmdc:mga0yw44_64364_c1_75_1565 475
383 3300050494 nmdc:mga06z11_2145_c1 nmdc:mga06z11_2145_c1_5209_6699 475
384 3300050494 nmdc:mga06z11_6192_c1 nmdc:mga06z11_6192_c1_2022_3515 475
385 3300050516 nmdc:mga0sz30_236_c1 nmdc:mga0sz30_236_c1_14876_16369 475
386 3300059505 Ga0587083_0007437 Ga0587083_0007437_52_1548 475
387 3300060353 Ga0501082_0004064 Ga0501082_0004064_4664_6151 475
388 iso_pu_bacteria 2821443989 2821448173 475
389 iso_pu_bacteria 2844533157 2844539241 475
390 3300005329 Ga0070683_100022087 Ga0070683_1000220873 476
391 3300005983 Ga0081540_1040957 Ga0081540_10409573 476
392 3300025944 Ga0207661_10197217 Ga0207661_101972172 476
393 3300032168 Ga0316593_10026657 Ga0316593_100266572 476
394 3300033524 Ga0316592_1009400 Ga0316592_10094002 476
395 3300037471 Ga0395905_0018025 Ga0395905_0018025_1705_3195 476
396 3300045051 Ga0451576_0004592 Ga0451576_0004592_8043_9536 476
397 3300001979 JGI24740J21852_10000095 JGI24740J21852_1000009510 477
398 3300002704 JGI25155J39150_1000047 JGI25155J39150_100004722 477
399 3300002705 JGI25156J39149_1000069 JGI25156J39149_100006924 477
400 3300002738 JGI25154J39366_1000091 JGI25154J39366_100009150 477
401 3300002741 JGI25157J39369_1000085 JGI25157J39369_100008524 477
402 3300002987 JGI25159J45721_1007752 JGI25159J45721_10077522 477
403 3300003187 JGI25151J46595_10000712 JGI25151J46595_100007127 477
404 3300003214 JGI25165J46597_1000076 JGI25165J46597_100007630 477
405 3300003215 JGI25153J46596_10003762 JGI25153J46596_100037624 477
406 3300003215 JGI25153J46596_10025914 JGI25153J46596_100259141 477
407 3300003320 rootH2_10267173 rootH2_102671733 477
408 3300003354 JGI25160J50197_1000081 JGI25160J50197_100008116 477
409 3300003354 JGI25160J50197_1005290 JGI25160J50197_10052902 477
410 3300003374 JGI25161J50226_1000063 JGI25161J50226_100006316 477
411 3300003374 JGI25161J50226_1002456 JGI25161J50226_10024562 477
412 3300003771 Ga0055526_1001883 Ga0055526_100188310 477
413 3300003775 Ga0055524_1003318 Ga0055524_10033183 477
414 3300003790 Ga0055528_1003407 Ga0055528_10034075 477
415 3300003790 Ga0055528_1004899 Ga0055528_10048994 477
416 3300003791 Ga0055530_10015911 Ga0055530_100159112 477
417 3300003792 Ga0055540_1002126 Ga0055540_10021261 477
418 3300003792 Ga0055540_1018625 Ga0055540_10186252 477
419 3300003794 Ga0055531_10001320 Ga0055531_1000132011 477
420 3300003856 Ga0058692_1001371 Ga0058692_10013712 477
421 3300003856 Ga0058692_1005398 Ga0058692_10053982 477
422 3300004625 Ga0055543_1000088 Ga0055543_10000883 477
423 3300004625 Ga0055543_1001594 Ga0055543_10015941 477
424 3300005262 Ga0065165_1000426 Ga0065165_100042644 477
425 3300005262 Ga0065165_1013169 Ga0065165_10131692 477
426 3300005548 Ga0070665_100049052 Ga0070665_1000490522 477
427 3300005548 Ga0070665_100081295 Ga0070665_1000812952 477
428 3300005578 Ga0068854_100117872 Ga0068854_1001178722 477
429 3300005614 Ga0068856_100001848 Ga0068856_1000018489 477
430 3300006038 Ga0075365_10001970 Ga0075365_100019706 477
431 3300006042 Ga0075368_10018555 Ga0075368_100185552 477
432 3300006048 Ga0075363_100003538 Ga0075363_1000035382 477
433 3300006048 Ga0075363_100021818 Ga0075363_1000218183 477
434 3300006051 Ga0075364_10094742 Ga0075364_100947422 477
435 3300006177 Ga0075362_10001965 Ga0075362_100019653 477
436 3300006178 Ga0075367_10062222 Ga0075367_100622222 477
437 3300006186 Ga0075369_10002552 Ga0075369_100025523 477
438 3300006186 Ga0075369_10012961 Ga0075369_100129611 477
439 3300006195 Ga0075366_10009995 Ga0075366_100099953 477
440 3300006195 Ga0075366_10010809 Ga0075366_100108094 477
441 3300006353 Ga0075370_10011429 Ga0075370_100114293 477
442 3300006948 Ga0099826_10000495 Ga0099826_100004958 477
443 3300009093 Ga0105240_10000214 Ga0105240_1000021490 477
444 3300009093 Ga0105240_10001222 Ga0105240_1000122222 477
445 3300009148 Ga0105243_10031629 Ga0105243_100316291 477
446 3300009545 Ga0105237_10002691 Ga0105237_100026918 477
447 3300010375 Ga0105239_10001559 Ga0105239_1000155921 477
448 3300011119 Ga0105246_10057280 Ga0105246_100572802 477
449 3300013102 Ga0157371_10000005 Ga0157371_1000000529 477
450 3300013102 Ga0157371_10005895 Ga0157371_100058955 477
451 3300013104 Ga0157370_10032595 Ga0157370_100325954 477
452 3300013105 Ga0157369_10064676 Ga0157369_100646762 477
453 3300013105 Ga0157369_10087514 Ga0157369_100875141 477
454 3300014497 Ga0182008_10019486 Ga0182008_100194861 477
455 3300015262 Ga0182007_10004456 Ga0182007_100044564 477
456 3300015265 Ga0182005_1004594 Ga0182005_10045943 477
457 3300025206 Ga0209435_100058 Ga0209435_10005850 477
458 3300025233 Ga0209437_100232 Ga0209437_10023261 477
459 3300025245 Ga0207425_1003224 Ga0207425_10032244 477
460 3300025246 Ga0209646_1000178 Ga0209646_100017850 477
461 3300025250 Ga0209026_1000208 Ga0209026_100020850 477
462 3300025253 Ga0209677_101586 Ga0209677_1015863 477
463 3300025256 Ga0209759_1000242 Ga0209759_100024250 477
464 3300025258 Ga0209129_1000394 Ga0209129_100039412 477
465 3300025261 Ga0209233_1000010 Ga0209233_1000010564 477
466 3300025261 Ga0209233_1000235 Ga0209233_100023561 477
467 3300025261 Ga0209233_1000394 Ga0209233_100039417 477
468 3300025273 Ga0209673_1000799 Ga0209673_100079927 477
469 3300025273 Ga0209673_1003925 Ga0209673_10039255 477
470 3300025284 Ga0209130_1000162 Ga0209130_100016217 477
471 3300025284 Ga0209130_1014604 Ga0209130_10146041 477
472 3300025292 Ga0209676_1006108 Ga0209676_10061083 477
473 3300025294 Ga0209025_1001491 Ga0209025_10014918 477
474 3300025295 Ga0209564_1001594 Ga0209564_10015948 477
475 3300025297 Ga0209758_1000440 Ga0209758_100044040 477
476 3300025297 Ga0209758_1002677 Ga0209758_10026773 477
477 3300025297 Ga0209758_1035629 Ga0209758_10356292 477
478 3300025299 Ga0209256_1002541 Ga0209256_10025419 477
479 3300025302 Ga0207426_1000126 Ga0207426_1000126174 477
480 3300025302 Ga0207426_1000556 Ga0207426_100055629 477
481 3300025303 Ga0209051_1004091 Ga0209051_10040914 477
482 3300025303 Ga0209051_1005327 Ga0209051_10053272 477
483 3300025304 Ga0209257_1003038 Ga0209257_10030384 477
484 3300025903 Ga0207680_10066884 Ga0207680_100668842 477
485 3300025913 Ga0207695_10000373 Ga0207695_1000037373 477
486 3300025913 Ga0207695_10006334 Ga0207695_1000633410 477
487 3300025914 Ga0207671_10000536 Ga0207671_1000053615 477
488 3300025981 Ga0207640_10084365 Ga0207640_100843652 477
489 3300027312 Ga0209371_1002587 Ga0209371_10025877 477
490 3300027666 Ga0209282_1000490 Ga0209282_100049010 477
491 3300030500 Ga0268256_1002945 Ga0268256_10029457 477
492 3300041413 Ga0439465_0013893 Ga0439465_0013893_888_2369 477
493 3300041491 Ga0451833_0023225 Ga0451833_0023225_17766_19247 477
494 3300041492 Ga0451835_0149410 Ga0451835_0149410_13052_14533 477
495 3300041498 Ga0451841_0973233 Ga0451841_0973233_2837_4318 477
496 3300041501 Ga0451845_0636556 Ga0451845_0636556_13394_14875 477
497 3300041503 Ga0451847_0042196 Ga0451847_0042196_18012_19493 477
498 3300041505 Ga0451849_0149307 Ga0451849_0149307_2686_4167 477
499 3300041509 Ga0451843_0907409 Ga0451843_0907409_18012_19493 477
500 3300041512 Ga0451853_2199883 Ga0451853_2199883_687_2168 477
501 3300045976 Ga0466967_0008734 Ga0466967_0008734_5660_7183 477
502 3300047470 Ga0495681_0004906 Ga0495681_0004906_526_2004 477
503 3300048903 Ga0496100_0001126 Ga0496100_0001126_4131_5609 477
504 3300048905 Ga0496102_0073562 Ga0496102_0073562_447_1925 477
505 3300048906 Ga0496103_0009866 Ga0496103_0009866_4045_5523 477
506 3300048909 Ga0496106_0162685 Ga0496106_0162685_86_1567 477
507 3300048916 Ga0496113_0062041 Ga0496113_0062041_1022_2500 477
508 3300048919 Ga0496116_0000042 Ga0496116_0000042_30342_31823 477
509 3300048919 Ga0496116_0022834 Ga0496116_0022834_1881_3359 477
510 3300048920 Ga0496117_0000489 Ga0496117_0000489_37447_38928 477
511 3300048920 Ga0496117_0014822 Ga0496117_0014822_1674_3155 477
512 3300048921 Ga0496118_0001334 Ga0496118_0001334_16871_18352 477
513 3300048921 Ga0496118_0017361 Ga0496118_0017361_1845_3326 477
514 3300048922 Ga0496119_0006327 Ga0496119_0006327_4303_5781 477
515 3300048922 Ga0496119_0011340 Ga0496119_0011340_5454_6935 477
516 3300048922 Ga0496119_0023558 Ga0496119_0023558_1392_2870 477
517 3300048923 Ga0496120_0002863 Ga0496120_0002863_9728_11209 477
518 3300048923 Ga0496120_0005951 Ga0496120_0005951_5925_7403 477
519 3300048924 Ga0496121_0005428 Ga0496121_0005428_3166_4644 477
520 3300048924 Ga0496121_0147327 Ga0496121_0147327_202_1698 477
521 3300048925 Ga0496122_0000737 Ga0496122_0000737_30094_31575 477
522 3300048925 Ga0496122_0014272 Ga0496122_0014272_1325_2803 477
523 3300048925 Ga0496122_0016627 Ga0496122_0016627_1153_2634 477
524 3300048925 Ga0496122_0047385 Ga0496122_0047385_911_2389 477
525 3300048926 Ga0496123_0000558 Ga0496123_0000558_30094_31575 477
526 3300048926 Ga0496123_0016906 Ga0496123_0016906_3300_4781 477
527 3300048927 Ga0496124_0060312 Ga0496124_0060312_1301_2782 477
528 3300048928 Ga0496125_0002110 Ga0496125_0002110_7180_8658 477
529 3300048928 Ga0496125_0010544 Ga0496125_0010544_546_2024 477
530 3300048928 Ga0496125_0010669 Ga0496125_0010669_6688_8169 477
531 3300048928 Ga0496125_0014753 Ga0496125_0014753_4539_6020 477
532 3300048928 Ga0496125_0031237 Ga0496125_0031237_1238_2719 477
533 3300048928 Ga0496125_0043250 Ga0496125_0043250_1282_2778 477
534 3300048929 Ga0496126_0000053 Ga0496126_0000053_262033_263514 477
535 3300048929 Ga0496126_0006903 Ga0496126_0006903_10995_12476 477
536 3300048929 Ga0496126_0066254 Ga0496126_0066254_1358_2836 477
537 3300050489 nmdc:mga03683_1092_c1 nmdc:mga03683_1092_c1_3757_5238 477
538 3300050489 nmdc:mga03683_12476_c1 nmdc:mga03683_12476_c1_283_1764 477
539 3300050491 nmdc:mga00v17_22_c1 nmdc:mga00v17_22_c1_21606_23087 477
540 3300050492 nmdc:mga0yw44_315_c1 nmdc:mga0yw44_315_c1_9293_10774 477
541 3300050492 nmdc:mga0yw44_46_c1 nmdc:mga0yw44_46_c1_11188_12669 477
542 3300050492 nmdc:mga0yw44_782_c1 nmdc:mga0yw44_782_c1_5759_7240 477
543 3300050493 nmdc:mga0k408_11108_c1 nmdc:mga0k408_11108_c1_32_1513 477
544 3300050494 nmdc:mga06z11_18955_c1 nmdc:mga06z11_18955_c1_1133_2614 477
545 3300050494 nmdc:mga06z11_5919_c1 nmdc:mga06z11_5919_c1_2444_3925 477
546 3300050496 nmdc:mga07m45_2815_c1 nmdc:mga07m45_2815_c1_700_2181 477
547 3300050516 nmdc:mga0sz30_444_c1 nmdc:mga0sz30_444_c1_11732_13213 477
548 3300053119 Ga0500595_014739 Ga0500595_014739_99_1592 477
549 3300053125 Ga0500618_000327 Ga0500618_000327_14511_15989 477
550 3300053134 Ga0500658_0000080 Ga0500658_0000080_22332_23813 477
551 3300053137 Ga0500561_0000059 Ga0500561_0000059_5729_7210 477
552 3300053153 Ga0500616_0000308 Ga0500616_0000308_39676_41157 477
553 3300053177 Ga0500636_0000009 Ga0500636_0000009_103873_105354 477
554 3300053177 Ga0500636_0001474 Ga0500636_0001474_7539_9017 477
555 3300059477 Ga0587084_004368 Ga0587084_004368_86_1579 477
556 3300059490 Ga0587066_005142 Ga0587066_005142_59_1540 477
557 3300059504 Ga0587082_001971 Ga0587082_001971_684_2165 477
558 3300059511 Ga0587091_002400 Ga0587091_002400_73_1554 477
559 3300059640 Ga0587067_003076 Ga0587067_003076_504_1985 477
560 3300059643 Ga0587072_000494 Ga0587072_000494_767_2248 477

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18945

VipB_2

EvpB/VC_A0108, tail sheath gpW/gp25-like domain

392

503

0.99

PF05943

VipB

EvpB/VC_A0108, tail sheath N-terminal domain

78

383

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5urx-assembly1.cif.gz_1B structure of the contracted type vi secretion system sheath in myxococcus xanthus 0.872 59 475
3j9g-assembly1.cif.gz_B atomic model of the vipa/vipb, the type six secretion system contractile sheath of vibrio cholerae from cryo-em 0.8691 57 476
5mxn-assembly1.cif.gz_A atomic model of the vipa/vipb/hcp, the type six secretion system non-contractile sheath-tube of vibrio cholerae from cryo-em 0.8541 20 473
5ojq-assembly1.cif.gz_C the modeled structure of of wild type extended type vi secretion system sheath/tube complex in vibrio cholerae based on cryo-em reconstruction of the non-contractile sheath/tube complex 0.8541 20 473
3j9g-assembly1.cif.gz_B atomic model of the vipa/vipb, the type six secretion system contractile sheath of vibrio cholerae from cryo-em 0.8446 57 476
ID Description Score Start End Superfamily
af_Q9W4L7_16_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6397 18 57 1.10.10.10
af_D3ZD36_98_197_1.20.1250.10 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.5653 378 425 1.20.1250.10
af_P0DSP1_102_437_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5582 431 454 2.60.40.10
af_Q8CDT7_1_92_1.20.1250.10 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.5463 378 423 1.20.1250.10
af_O88307_133_586_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5373 431 454 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7Y0X3R1-F1-model_v4 Type VI secretion system contractile sheath large subunit 0.9685 253 337
AF-A0A6A8Q0P7-F1-model_v4 deleted 0.9431 173 353
AF-A0A7X5N2G0-F1-model_v4 Type VI secretion system contractile sheath large subunit 0.9368 259 385
AF-A0A2T9UMC3-F1-model_v4 Type VI secretion system contractile sheath large subunit 0.9364 203 375
AF-A0A2X3L0K4-F1-model_v4 Uncharacterized protein conserved in bacteria 0.9362 187 366

Feature Viewer

pLDDT pTM Quality
82.08 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map