F463551

General Info

Members Datasets Scaffolds Average Seq Length
559 302 530 299

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10052599|Ga0105238_100525994
Length 351
Sequence MVAWFQNYTPKLCCTTLLEAHKRLPLTKQKLKSGNCKLGTDILFVFPEDLALAQQKFNVGLIQMSTTPDPDKNLQRAIDKIHQASARGAHIVCLPELFQTQYFCQRQDANLFDLAEPIPSPVTNRLATLAKQLRIVLIASLFEKRAPGVYHNTAVIFDADGSLRGLYRKMHIPDDPLYYEKYYFTPGDLGYRAFDTAVGRVGTLVCWDQWYPEGARLTALQGAQILFYPTAIGWHPSEKAEFGQAQHDAWRTIQRAHAIANGVYVAVVNRVGHETGDIRGNAVAGDGLEFWGASFLCDPFGRVTAEASHDKEEVLIGEVDFRVVEDVRRNWPFLRDRRIDSYGAITNRLSD

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
4 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
5 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
6 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
7 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
8 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
9 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
10 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
11 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
12 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
13 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
14 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
15 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
16 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
17 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
18 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
19 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
20 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
21 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
22 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
23 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
24 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
25 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
26 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
159 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
163 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
167 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
222 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
223 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
277 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
280 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
296 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
300 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
301 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
302 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.1
Metatranscriptomes 0.72
Isolates 5.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0.89
Rhizoplane 3.22
Rhizosphere 88.19
Stem 0
Stem Tuber 0
Unclassified 6.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1006967 3300003578 Bacteria 972
2 Ga0065714_10004146 3300005288 Bacteria 5965
3 Ga0065714_10066564 3300005288 Bacteria 6644
4 Ga0065714_10069104 3300005288 Bacteria 4368
5 Ga0065714_10077319 3300005288 Bacteria 2701
6 Ga0065712_10116560 3300005290 Bacteria 1734
7 Ga0065715_10109837 3300005293 Bacteria 2649
8 Ga0070658_10306633 3300005327 Bacteria 1354
9 Ga0070683_100089029 3300005329 Bacteria 2897
10 Ga0070683_100142852 3300005329 Bacteria 2267
11 Ga0070683_100308101 3300005329 Bacteria 1507
12 Ga0068869_100285342 3300005334 Bacteria 1329
13 Ga0068869_100330994 3300005334 Bacteria 1237
14 Ga0070666_10092117 3300005335 Bacteria 2083
15 Ga0070680_100046697 3300005336 Bacteria 3524
16 Ga0070682_100007246 3300005337 Bacteria 6249
17 Ga0068868_100004905 3300005338 Bacteria 9396
18 Ga0068868_100179453 3300005338 Bacteria 1756
19 Ga0070660_100053497 3300005339 Bacteria 3114
20 Ga0070689_100092621 3300005340 Bacteria 2384
21 Ga0070691_10004988 3300005341 Bacteria 6038
22 Ga0070673_100247586 3300005364 Bacteria 1552
23 Ga0070659_100052298 3300005366 Bacteria 3212
24 Ga0070667_100052802 3300005367 Bacteria 3430
25 Ga0070709_10077486 3300005434 Bacteria 2161
26 Ga0070709_10114134 3300005434 Bacteria 1820
27 Ga0070709_10134806 3300005434 Bacteria 1690
28 Ga0070714_100062522 3300005435 Bacteria 3200
29 Ga0070714_100160752 3300005435 Bacteria 2032
30 Ga0070713_100000671 3300005436 Bacteria 21916
31 Ga0070713_100044503 3300005436 Bacteria 3634
32 Ga0070713_100055770 3300005436 Bacteria 3285
33 Ga0070713_100205524 3300005436 Bacteria 1780
34 Ga0070711_100005278 3300005439 Bacteria 7711
35 Ga0070711_100364363 3300005439 Bacteria 1165
36 Ga0070705_100091310 3300005440 Bacteria 1898
37 Ga0070708_100033387 3300005445 Bacteria 4471
38 Ga0070708_100065359 3300005445 Bacteria 3262
39 Ga0070708_100181214 3300005445 Bacteria 1969
40 Ga0070663_100016186 3300005455 Bacteria 4834
41 Ga0070663_100017583 3300005455 Bacteria 4670
42 Ga0070681_10016992 3300005458 Bacteria 7270
43 Ga0070681_10020317 3300005458 Bacteria 6657
44 Ga0070681_10099687 3300005458 Bacteria 2851
45 Ga0068867_100070565 3300005459 Bacteria 2612
46 Ga0070706_100010274 3300005467 Bacteria 8697
47 Ga0070706_100013873 3300005467 Bacteria 7450
48 Ga0070706_100051944 3300005467 Bacteria 3784
49 Ga0070706_100440219 3300005467 Bacteria 1213
50 Ga0070707_100030715 3300005468 Bacteria 5117
51 Ga0070707_100068123 3300005468 Bacteria 3424
52 Ga0070707_100623873 3300005468 Bacteria 1040
53 Ga0070698_100420296 3300005471 Bacteria 1271
54 Ga0070699_100014010 3300005518 Bacteria 6898
55 Ga0070699_100067938 3300005518 Bacteria 3095
56 Ga0070699_100095156 3300005518 Bacteria 2607
57 Ga0070699_100098316 3300005518 Bacteria 2564
58 Ga0070679_100054386 3300005530 Bacteria 3985
59 Ga0070684_100030327 3300005535 Bacteria 4593
60 Ga0070684_100153703 3300005535 Bacteria 2086
61 Ga0070697_100000056 3300005536 Bacteria 86619
62 Ga0070697_100003325 3300005536 Bacteria 12350
63 Ga0070697_100014354 3300005536 Bacteria 6222
64 Ga0070697_100037446 3300005536 Bacteria 3919
65 Ga0070697_100140395 3300005536 Bacteria 2032
66 Ga0070697_100366207 3300005536 Bacteria 1246
67 Ga0070695_100083942 3300005545 Bacteria 2112
68 Ga0070696_100003740 3300005546 Bacteria 10162
69 Ga0070696_100089873 3300005546 Bacteria 2184
70 Ga0070665_100000059 3300005548 Bacteria 224560
71 Ga0070665_100026102 3300005548 Bacteria 5882
72 Ga0070704_100117018 3300005549 Bacteria 2039
73 Ga0068855_100005496 3300005563 Bacteria 15463
74 Ga0070664_100102415 3300005564 Bacteria 2491
75 Ga0068857_100094948 3300005577 Bacteria 2670
76 Ga0068857_100139584 3300005577 Bacteria 2190
77 Ga0068854_100001808 3300005578 Bacteria 13009
78 Ga0068856_100021190 3300005614 Bacteria 6313
79 Ga0068856_100054304 3300005614 Bacteria 3951
80 Ga0068856_100392361 3300005614 Bacteria 1408
81 Ga0068852_100060005 3300005616 Bacteria 3300
82 Ga0068859_100207493 3300005617 Bacteria 2045
83 Ga0068864_100387604 3300005618 Bacteria 1326
84 Ga0068866_10082389 3300005718 Bacteria 1731
85 Ga0068858_100011173 3300005842 Bacteria 8489
86 Ga0068860_100032066 3300005843 Bacteria 5051
87 Ga0068860_100131493 3300005843 Bacteria 2402
88 Ga0070717_10014279 3300006028 Bacteria 6108
89 Ga0070717_10091306 3300006028 Bacteria 2571
90 Ga0075364_10198911 3300006051 Bacteria 1358
91 Ga0070716_100075269 3300006173 Bacteria 1997
92 Ga0070712_100012345 3300006175 Bacteria 5429
93 Ga0070712_100248550 3300006175 Bacteria 1420
94 Ga0097621_100033259 3300006237 Bacteria 4104
95 Ga0097621_100137625 3300006237 Bacteria 2084
96 Ga0068871_100000746 3300006358 Bacteria 22033
97 Ga0075428_100002951 3300006844 Bacteria 18545
98 Ga0075428_100092022 3300006844 Bacteria 3307
99 Ga0075428_100278158 3300006844 Bacteria 1801
100 Ga0075431_100027400 3300006847 Bacteria 5846
101 Ga0075434_100263666 3300006871 Bacteria 1742
102 Ga0075429_100339995 3300006880 Bacteria 1314
103 Ga0068865_100046255 3300006881 Bacteria 2985
104 Ga0068865_100363607 3300006881 Bacteria 1176
105 Ga0075436_100000786 3300006914 Bacteria 21067
106 Ga0075436_100021569 3300006914 Bacteria 4421
107 Ga0075436_100035931 3300006914 Bacteria 3418
108 Ga0097620_100207490 3300006931 Bacteria 2045
109 Ga0099824_1009165 3300006942 Bacteria 12295
110 Ga0079104_1000179 3300006946 Bacteria 90381
111 Ga0099826_10039471 3300006948 Bacteria 3302
112 Ga0075435_100233244 3300007076 Bacteria 1564
113 Ga0105244_10000004 3300009036 Bacteria 492478
114 Ga0105240_10002067 3300009093 Bacteria 32884
115 Ga0105240_10288550 3300009093 Bacteria 1882
116 Ga0105240_10364574 3300009093 Bacteria 1635
117 Ga0105240_10684781 3300009093 Bacteria 1121
118 Ga0105240_10859012 3300009093 Bacteria 979
119 Ga0105245_10016053 3300009098 Bacteria 6524
120 Ga0105245_10137523 3300009098 Bacteria 2297
121 Ga0105247_10112348 3300009101 Bacteria 1755
122 Ga0105247_10186241 3300009101 Bacteria 1388
123 Ga0114129_10030396 3300009147 Bacteria 7642
124 Ga0114129_10068234 3300009147 Bacteria 4958
125 Ga0114129_10359478 3300009147 Bacteria 1927
126 Ga0105241_10008113 3300009174 Bacteria 7729
127 Ga0105241_10009152 3300009174 Bacteria 7290
128 Ga0105242_10018631 3300009176 Bacteria 5430
129 Ga0105242_10072894 3300009176 Bacteria 2854
130 Ga0105242_10153815 3300009176 Bacteria 2008
131 Ga0105242_10211059 3300009176 Bacteria 1730
132 Ga0105248_10022854 3300009177 Bacteria 6943
133 Ga0105248_10074776 3300009177 Bacteria 3807
134 Ga0105248_10303248 3300009177 Bacteria 1799
135 Ga0105237_10120283 3300009545 Bacteria 2620
136 Ga0105237_10126899 3300009545 Bacteria 2545
137 Ga0105237_10401164 3300009545 Bacteria 1376
138 Ga0105238_10052599 3300009551 Bacteria 4094
139 Ga0105238_10069401 3300009551 Bacteria 3525
140 Ga0105238_10607154 3300009551 Bacteria 1102
141 Ga0105249_10146928 3300009553 Bacteria 2266
142 Ga0105239_10132220 3300010375 Bacteria 2776
143 Ga0105239_10569768 3300010375 Bacteria 1290
144 Ga0105246_10163332 3300011119 Bacteria 1699
145 Ga0105246_10229509 3300011119 Bacteria 1461
146 Ga0157373_10000002 3300013100 Bacteria 750094
147 Ga0157371_10008727 3300013102 Bacteria 8045
148 Ga0157370_10001033 3300013104 Bacteria 35017
149 Ga0157370_10003309 3300013104 Bacteria 19002
150 Ga0157370_10012803 3300013104 Bacteria 8672
151 Ga0157370_10013108 3300013104 Bacteria 8555
152 Ga0157370_10026706 3300013104 Bacteria 5697
153 Ga0157370_10275536 3300013104 Bacteria 1554
154 Ga0157370_10311689 3300013104 Bacteria 1452
155 Ga0157369_10075607 3300013105 Bacteria 3610
156 Ga0157369_10214531 3300013105 Bacteria 2016
157 Ga0157369_10349089 3300013105 Bacteria 1537
158 Ga0157374_10027875 3300013296 Bacteria 5099
159 Ga0157374_10038456 3300013296 Bacteria 4398
160 Ga0157374_10203970 3300013296 Bacteria 1937
161 Ga0157378_10001165 3300013297 Bacteria 23923
162 Ga0157378_10002118 3300013297 Bacteria 17654
163 Ga0157378_10195401 3300013297 Bacteria 1911
164 Ga0157378_10349689 3300013297 Bacteria 1444
165 Ga0163162_10004350 3300013306 Bacteria 13633
166 Ga0163162_10052708 3300013306 Bacteria 4086
167 Ga0163162_10189777 3300013306 Bacteria 2182
168 Ga0163162_10200284 3300013306 Bacteria 2125
169 Ga0157372_10023921 3300013307 Bacteria 6628
170 Ga0157372_10037501 3300013307 Bacteria 5348
171 Ga0157372_10038635 3300013307 Bacteria 5267
172 Ga0157372_10055773 3300013307 Bacteria 4413
173 Ga0157372_10104628 3300013307 Bacteria 3236
174 Ga0157372_10195713 3300013307 Bacteria 2342
175 Ga0157372_10370739 3300013307 Bacteria 1668
176 Ga0157375_10282395 3300013308 Bacteria 1823
177 Ga0157375_10672267 3300013308 Bacteria 1190
178 Ga0163163_10013381 3300014325 Bacteria 7511
179 Ga0163163_10052875 3300014325 Bacteria 4008
180 Ga0163163_10058448 3300014325 Bacteria 3813
181 Ga0157380_10035500 3300014326 Bacteria 3852
182 Ga0157380_10160624 3300014326 Bacteria 1953
183 Ga0157379_10002234 3300014968 Bacteria 16113
184 Ga0157379_10008944 3300014968 Bacteria 8728
185 Ga0157376_10025610 3300014969 Bacteria 4649
186 Ga0157376_10091405 3300014969 Bacteria 2636
187 Ga0182006_1017349 3300015261 Bacteria 3060
188 Ga0163161_10000007 3300017792 Bacteria 301614
189 Ga0213875_10000103 3300021388 Bacteria 96738
190 Ga0213875_10007340 3300021388 Bacteria 5700
191 Ga0213875_10045127 3300021388 Bacteria 2069
192 Ga0224712_10139236 3300022467 Bacteria 1066
193 Ga0228598_1003984 3300024227 Bacteria 3144
194 Ga0207656_10082372 3300025321 Bacteria 1448
195 Ga0207655_1000008 3300025728 Bacteria 734289
196 Ga0207642_10028907 3300025899 Bacteria 2289
197 Ga0207710_10062168 3300025900 Bacteria 1696
198 Ga0207699_10025061 3300025906 Bacteria 3271
199 Ga0207699_10042227 3300025906 Bacteria 2640
200 Ga0207645_10012241 3300025907 Bacteria 5826
201 Ga0207705_10014739 3300025909 Bacteria 5620
202 Ga0207684_10017495 3300025910 Bacteria 6149
203 Ga0207684_10076720 3300025910 Bacteria 2841
204 Ga0207654_10034275 3300025911 Bacteria 2820
205 Ga0207654_10047212 3300025911 Bacteria 2460
206 Ga0207695_10005671 3300025913 Bacteria 16476
207 Ga0207695_10007205 3300025913 Bacteria 14226
208 Ga0207695_10010371 3300025913 Bacteria 11404
209 Ga0207695_10081279 3300025913 Bacteria 3280
210 Ga0207695_10501107 3300025913 Bacteria 1096
211 Ga0207671_10038421 3300025914 Bacteria 3548
212 Ga0207657_10009793 3300025919 Bacteria 9608
213 Ga0207657_10041434 3300025919 Bacteria 4072
214 Ga0207646_10000016 3300025922 Bacteria 337048
215 Ga0207646_10068113 3300025922 Bacteria 3179
216 Ga0207646_10209126 3300025922 Bacteria 1762
217 Ga0207694_10002979 3300025924 Bacteria 13589
218 Ga0207694_10058190 3300025924 Bacteria 3006
219 Ga0207694_10097675 3300025924 Bacteria 2324
220 Ga0207687_10002547 3300025927 Bacteria 12373
221 Ga0207687_10109316 3300025927 Bacteria 2048
222 Ga0207700_10001522 3300025928 Bacteria 13124
223 Ga0207700_10007378 3300025928 Bacteria 6717
224 Ga0207700_10119628 3300025928 Bacteria 2133
225 Ga0207700_10272033 3300025928 Bacteria 1454
226 Ga0207700_10351261 3300025928 Bacteria 1284
227 Ga0207664_10010105 3300025929 Bacteria 6654
228 Ga0207664_10066868 3300025929 Bacteria 2882
229 Ga0207706_10000075 3300025933 Bacteria 102980
230 Ga0207686_10016208 3300025934 Bacteria 4178
231 Ga0207686_10048624 3300025934 Bacteria 2628
232 Ga0207686_10085014 3300025934 Bacteria 2074
233 Ga0207670_10083325 3300025936 Bacteria 2243
234 Ga0207704_10019331 3300025938 Bacteria 3575
235 Ga0207704_10141428 3300025938 Bacteria 1684
236 Ga0207704_10247698 3300025938 Bacteria 1335
237 Ga0207711_10147898 3300025941 Bacteria 2118
238 Ga0207689_10042747 3300025942 Bacteria 3747
239 Ga0207689_10071125 3300025942 Bacteria 2857
240 Ga0207689_10090770 3300025942 Bacteria 2510
241 Ga0207661_10064568 3300025944 Bacteria 2968
242 Ga0207661_10426764 3300025944 Bacteria 1205
243 Ga0207667_10001499 3300025949 Bacteria 29319
244 Ga0207667_10007732 3300025949 Bacteria 12851
245 Ga0207667_10046952 3300025949 Bacteria 4572
246 Ga0207712_10043421 3300025961 Bacteria 3101
247 Ga0207668_10004334 3300025972 Bacteria 8331
248 Ga0207640_10012867 3300025981 Bacteria 4780
249 Ga0207703_10147289 3300026035 Bacteria 2049
250 Ga0207678_10000103 3300026067 Bacteria 69649
251 Ga0207678_10026135 3300026067 Bacteria 5094
252 Ga0207708_10079088 3300026075 Bacteria 2525
253 Ga0207641_10027453 3300026088 Bacteria 4701
254 Ga0207641_10244565 3300026088 Bacteria 1673
255 Ga0207648_10006119 3300026089 Bacteria 11996
256 Ga0207648_10009044 3300026089 Bacteria 9581
257 Ga0207674_10009982 3300026116 Bacteria 10806
258 Ga0207674_10101224 3300026116 Bacteria 2862
259 Ga0207674_10137495 3300026116 Bacteria 2404
260 Ga0207674_10711082 3300026116 Bacteria 970
261 Ga0207675_100010887 3300026118 Bacteria 8520
262 Ga0207675_100017027 3300026118 Bacteria 6792
263 Ga0207683_10069806 3300026121 Bacteria 3103
264 Ga0207683_10111174 3300026121 Bacteria 2453
265 Ga0207683_10340208 3300026121 Bacteria 1376
266 Ga0209281_1000116 3300027111 Bacteria 209707
267 Ga0209282_1032878 3300027666 Bacteria 3166
268 Ga0268266_10124559 3300028379 Bacteria 2298
269 Ga0268266_10192144 3300028379 Bacteria 1864
270 Ga0268266_10247871 3300028379 Bacteria 1647
271 Ga0268264_10100482 3300028381 Bacteria 2512
272 Ga0268264_10117162 3300028381 Bacteria 2342
273 Ga0265337_1039542 3300028556 Bacteria 1363
274 Ga0265326_10010989 3300028558 Bacteria 2678
275 Ga0265334_10006298 3300028573 Bacteria 5124
276 Ga0265334_10057252 3300028573 Bacteria 1478
277 Ga0265318_10000224 3300028577 Bacteria 48801
278 Ga0265318_10008554 3300028577 Bacteria 4548
279 Ga0265323_10002895 3300028653 Bacteria 7698
280 Ga0265323_10016687 3300028653 Bacteria 2861
281 Ga0265323_10048631 3300028653 Bacteria 1512
282 Ga0265336_10013437 3300028666 Bacteria 2730
283 Ga0307515_10135185 3300028794 Bacteria 2686
284 Ga0265338_10000016 3300028800 Bacteria 347424
285 Ga0265338_10002506 3300028800 Bacteria 27353
286 Ga0265338_10008201 3300028800 Bacteria 12730
287 Ga0265338_10076627 3300028800 Bacteria 2831
288 Ga0265338_10187940 3300028800 Bacteria 1568
289 Ga0265324_10000022 3300029957 Bacteria 167667
290 Ga0265324_10000063 3300029957 Bacteria 91952
291 Ga0265324_10008096 3300029957 Bacteria 4209
292 Ga0265324_10014546 3300029957 Bacteria 2910
293 Ga0265760_10002015 3300031090 Archaea 5976
294 Ga0265330_10000849 3300031235 Bacteria 19161
295 Ga0265330_10002397 3300031235 Bacteria 10239
296 Ga0265330_10002939 3300031235 Bacteria 9072
297 Ga0265330_10004876 3300031235 Bacteria 6761
298 Ga0265330_10015239 3300031235 Bacteria 3557
299 Ga0265330_10024850 3300031235 Bacteria 2716
300 Ga0265332_10000044 3300031238 Bacteria 114444
301 Ga0265332_10000686 3300031238 Bacteria 21713
302 Ga0265328_10008323 3300031239 Bacteria 4284
303 Ga0265328_10010390 3300031239 Bacteria 3750
304 Ga0265320_10004323 3300031240 Bacteria 9328
305 Ga0265320_10005189 3300031240 Bacteria 8403
306 Ga0265320_10118840 3300031240 Bacteria 1207
307 Ga0265325_10001540 3300031241 Bacteria 16132
308 Ga0265329_10000251 3300031242 Bacteria 28670
309 Ga0265329_10003082 3300031242 Bacteria 7380
310 Ga0265329_10005817 3300031242 Bacteria 4949
311 Ga0265340_10000916 3300031247 Bacteria 16739
312 Ga0265340_10017650 3300031247 Bacteria 3691
313 Ga0265340_10048214 3300031247 Bacteria 2072
314 Ga0265339_10000010 3300031249 Bacteria 214721
315 Ga0265339_10015894 3300031249 Bacteria 4500
316 Ga0265339_10031038 3300031249 Bacteria 3022
317 Ga0265331_10000076 3300031250 Bacteria 145884
318 Ga0265331_10046058 3300031250 Bacteria 2103
319 Ga0265316_10000006 3300031344 Bacteria 289686
320 Ga0265316_10000054 3300031344 Bacteria 124687
321 Ga0265316_10002763 3300031344 Bacteria 17979
322 Ga0265316_10004322 3300031344 Bacteria 14176
323 Ga0265316_10022719 3300031344 Bacteria 5281
324 Ga0265316_10027939 3300031344 Bacteria 4661
325 Ga0265316_10035082 3300031344 Bacteria 4069
326 Ga0265316_10080641 3300031344 Bacteria 2495
327 Ga0265316_10296707 3300031344 Bacteria 1178
328 Ga0307509_10123494 3300031507 Bacteria 2561
329 Ga0307408_100002894 3300031548 Bacteria 11896
330 Ga0265313_10003719 3300031595 Bacteria 12147
331 Ga0265313_10028980 3300031595 Bacteria 2869
332 Ga0265314_10000017 3300031711 Bacteria 340498
333 Ga0265314_10000056 3300031711 Bacteria 171647
334 Ga0265314_10003050 3300031711 Bacteria 16520
335 Ga0265314_10004948 3300031711 Bacteria 12160
336 Ga0265314_10103444 3300031711 Bacteria 1825
337 Ga0265314_10138984 3300031711 Bacteria 1504
338 Ga0265314_10207558 3300031711 Bacteria 1153
339 Ga0265342_10000128 3300031712 Bacteria 84420
340 Ga0265342_10000368 3300031712 Bacteria 49570
341 Ga0265342_10012423 3300031712 Bacteria 5769
342 Ga0265342_10026968 3300031712 Bacteria 3597
343 Ga0265342_10058307 3300031712 Bacteria 2282
344 Ga0265342_10141794 3300031712 Bacteria 1340
345 Ga0316576_10130815 3300031727 Bacteria 1888
346 Ga0307413_10003912 3300031824 Bacteria 6375
347 Ga0307410_10000115 3300031852 Bacteria 28127
348 Ga0307410_10004592 3300031852 Bacteria 7166
349 Ga0307406_10000111 3300031901 Bacteria 46791
350 Ga0307407_10008551 3300031903 Bacteria 4708
351 Ga0307407_10126718 3300031903 Bacteria 1627
352 Ga0307414_10000001 3300032004 Bacteria 1352954
353 Ga0307414_10121444 3300032004 Bacteria 2009
354 Ga0307414_10282008 3300032004 Bacteria 1396
355 Ga0307411_10000013 3300032005 Bacteria 145335
356 Ga0307411_10002284 3300032005 Bacteria 8393
357 Ga0307411_10214715 3300032005 Bacteria 1488
358 Ga0373959_0006217 3300034820 Bacteria 1976
359 Ga0373926_0003601 3300035083 Bacteria 5025
360 Ga0373926_0009181 3300035083 Bacteria 3300
361 Ga0373926_0014350 3300035083 Bacteria 2693
362 Ga0373926_0019795 3300035083 Bacteria 2322
363 Ga0373929_0006477 3300035085 Bacteria 2117
364 Ga0373923_0022455 3300035111 Bacteria 2475
365 Ga0373923_0161770 3300035111 Bacteria 1021
366 Ga0373932_0046409 3300035112 Bacteria 1274
367 Ga0373936_0000679 3300035113 Bacteria 11833
368 Ga0373936_0063037 3300035113 Bacteria 1517
369 Ga0373953_0041548 3300035117 Bacteria 1830
370 Ga0373956_0003328 3300035119 Bacteria 6473
371 Ga0373956_0054175 3300035119 Bacteria 1807
372 Ga0373943_0184738 3300035170 Bacteria 1147
373 Ga0373955_0002990 3300035172 Bacteria 7405
374 Ga0373942_0014620 3300035207 Bacteria 1903
375 Ga0373924_0013101 3300035410 Bacteria 3111
376 Ga0373931_0029780 3300035691 Bacteria 2806
377 Ga0373935_0056029 3300035692 Bacteria 2512
378 Ga0373935_0117773 3300035692 Bacteria 1771
379 Ga0373927_0004452 3300035695 Bacteria 9815
380 Ga0373927_0004743 3300035695 Bacteria 9472
381 Ga0373927_0009837 3300035695 Bacteria 6409
382 Ga0373933_0095011 3300035724 Bacteria 1844
383 Ga0373933_0116569 3300035724 Bacteria 1670
384 Ga0373947_0044626 3300035725 Bacteria 2650
385 Ga0373937_0046658 3300036401 Bacteria 3962
386 Ga0373937_0326650 3300036401 Bacteria 1452
387 Ga0373925_0061915 3300037068 Bacteria 2812
388 Ga0373925_0298449 3300037068 Bacteria 1300
389 Ga0395898_0137759 3300037466 Bacteria 2337
390 Ga0395905_0263386 3300037471 Bacteria 1609
391 Ga0436364_0658052 3300037853 Bacteria 2452
392 Ga0436364_0822356 3300037853 Bacteria 1276
393 Ga0436364_1188517 3300037853 Bacteria 3709
394 Ga0436364_1306996 3300037853 Bacteria 3732
395 Ga0436365_0073490 3300039437 Bacteria 1206
396 Ga0436365_0998318 3300039437 Bacteria 1350
397 Ga0436360_0490098 3300039438 Bacteria 1674
398 Ga0436362_0306584 3300039453 Bacteria 2306
399 Ga0436362_0442697 3300039453 Bacteria 3279
400 Ga0436362_1032274 3300039453 Bacteria 4257
401 Ga0439447_002257 3300041407 Bacteria 7068
402 Ga0439466_0002554 3300041411 Bacteria 7128
403 Ga0451837_0054513 3300041494 Bacteria 2187
404 Ga0439446_0005985 3300042156 Bacteria 3151
405 Ga0439435_0021925 3300042436 Bacteria 1663
406 Ga0451577_0000173 3300042876 Bacteria 142333
407 Ga0451577_0000531 3300042876 Bacteria 63238
408 Ga0451577_0003545 3300042876 Bacteria 17247
409 Ga0451577_0004786 3300042876 Bacteria 14151
410 Ga0451577_0030222 3300042876 Bacteria 4895
411 Ga0451577_0041603 3300042876 Bacteria 4124
412 Ga0451577_0089705 3300042876 Bacteria 2743
413 Ga0451577_0098319 3300042876 Bacteria 2614
414 Ga0451577_0166528 3300042876 Bacteria 1986
415 Ga0451577_0374375 3300042876 Bacteria 1292
416 Ga0453683_0000548 3300044673 Bacteria 41756
417 Ga0453683_0013874 3300044673 Bacteria 5241
418 Ga0453683_0042311 3300044673 Bacteria 2860
419 Ga0466963_0000193 3300044694 Bacteria 25611
420 Ga0453684_0000324 3300044712 Bacteria 201431
421 Ga0453684_0000968 3300044712 Bacteria 94634
422 Ga0453684_0001343 3300044712 Bacteria 72090
423 Ga0453684_0001454 3300044712 Bacteria 67293
424 Ga0453684_0019540 3300044712 Bacteria 10302
425 Ga0453684_0049970 3300044712 Bacteria 5506
426 Ga0453684_0470204 3300044712 Bacteria 1396
427 Ga0466959_0135539 3300045049 Bacteria 1743
428 Ga0451576_0000613 3300045051 Bacteria 74967
429 Ga0451576_0005720 3300045051 Bacteria 15490
430 Ga0451576_0147833 3300045051 Bacteria 2450
431 Ga0466967_0001058 3300045976 Bacteria 15165
432 Ga0466967_0098432 3300045976 Bacteria 2671
433 Ga0466967_0652805 3300045976 Bacteria 1040
434 Ga0495580_0006268 3300046472 Bacteria 9724
435 Ga0495580_0026885 3300046472 Bacteria 4191
436 Ga0495580_0029553 3300046472 Bacteria 3976
437 Ga0495580_0039807 3300046472 Bacteria 3363
438 Ga0495580_0112870 3300046472 Bacteria 1887
439 Ga0495580_0317473 3300046472 Bacteria 1059
440 Ga0495582_0000591 3300046473 Bacteria 20062
441 Ga0495582_0014082 3300046473 Bacteria 4401
442 Ga0495608_0036263 3300046511 Bacteria 3320
443 Ga0495630_0248695 3300046517 Bacteria 1358
444 Ga0495665_0001144 3300046531 Bacteria 14085
445 Ga0495586_0014687 3300046535 Bacteria 4162
446 Ga0495633_0142313 3300046558 Bacteria 1109
447 Ga0495623_0027200 3300046679 Bacteria 3678
448 Ga0495646_0003801 3300046680 Bacteria 9441
449 Ga0495658_0084803 3300046683 Bacteria 1866
450 Ga0495613_0160644 3300046689 Bacteria 1599
451 Ga0495624_0006840 3300046690 Bacteria 8048
452 Ga0495581_0106821 3300047315 Bacteria 1627
453 Ga0495674_0007702 3300047319 Bacteria 10289
454 Ga0495674_0055000 3300047319 Bacteria 3492
455 Ga0495674_0159009 3300047319 Bacteria 1891
456 Ga0495675_0019902 3300047444 Bacteria 4264
457 Ga0495675_0198504 3300047444 Bacteria 1222
458 Ga0495684_0027401 3300047471 Bacteria 4375
459 Ga0495684_0058713 3300047471 Bacteria 2930
460 Ga0495593_0009089 3300047673 Bacteria 5766
461 Ga0496100_0100742 3300048903 Bacteria 1990
462 Ga0496102_0002570 3300048905 Bacteria 15469
463 Ga0496102_0116928 3300048905 Bacteria 2488
464 Ga0496102_0567567 3300048905 Bacteria 1057
465 Ga0496103_0016516 3300048906 Bacteria 4405
466 Ga0496103_0085927 3300048906 Bacteria 1982
467 Ga0496104_0026550 3300048907 Bacteria 5350
468 Ga0496104_0146919 3300048907 Bacteria 2264
469 Ga0496104_0245552 3300048907 Bacteria 1703
470 Ga0496104_0266991 3300048907 Bacteria 1624
471 Ga0496107_0092997 3300048910 Bacteria 2205
472 Ga0496109_0212553 3300048912 Bacteria 1819
473 Ga0496109_0381514 3300048912 Bacteria 1331
474 Ga0496112_0035758 3300048915 Bacteria 4841
475 Ga0496112_0141920 3300048915 Bacteria 2371
476 Ga0496112_0182016 3300048915 Bacteria 2065
477 Ga0496113_0222835 3300048916 Bacteria 1503
478 Ga0496115_0316274 3300048918 Bacteria 1278
479 Ga0496116_0000047 3300048919 Bacteria 315121
480 Ga0496118_0075921 3300048921 Bacteria 2393
481 Ga0496121_0009482 3300048924 Bacteria 11176
482 Ga0496124_0024755 3300048927 Bacteria 5450
483 Ga0496124_0152485 3300048927 Bacteria 1811
484 Ga0496125_0000050 3300048928 Bacteria 286703
485 Ga0496126_0005294 3300048929 Bacteria 14809
486 Ga0501323_013347 3300049539 Bacteria 1015
487 Ga0501031_0075344 3300049568 Bacteria 2197
488 Ga0501034_0022373 3300049571 Bacteria 6443
489 Ga0501039_0122677 3300049575 Bacteria 2037
490 Ga0501041_0105516 3300049577 Bacteria 1746
491 Ga0501042_0081683 3300049578 Bacteria 2316
492 Ga0501046_0000028 3300049580 Bacteria 194675
493 Ga0501047_0100734 3300049581 Bacteria 2768
494 Ga0501048_0070562 3300049582 Bacteria 2467
495 Ga0501048_0211690 3300049582 Bacteria 1375
496 Ga0501071_0058745 3300049587 Bacteria 2781
497 Ga0501073_0041528 3300049589 Bacteria 3250
498 Ga0501075_0041214 3300049591 Bacteria 3460
499 Ga0501077_0011246 3300049593 Bacteria 5585
500 Ga0501249_000033 3300049679 Bacteria 73096
501 Ga0501249_001379 3300049679 Bacteria 5013
502 Ga0501257_039613 3300049686 Bacteria 1154
503 Ga0501080_0111597 3300049742 Bacteria 2535
504 Ga0501266_000005 3300049763 Bacteria 346750
505 Ga0501269_012482 3300049766 Bacteria 1037
506 Ga0501035_0071779 3300049822 Bacteria 3065
507 Ga0501035_0248099 3300049822 Bacteria 1513
508 Ga0501044_0004275 3300049823 Bacteria 16022
509 Ga0501044_0045900 3300049823 Bacteria 4525
510 Ga0501045_0108415 3300049824 Bacteria 2058
511 nmdc:mga00v17_290599_c1 3300050491 Bacteria 1061
512 nmdc:mga05p37_35920_c1 3300050507 Bacteria 6081
513 nmdc:mga09592_329509_c1 3300050508 Bacteria 1322
514 nmdc:mga0qj67_8316_c1 3300050509 Bacteria 7690
515 nmdc:mga06r32_15116_c1 3300050510 Bacteria 7009
516 nmdc:mga0n895_127273_c1 3300050512 Bacteria 2571
517 nmdc:mga0n895_166621_c1 3300050512 Bacteria 2235
518 nmdc:mga0rr50_216449_c1 3300050513 Bacteria 1580
519 nmdc:mga0rr50_314450_c1 3300050513 Bacteria 1312
520 nmdc:mga08x19_10402_c1 3300050514 Bacteria 5585
521 nmdc:mga08x19_17930_c1 3300050514 Bacteria 4335
522 nmdc:mga08x19_555_c2 3300050514 Bacteria 19623
523 Ga0495619_0055744 3300053085 Bacteria 2619
524 Ga0500646_0003732 3300053090 Bacteria 3901
525 Ga0500641_0000027 3300053096 Bacteria 106908
526 Ga0500641_0002278 3300053096 Bacteria 6808
527 Ga0500658_0000021 3300053134 Bacteria 133042
528 Ga0500559_0052890 3300053136 Bacteria 1796
529 Ga0501084_0140321 3300054114 Bacteria 2035
530 Ga0501082_0134860 3300060353 Bacteria 2142

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047444 Ga0495675_0198504 Ga0495675_0198504_15_734 238
2 3300031235 Ga0265330_10004876 Ga0265330_100048764 264
3 3300031344 Ga0265316_10027939 Ga0265316_100279393 264
4 3300031712 Ga0265342_10141794 Ga0265342_101417942 264
5 3300005548 Ga0070665_100026102 Ga0070665_1000261022 277
6 3300005518 Ga0070699_100067938 Ga0070699_1000679382 280
7 3300005546 Ga0070696_100003740 Ga0070696_1000037404 280
8 3300014326 Ga0157380_10035500 Ga0157380_100355002 280
9 3300014326 Ga0157380_10160624 Ga0157380_101606242 280
10 3300031090 Ga0265760_10002015 Ga0265760_100020151 280
11 3300046517 Ga0495630_0248695 Ga0495630_0248695_348_1193 280
12 3300049593 Ga0501077_0011246 Ga0501077_0011246_255_1103 280
13 3300005518 Ga0070699_100095156 Ga0070699_1000951563 281
14 3300031235 Ga0265330_10024850 Ga0265330_100248502 281
15 3300005445 Ga0070708_100181214 Ga0070708_1001812141 282
16 3300005536 Ga0070697_100037446 Ga0070697_1000374461 282
17 3300005718 Ga0068866_10082389 Ga0068866_100823892 282
18 3300006175 Ga0070712_100248550 Ga0070712_1002485502 282
19 3300006871 Ga0075434_100263666 Ga0075434_1002636662 282
20 3300009174 Ga0105241_10009152 Ga0105241_100091522 282
21 3300009545 Ga0105237_10120283 Ga0105237_101202832 282
22 3300013297 Ga0157378_10195401 Ga0157378_101954011 282
23 3300013306 Ga0163162_10200284 Ga0163162_102002842 282
24 3300013307 Ga0157372_10037501 Ga0157372_100375012 282
25 3300014968 Ga0157379_10002234 Ga0157379_1000223411 282
26 3300021388 Ga0213875_10000103 Ga0213875_100001033 282
27 3300025928 Ga0207700_10351261 Ga0207700_103512611 282
28 3300035083 Ga0373926_0003601 Ga0373926_0003601_3213_4079 282
29 3300035112 Ga0373932_0046409 Ga0373932_0046409_189_1055 282
30 3300035113 Ga0373936_0000679 Ga0373936_0000679_8623_9489 282
31 3300035691 Ga0373931_0029780 Ga0373931_0029780_1142_2008 282
32 3300035695 Ga0373927_0004743 Ga0373927_0004743_173_1039 282
33 3300046473 Ga0495582_0000591 Ga0495582_0000591_3116_3982 282
34 3300046531 Ga0495665_0001144 Ga0495665_0001144_4451_5317 282
35 3300046679 Ga0495623_0027200 Ga0495623_0027200_814_1680 282
36 3300047315 Ga0495581_0106821 Ga0495581_0106821_454_1320 282
37 3300048903 Ga0496100_0100742 Ga0496100_0100742_636_1502 282
38 3300048905 Ga0496102_0002570 Ga0496102_0002570_4990_5856 282
39 3300048905 Ga0496102_0567567 Ga0496102_0567567_16_882 282
40 3300048906 Ga0496103_0085927 Ga0496103_0085927_669_1535 282
41 3300048907 Ga0496104_0026550 Ga0496104_0026550_4408_5274 282
42 3300048907 Ga0496104_0245552 Ga0496104_0245552_795_1661 282
43 3300048910 Ga0496107_0092997 Ga0496107_0092997_1061_1927 282
44 3300048912 Ga0496109_0381514 Ga0496109_0381514_372_1238 282
45 3300048915 Ga0496112_0035758 Ga0496112_0035758_3944_4810 282
46 3300050514 nmdc:mga08x19_10402_c1 nmdc:mga08x19_10402_c1_1610_2476 282
47 3300005334 Ga0068869_100285342 Ga0068869_1002853422 283
48 3300005341 Ga0070691_10004988 Ga0070691_100049884 283
49 3300025942 Ga0207689_10042747 Ga0207689_100427472 283
50 3300028381 Ga0268264_10100482 Ga0268264_101004822 283
51 3300028558 Ga0265326_10010989 Ga0265326_100109893 283
52 3300028573 Ga0265334_10006298 Ga0265334_100062987 283
53 3300028653 Ga0265323_10002895 Ga0265323_100028954 283
54 3300028653 Ga0265323_10016687 Ga0265323_100166872 283
55 3300028653 Ga0265323_10048631 Ga0265323_100486312 283
56 3300028800 Ga0265338_10076627 Ga0265338_100766272 283
57 3300031235 Ga0265330_10000849 Ga0265330_100008497 283
58 3300031235 Ga0265330_10002939 Ga0265330_100029395 283
59 3300031235 Ga0265330_10015239 Ga0265330_100152392 283
60 3300031242 Ga0265329_10000251 Ga0265329_100002515 283
61 3300031247 Ga0265340_10000916 Ga0265340_100009165 283
62 3300031344 Ga0265316_10000054 Ga0265316_1000005415 283
63 3300031344 Ga0265316_10002763 Ga0265316_1000276319 283
64 3300031344 Ga0265316_10022719 Ga0265316_100227192 283
65 3300031344 Ga0265316_10035082 Ga0265316_100350822 283
66 3300031344 Ga0265316_10296707 Ga0265316_102967071 283
67 3300031711 Ga0265314_10000017 Ga0265314_10000017138 283
68 3300031711 Ga0265314_10207558 Ga0265314_102075581 283
69 3300031712 Ga0265342_10012423 Ga0265342_100124231 283
70 3300039437 Ga0436365_0073490 Ga0436365_0073490_18_902 283
71 3300042436 Ga0439435_0021925 Ga0439435_0021925_488_1360 283
72 3300045976 Ga0466967_0652805 Ga0466967_0652805_130_1026 283
73 3300048918 Ga0496115_0316274 Ga0496115_0316274_406_1266 283
74 3300049580 Ga0501046_0000028 Ga0501046_0000028_110818_111705 285
75 3300060353 Ga0501082_0134860 Ga0501082_0134860_1008_1895 285
76 3300029957 Ga0265324_10000022 Ga0265324_1000002253 286
77 3300031711 Ga0265314_10138984 Ga0265314_101389842 286
78 3300046680 Ga0495646_0003801 Ga0495646_0003801_8071_8934 286
79 3300005340 Ga0070689_100092621 Ga0070689_1000926212 287
80 3300009553 Ga0105249_10146928 Ga0105249_101469282 287
81 3300014325 Ga0163163_10013381 Ga0163163_100133814 287
82 3300025936 Ga0207670_10083325 Ga0207670_100833253 287
83 3300006844 Ga0075428_100002951 Ga0075428_10000295110 288
84 3300026116 Ga0207674_10711082 Ga0207674_107110821 288
85 3300028666 Ga0265336_10013437 Ga0265336_100134372 288
86 3300049571 Ga0501034_0022373 Ga0501034_0022373_56_955 288
87 3300009101 Ga0105247_10186241 Ga0105247_101862411 289
88 3300014325 Ga0163163_10052875 Ga0163163_100528753 289
89 3300026121 Ga0207683_10340208 Ga0207683_103402081 289
90 3300031238 Ga0265332_10000044 Ga0265332_1000004429 289
91 3300031239 Ga0265328_10008323 Ga0265328_100083235 289
92 3300031240 Ga0265320_10118840 Ga0265320_101188401 289
93 3300031242 Ga0265329_10005817 Ga0265329_100058171 289
94 3300031249 Ga0265339_10031038 Ga0265339_100310383 289
95 3300031250 Ga0265331_10000076 Ga0265331_1000007694 289
96 3300031344 Ga0265316_10000006 Ga0265316_10000006152 289
97 3300031711 Ga0265314_10000056 Ga0265314_1000005658 289
98 3300031712 Ga0265342_10058307 Ga0265342_100583073 289
99 3300047319 Ga0495674_0007702 Ga0495674_0007702_6046_6987 289
100 3300047471 Ga0495684_0027401 Ga0495684_0027401_2584_3525 289
101 3300005434 Ga0070709_10134806 Ga0070709_101348062 290
102 3300005435 Ga0070714_100160752 Ga0070714_1001607522 290
103 3300005436 Ga0070713_100000671 Ga0070713_10000067117 290
104 3300005439 Ga0070711_100005278 Ga0070711_1000052784 290
105 3300006051 Ga0075364_10198911 Ga0075364_101989112 290
106 3300025906 Ga0207699_10042227 Ga0207699_100422272 290
107 3300025929 Ga0207664_10010105 Ga0207664_100101052 290
108 3300049589 Ga0501073_0041528 Ga0501073_0041528_1357_2289 290
109 3300050491 nmdc:mga00v17_290599_c1 nmdc:mga00v17_290599_c1_156_1031 290
110 3300005467 Ga0070706_100051944 Ga0070706_1000519445 291
111 3300009093 Ga0105240_10859012 Ga0105240_108590121 291
112 3300009147 Ga0114129_10359478 Ga0114129_103594781 291
113 3300025910 Ga0207684_10076720 Ga0207684_100767202 291
114 3300025922 Ga0207646_10068113 Ga0207646_100681133 291
115 3300028800 Ga0265338_10000016 Ga0265338_10000016219 291
116 3300028800 Ga0265338_10002506 Ga0265338_100025063 291
117 3300028800 Ga0265338_10008201 Ga0265338_1000820111 291
118 3300029957 Ga0265324_10008096 Ga0265324_100080964 291
119 3300031240 Ga0265320_10005189 Ga0265320_100051898 291
120 3300031241 Ga0265325_10001540 Ga0265325_1000154010 291
121 3300031247 Ga0265340_10017650 Ga0265340_100176504 291
122 3300031711 Ga0265314_10003050 Ga0265314_1000305020 291
123 3300031711 Ga0265314_10103444 Ga0265314_101034442 291
124 3300031712 Ga0265342_10026968 Ga0265342_100269682 291
125 3300035083 Ga0373926_0014350 Ga0373926_0014350_1261_2139 291
126 3300035111 Ga0373923_0161770 Ga0373923_0161770_30_908 291
127 3300035113 Ga0373936_0063037 Ga0373936_0063037_116_994 291
128 3300035410 Ga0373924_0013101 Ga0373924_0013101_1202_2080 291
129 3300035692 Ga0373935_0117773 Ga0373935_0117773_457_1356 291
130 3300046511 Ga0495608_0036263 Ga0495608_0036263_2122_3000 291
131 3300046690 Ga0495624_0006840 Ga0495624_0006840_538_1416 291
132 3300047444 Ga0495675_0019902 Ga0495675_0019902_410_1288 291
133 3300047673 Ga0495593_0009089 Ga0495593_0009089_1624_2502 291
134 iso_pu_bacteria 2513020052 2513236411 291
135 iso_pu_bacteria 2643221667 2644369848 291
136 iso_pu_bacteria 2738541279 2738731963 291
137 iso_pu_bacteria 2738541285 2738764528 291
138 iso_pu_bacteria 2738543007 2739213543 291
139 iso_pu_bacteria 2833640130 2833643088 291
140 iso_pu_bacteria 2904555929 2904556633 291
141 iso_pu_bacteria 2919683626 2919687800 291
142 iso_pu_bacteria 2929150217 2929153061 291
143 iso_pu_bacteria 8056440228 8056442923 291
144 3300005327 Ga0070658_10306633 Ga0070658_103066332 292
145 3300005329 Ga0070683_100308101 Ga0070683_1003081012 292
146 3300005364 Ga0070673_100247586 Ga0070673_1002475862 292
147 3300005436 Ga0070713_100044503 Ga0070713_1000445032 292
148 3300005439 Ga0070711_100364363 Ga0070711_1003643631 292
149 3300005455 Ga0070663_100017583 Ga0070663_1000175832 292
150 3300005458 Ga0070681_10016992 Ga0070681_100169924 292
151 3300005458 Ga0070681_10099687 Ga0070681_100996873 292
152 3300005459 Ga0068867_100070565 Ga0068867_1000705652 292
153 3300005563 Ga0068855_100005496 Ga0068855_1000054963 292
154 3300005617 Ga0068859_100207493 Ga0068859_1002074932 292
155 3300006237 Ga0097621_100033259 Ga0097621_1000332592 292
156 3300006847 Ga0075431_100027400 Ga0075431_1000274002 292
157 3300006880 Ga0075429_100339995 Ga0075429_1003399952 292
158 3300006881 Ga0068865_100046255 Ga0068865_1000462553 292
159 3300006881 Ga0068865_100363607 Ga0068865_1003636072 292
160 3300006914 Ga0075436_100021569 Ga0075436_1000215693 292
161 3300006931 Ga0097620_100207490 Ga0097620_1002074902 292
162 3300009093 Ga0105240_10002067 Ga0105240_100020675 292
163 3300009093 Ga0105240_10364574 Ga0105240_103645742 292
164 3300009093 Ga0105240_10684781 Ga0105240_106847812 292
165 3300009098 Ga0105245_10137523 Ga0105245_101375232 292
166 3300009174 Ga0105241_10008113 Ga0105241_100081136 292
167 3300009176 Ga0105242_10072894 Ga0105242_100728943 292
168 3300009176 Ga0105242_10211059 Ga0105242_102110592 292
169 3300009545 Ga0105237_10126899 Ga0105237_101268992 292
170 3300009551 Ga0105238_10069401 Ga0105238_100694012 292
171 3300009551 Ga0105238_10607154 Ga0105238_106071542 292
172 3300010375 Ga0105239_10132220 Ga0105239_101322203 292
173 3300011119 Ga0105246_10163332 Ga0105246_101633322 292
174 3300013104 Ga0157370_10013108 Ga0157370_100131083 292
175 3300013104 Ga0157370_10275536 Ga0157370_102755362 292
176 3300013104 Ga0157370_10311689 Ga0157370_103116892 292
177 3300013105 Ga0157369_10349089 Ga0157369_103490892 292
178 3300013297 Ga0157378_10002118 Ga0157378_100021189 292
179 3300013306 Ga0163162_10189777 Ga0163162_101897773 292
180 3300013307 Ga0157372_10023921 Ga0157372_100239212 292
181 3300013307 Ga0157372_10104628 Ga0157372_101046282 292
182 3300013307 Ga0157372_10195713 Ga0157372_101957131 292
183 3300013308 Ga0157375_10282395 Ga0157375_102823952 292
184 3300021388 Ga0213875_10007340 Ga0213875_100073407 292
185 3300021388 Ga0213875_10045127 Ga0213875_100451272 292
186 3300022467 Ga0224712_10139236 Ga0224712_101392361 292
187 3300025321 Ga0207656_10082372 Ga0207656_100823722 292
188 3300025909 Ga0207705_10014739 Ga0207705_100147395 292
189 3300025911 Ga0207654_10047212 Ga0207654_100472122 292
190 3300025913 Ga0207695_10005671 Ga0207695_1000567113 292
191 3300025913 Ga0207695_10081279 Ga0207695_100812792 292
192 3300025913 Ga0207695_10501107 Ga0207695_105011072 292
193 3300025922 Ga0207646_10000016 Ga0207646_1000001612 292
194 3300025924 Ga0207694_10002979 Ga0207694_1000297911 292
195 3300025924 Ga0207694_10058190 Ga0207694_100581903 292
196 3300025927 Ga0207687_10002547 Ga0207687_100025475 292
197 3300025927 Ga0207687_10109316 Ga0207687_101093162 292
198 3300025928 Ga0207700_10001522 Ga0207700_100015224 292
199 3300025934 Ga0207686_10016208 Ga0207686_100162082 292
200 3300025938 Ga0207704_10019331 Ga0207704_100193313 292
201 3300025938 Ga0207704_10141428 Ga0207704_101414282 292
202 3300025942 Ga0207689_10090770 Ga0207689_100907703 292
203 3300025944 Ga0207661_10426764 Ga0207661_104267642 292
204 3300025949 Ga0207667_10001499 Ga0207667_100014995 292
205 3300025949 Ga0207667_10046952 Ga0207667_100469524 292
206 3300025961 Ga0207712_10043421 Ga0207712_100434212 292
207 3300026067 Ga0207678_10026135 Ga0207678_100261352 292
208 3300026089 Ga0207648_10009044 Ga0207648_100090442 292
209 3300026118 Ga0207675_100010887 Ga0207675_1000108878 292
210 3300035083 Ga0373926_0019795 Ga0373926_0019795_208_1089 292
211 3300035119 Ga0373956_0054175 Ga0373956_0054175_236_1126 292
212 3300035695 Ga0373927_0009837 Ga0373927_0009837_3893_4774 292
213 3300037068 Ga0373925_0298449 Ga0373925_0298449_172_1062 292
214 3300037466 Ga0395898_0137759 Ga0395898_0137759_208_1128 292
215 3300037853 Ga0436364_0658052 Ga0436364_0658052_767_1678 292
216 3300037853 Ga0436364_0822356 Ga0436364_0822356_199_1110 292
217 3300037853 Ga0436364_1188517 Ga0436364_1188517_456_1367 292
218 3300037853 Ga0436364_1306996 Ga0436364_1306996_1039_1935 292
219 3300039437 Ga0436365_0998318 Ga0436365_0998318_63_959 292
220 3300039438 Ga0436360_0490098 Ga0436360_0490098_184_1095 292
221 3300039453 Ga0436362_0306584 Ga0436362_0306584_431_1342 292
222 3300039453 Ga0436362_1032274 Ga0436362_1032274_691_1572 292
223 3300042876 Ga0451577_0098319 Ga0451577_0098319_785_1669 292
224 3300044673 Ga0453683_0000548 Ga0453683_0000548_31928_32812 292
225 3300044712 Ga0453684_0470204 Ga0453684_0470204_274_1158 292
226 3300046472 Ga0495580_0006268 Ga0495580_0006268_6493_7383 292
227 3300046472 Ga0495580_0317473 Ga0495580_0317473_129_1031 292
228 3300046473 Ga0495582_0014082 Ga0495582_0014082_2543_3424 292
229 3300046535 Ga0495586_0014687 Ga0495586_0014687_1343_2224 292
230 3300046683 Ga0495658_0084803 Ga0495658_0084803_440_1321 292
231 3300047319 Ga0495674_0159009 Ga0495674_0159009_276_1157 292
232 3300048907 Ga0496104_0266991 Ga0496104_0266991_223_1104 292
233 3300049581 Ga0501047_0100734 Ga0501047_0100734_553_1434 292
234 3300049822 Ga0501035_0071779 Ga0501035_0071779_1522_2442 292
235 3300049823 Ga0501044_0004275 Ga0501044_0004275_2794_3714 292
236 3300049823 Ga0501044_0045900 Ga0501044_0045900_2512_3432 292
237 3300050508 nmdc:mga09592_329509_c1 nmdc:mga09592_329509_c1_169_1050 292
238 3300050510 nmdc:mga06r32_15116_c1 nmdc:mga06r32_15116_c1_64_945 292
239 3300050514 nmdc:mga08x19_17930_c1 nmdc:mga08x19_17930_c1_1192_2073 292
240 iso_pu_bacteria 2519899754 2520878842 292
241 iso_pu_bacteria 2643221600 2644011445 292
242 iso_pu_bacteria 2643221716 2644642308 292
243 iso_pu_bacteria 2643221725 2644685238 292
244 iso_pu_bacteria 2739367857 2740000812 292
245 iso_pu_bacteria 2739367858 2740005628 292
246 iso_pu_bacteria 2802428842 2802654152 292
247 iso_pu_bacteria 2816332280 2817415821 292
248 iso_pu_bacteria 2857613821 2857614558 292
249 iso_pu_bacteria 2857618242 2857619060 292
250 iso_pu_bacteria 2881359912 2881360466 292
251 iso_pu_bacteria 2903895155 2903898609 292
252 iso_pu_bacteria 2904419702 2904419845 292
253 iso_pu_bacteria 2919191525 2919194038 292
254 iso_pu_bacteria 2958458903 2958460881 292
255 iso_pu_bacteria 2977268062 2977269732 292
256 iso_pu_bacteria 8054307821 8054308205 292
257 iso_pu_bacteria 8055419101 8055421499 292
258 iso_pu_bacteria 8055592153 8055594027 292
259 3300005329 Ga0070683_100089029 Ga0070683_1000890293 293
260 3300005435 Ga0070714_100062522 Ga0070714_1000625223 293
261 3300005436 Ga0070713_100205524 Ga0070713_1002055242 293
262 3300005445 Ga0070708_100033387 Ga0070708_1000333874 293
263 3300005445 Ga0070708_100065359 Ga0070708_1000653594 293
264 3300005467 Ga0070706_100010274 Ga0070706_1000102742 293
265 3300005467 Ga0070706_100013873 Ga0070706_1000138737 293
266 3300005467 Ga0070706_100440219 Ga0070706_1004402191 293
267 3300005468 Ga0070707_100030715 Ga0070707_1000307152 293
268 3300005468 Ga0070707_100623873 Ga0070707_1006238731 293
269 3300005471 Ga0070698_100420296 Ga0070698_1004202962 293
270 3300005518 Ga0070699_100014010 Ga0070699_1000140106 293
271 3300005535 Ga0070684_100153703 Ga0070684_1001537031 293
272 3300005536 Ga0070697_100003325 Ga0070697_1000033258 293
273 3300005536 Ga0070697_100366207 Ga0070697_1003662072 293
274 3300006028 Ga0070717_10014279 Ga0070717_100142797 293
275 3300006914 Ga0075436_100000786 Ga0075436_10000078617 293
276 3300006914 Ga0075436_100035931 Ga0075436_1000359312 293
277 3300009093 Ga0105240_10288550 Ga0105240_102885501 293
278 3300009177 Ga0105248_10022854 Ga0105248_100228546 293
279 3300013307 Ga0157372_10038635 Ga0157372_100386354 293
280 3300013307 Ga0157372_10055773 Ga0157372_100557731 293
281 3300014325 Ga0163163_10058448 Ga0163163_100584483 293
282 3300025910 Ga0207684_10017495 Ga0207684_100174952 293
283 3300025913 Ga0207695_10007205 Ga0207695_1000720513 293
284 3300025928 Ga0207700_10272033 Ga0207700_102720331 293
285 3300025929 Ga0207664_10066868 Ga0207664_100668681 293
286 3300025941 Ga0207711_10147898 Ga0207711_101478981 293
287 3300025944 Ga0207661_10064568 Ga0207661_100645682 293
288 3300026088 Ga0207641_10027453 Ga0207641_100274532 293
289 3300026116 Ga0207674_10101224 Ga0207674_101012242 293
290 3300026121 Ga0207683_10069806 Ga0207683_100698063 293
291 3300028379 Ga0268266_10247871 Ga0268266_102478712 293
292 3300028573 Ga0265334_10057252 Ga0265334_100572522 293
293 3300028577 Ga0265318_10000224 Ga0265318_1000022424 293
294 3300028577 Ga0265318_10008554 Ga0265318_100085544 293
295 3300031235 Ga0265330_10002397 Ga0265330_100023974 293
296 3300031238 Ga0265332_10000686 Ga0265332_1000068618 293
297 3300031239 Ga0265328_10010390 Ga0265328_100103902 293
298 3300031240 Ga0265320_10004323 Ga0265320_100043234 293
299 3300031242 Ga0265329_10003082 Ga0265329_100030827 293
300 3300031250 Ga0265331_10046058 Ga0265331_100460582 293
301 3300031344 Ga0265316_10080641 Ga0265316_100806412 293
302 3300031507 Ga0307509_10123494 Ga0307509_101234942 293
303 3300031595 Ga0265313_10028980 Ga0265313_100289803 293
304 3300031711 Ga0265314_10004948 Ga0265314_1000494810 293
305 3300031712 Ga0265342_10000368 Ga0265342_100003684 293
306 3300031903 Ga0307407_10126718 Ga0307407_101267182 293
307 3300035083 Ga0373926_0009181 Ga0373926_0009181_103_990 293
308 3300035111 Ga0373923_0022455 Ga0373923_0022455_423_1310 293
309 3300035117 Ga0373953_0041548 Ga0373953_0041548_232_1119 293
310 3300035119 Ga0373956_0003328 Ga0373956_0003328_2300_3187 293
311 3300035172 Ga0373955_0002990 Ga0373955_0002990_1773_2660 293
312 3300035692 Ga0373935_0056029 Ga0373935_0056029_1536_2423 293
313 3300035695 Ga0373927_0004452 Ga0373927_0004452_2186_3073 293
314 3300035724 Ga0373933_0095011 Ga0373933_0095011_264_1151 293
315 3300035724 Ga0373933_0116569 Ga0373933_0116569_729_1616 293
316 3300035725 Ga0373947_0044626 Ga0373947_0044626_118_1005 293
317 3300036401 Ga0373937_0046658 Ga0373937_0046658_1548_2435 293
318 3300037068 Ga0373925_0061915 Ga0373925_0061915_151_1038 293
319 3300042876 Ga0451577_0089705 Ga0451577_0089705_484_1371 293
320 3300042876 Ga0451577_0374375 Ga0451577_0374375_32_928 293
321 3300045049 Ga0466959_0135539 Ga0466959_0135539_199_1098 293
322 3300046472 Ga0495580_0029553 Ga0495580_0029553_2486_3385 293
323 3300046689 Ga0495613_0160644 Ga0495613_0160644_187_1077 293
324 3300048915 Ga0496112_0182016 Ga0496112_0182016_623_1513 293
325 3300049582 Ga0501048_0211690 Ga0501048_0211690_188_1075 293
326 3300049686 Ga0501257_039613 Ga0501257_039613_174_1112 293
327 3300050509 nmdc:mga0qj67_8316_c1 nmdc:mga0qj67_8316_c1_2863_3807 293
328 3300050514 nmdc:mga08x19_555_c2 nmdc:mga08x19_555_c2_10724_11623 293
329 3300005290 Ga0065712_10116560 Ga0065712_101165602 294
330 3300005293 Ga0065715_10109837 Ga0065715_101098373 294
331 3300005329 Ga0070683_100142852 Ga0070683_1001428521 294
332 3300005334 Ga0068869_100330994 Ga0068869_1003309942 294
333 3300005335 Ga0070666_10092117 Ga0070666_100921172 294
334 3300005336 Ga0070680_100046697 Ga0070680_1000466972 294
335 3300005337 Ga0070682_100007246 Ga0070682_1000072464 294
336 3300005338 Ga0068868_100004905 Ga0068868_1000049055 294
337 3300005338 Ga0068868_100179453 Ga0068868_1001794531 294
338 3300005339 Ga0070660_100053497 Ga0070660_1000534973 294
339 3300005366 Ga0070659_100052298 Ga0070659_1000522982 294
340 3300005367 Ga0070667_100052802 Ga0070667_1000528023 294
341 3300005434 Ga0070709_10077486 Ga0070709_100774862 294
342 3300005434 Ga0070709_10114134 Ga0070709_101141343 294
343 3300005436 Ga0070713_100055770 Ga0070713_1000557703 294
344 3300005440 Ga0070705_100091310 Ga0070705_1000913101 294
345 3300005455 Ga0070663_100016186 Ga0070663_1000161862 294
346 3300005458 Ga0070681_10020317 Ga0070681_100203176 294
347 3300005468 Ga0070707_100068123 Ga0070707_1000681233 294
348 3300005518 Ga0070699_100098316 Ga0070699_1000983161 294
349 3300005530 Ga0070679_100054386 Ga0070679_1000543863 294
350 3300005535 Ga0070684_100030327 Ga0070684_1000303272 294
351 3300005536 Ga0070697_100000056 Ga0070697_10000005660 294
352 3300005536 Ga0070697_100014354 Ga0070697_1000143546 294
353 3300005536 Ga0070697_100140395 Ga0070697_1001403952 294
354 3300005545 Ga0070695_100083942 Ga0070695_1000839421 294
355 3300005546 Ga0070696_100089873 Ga0070696_1000898732 294
356 3300005549 Ga0070704_100117018 Ga0070704_1001170182 294
357 3300005564 Ga0070664_100102415 Ga0070664_1001024152 294
358 3300005577 Ga0068857_100094948 Ga0068857_1000949482 294
359 3300005577 Ga0068857_100139584 Ga0068857_1001395841 294
360 3300005578 Ga0068854_100001808 Ga0068854_10000180812 294
361 3300005614 Ga0068856_100021190 Ga0068856_1000211903 294
362 3300005614 Ga0068856_100054304 Ga0068856_1000543042 294
363 3300005614 Ga0068856_100392361 Ga0068856_1003923612 294
364 3300005616 Ga0068852_100060005 Ga0068852_1000600052 294
365 3300005618 Ga0068864_100387604 Ga0068864_1003876041 294
366 3300005842 Ga0068858_100011173 Ga0068858_1000111732 294
367 3300005843 Ga0068860_100032066 Ga0068860_1000320663 294
368 3300005843 Ga0068860_100131493 Ga0068860_1001314932 294
369 3300006028 Ga0070717_10091306 Ga0070717_100913062 294
370 3300006173 Ga0070716_100075269 Ga0070716_1000752693 294
371 3300006175 Ga0070712_100012345 Ga0070712_1000123453 294
372 3300006237 Ga0097621_100137625 Ga0097621_1001376252 294
373 3300006358 Ga0068871_100000746 Ga0068871_1000007469 294
374 3300007076 Ga0075435_100233244 Ga0075435_1002332441 294
375 3300009098 Ga0105245_10016053 Ga0105245_100160536 294
376 3300009101 Ga0105247_10112348 Ga0105247_101123482 294
377 3300009147 Ga0114129_10068234 Ga0114129_100682346 294
378 3300009176 Ga0105242_10018631 Ga0105242_100186313 294
379 3300009176 Ga0105242_10153815 Ga0105242_101538152 294
380 3300009177 Ga0105248_10074776 Ga0105248_100747762 294
381 3300009177 Ga0105248_10303248 Ga0105248_103032482 294
382 3300009551 Ga0105238_10052599 Ga0105238_100525994 294
383 3300010375 Ga0105239_10569768 Ga0105239_105697681 294
384 3300011119 Ga0105246_10229509 Ga0105246_102295092 294
385 3300013105 Ga0157369_10075607 Ga0157369_100756072 294
386 3300013296 Ga0157374_10027875 Ga0157374_100278753 294
387 3300013296 Ga0157374_10038456 Ga0157374_100384564 294
388 3300013296 Ga0157374_10203970 Ga0157374_102039702 294
389 3300013297 Ga0157378_10001165 Ga0157378_100011654 294
390 3300013297 Ga0157378_10349689 Ga0157378_103496892 294
391 3300013306 Ga0163162_10004350 Ga0163162_1000435011 294
392 3300013306 Ga0163162_10052708 Ga0163162_100527082 294
393 3300013307 Ga0157372_10370739 Ga0157372_103707392 294
394 3300013308 Ga0157375_10672267 Ga0157375_106722672 294
395 3300014968 Ga0157379_10008944 Ga0157379_100089442 294
396 3300014969 Ga0157376_10025610 Ga0157376_100256104 294
397 3300014969 Ga0157376_10091405 Ga0157376_100914052 294
398 3300024227 Ga0228598_1003984 Ga0228598_10039842 294
399 3300025899 Ga0207642_10028907 Ga0207642_100289072 294
400 3300025900 Ga0207710_10062168 Ga0207710_100621682 294
401 3300025906 Ga0207699_10025061 Ga0207699_100250612 294
402 3300025907 Ga0207645_10012241 Ga0207645_100122415 294
403 3300025911 Ga0207654_10034275 Ga0207654_100342753 294
404 3300025913 Ga0207695_10010371 Ga0207695_100103713 294
405 3300025914 Ga0207671_10038421 Ga0207671_100384213 294
406 3300025919 Ga0207657_10009793 Ga0207657_100097937 294
407 3300025919 Ga0207657_10041434 Ga0207657_100414343 294
408 3300025922 Ga0207646_10209126 Ga0207646_102091262 294
409 3300025924 Ga0207694_10097675 Ga0207694_100976752 294
410 3300025928 Ga0207700_10007378 Ga0207700_100073781 294
411 3300025928 Ga0207700_10119628 Ga0207700_101196282 294
412 3300025933 Ga0207706_10000075 Ga0207706_1000007583 294
413 3300025934 Ga0207686_10048624 Ga0207686_100486243 294
414 3300025934 Ga0207686_10085014 Ga0207686_100850141 294
415 3300025938 Ga0207704_10247698 Ga0207704_102476981 294
416 3300025942 Ga0207689_10071125 Ga0207689_100711253 294
417 3300025949 Ga0207667_10007732 Ga0207667_100077323 294
418 3300025972 Ga0207668_10004334 Ga0207668_100043349 294
419 3300025981 Ga0207640_10012867 Ga0207640_100128674 294
420 3300026035 Ga0207703_10147289 Ga0207703_101472891 294
421 3300026067 Ga0207678_10000103 Ga0207678_1000010321 294
422 3300026075 Ga0207708_10079088 Ga0207708_100790882 294
423 3300026088 Ga0207641_10244565 Ga0207641_102445652 294
424 3300026089 Ga0207648_10006119 Ga0207648_100061196 294
425 3300026116 Ga0207674_10009982 Ga0207674_100099824 294
426 3300026116 Ga0207674_10137495 Ga0207674_101374952 294
427 3300026118 Ga0207675_100017027 Ga0207675_1000170273 294
428 3300026121 Ga0207683_10111174 Ga0207683_101111742 294
429 3300028379 Ga0268266_10124559 Ga0268266_101245592 294
430 3300028379 Ga0268266_10192144 Ga0268266_101921441 294
431 3300028381 Ga0268264_10117162 Ga0268264_101171622 294
432 3300028556 Ga0265337_1039542 Ga0265337_10395422 294
433 3300029957 Ga0265324_10000063 Ga0265324_100000639 294
434 3300029957 Ga0265324_10014546 Ga0265324_100145463 294
435 3300031247 Ga0265340_10048214 Ga0265340_100482142 294
436 3300031249 Ga0265339_10000010 Ga0265339_10000010119 294
437 3300031344 Ga0265316_10004322 Ga0265316_1000432210 294
438 3300031595 Ga0265313_10003719 Ga0265313_100037199 294
439 3300031727 Ga0316576_10130815 Ga0316576_101308151 294
440 3300031852 Ga0307410_10004592 Ga0307410_100045925 294
441 3300032005 Ga0307411_10002284 Ga0307411_100022848 294
442 3300034820 Ga0373959_0006217 Ga0373959_0006217_19_921 294
443 3300035085 Ga0373929_0006477 Ga0373929_0006477_1075_1977 294
444 3300035170 Ga0373943_0184738 Ga0373943_0184738_168_1070 294
445 3300035207 Ga0373942_0014620 Ga0373942_0014620_572_1591 294
446 3300036401 Ga0373937_0326650 Ga0373937_0326650_298_1200 294
447 3300037471 Ga0395905_0263386 Ga0395905_0263386_187_1092 294
448 3300039453 Ga0436362_0442697 Ga0436362_0442697_643_1548 294
449 3300042876 Ga0451577_0000531 Ga0451577_0000531_58494_59402 294
450 3300042876 Ga0451577_0041603 Ga0451577_0041603_3031_3927 294
451 3300042876 Ga0451577_0166528 Ga0451577_0166528_1085_1969 294
452 3300044673 Ga0453683_0013874 Ga0453683_0013874_3346_4254 294
453 3300044694 Ga0466963_0000193 Ga0466963_0000193_8208_9110 294
454 3300044712 Ga0453684_0000324 Ga0453684_0000324_79744_80652 294
455 3300044712 Ga0453684_0000968 Ga0453684_0000968_170_1066 294
456 3300045051 Ga0451576_0005720 Ga0451576_0005720_3829_4737 294
457 3300045051 Ga0451576_0147833 Ga0451576_0147833_309_1211 294
458 3300045976 Ga0466967_0001058 Ga0466967_0001058_13136_14038 294
459 3300045976 Ga0466967_0098432 Ga0466967_0098432_1512_2414 294
460 3300046472 Ga0495580_0039807 Ga0495580_0039807_2074_2997 294
461 3300046472 Ga0495580_0112870 Ga0495580_0112870_775_1698 294
462 3300047319 Ga0495674_0055000 Ga0495674_0055000_1505_2428 294
463 3300047471 Ga0495684_0058713 Ga0495684_0058713_220_1122 294
464 3300048905 Ga0496102_0116928 Ga0496102_0116928_474_1493 294
465 3300048906 Ga0496103_0016516 Ga0496103_0016516_2695_3774 294
466 3300048907 Ga0496104_0146919 Ga0496104_0146919_1348_2250 294
467 3300048912 Ga0496109_0212553 Ga0496109_0212553_136_1155 294
468 3300048915 Ga0496112_0141920 Ga0496112_0141920_13_1032 294
469 3300050512 nmdc:mga0n895_127273_c1 nmdc:mga0n895_127273_c1_684_1592 294
470 3300050512 nmdc:mga0n895_166621_c1 nmdc:mga0n895_166621_c1_453_1355 294
471 3300050513 nmdc:mga0rr50_216449_c1 nmdc:mga0rr50_216449_c1_208_1110 294
472 3300050513 nmdc:mga0rr50_314450_c1 nmdc:mga0rr50_314450_c1_267_1175 294
473 3300005288 Ga0065714_10004146 Ga0065714_100041463 295
474 3300005288 Ga0065714_10066564 Ga0065714_100665643 295
475 3300005288 Ga0065714_10077319 Ga0065714_100773193 295
476 3300005548 Ga0070665_100000059 Ga0070665_100000059163 295
477 3300006844 Ga0075428_100092022 Ga0075428_1000920222 295
478 3300006844 Ga0075428_100278158 Ga0075428_1002781582 295
479 3300009036 Ga0105244_10000004 Ga0105244_10000004358 295
480 3300009147 Ga0114129_10030396 Ga0114129_100303965 295
481 3300009545 Ga0105237_10401164 Ga0105237_104011642 295
482 3300013104 Ga0157370_10026706 Ga0157370_100267063 295
483 3300017792 Ga0163161_10000007 Ga0163161_10000007186 295
484 3300025728 Ga0207655_1000008 Ga0207655_1000008230 295
485 3300028794 Ga0307515_10135185 Ga0307515_101351851 295
486 3300028800 Ga0265338_10187940 Ga0265338_101879402 295
487 3300031249 Ga0265339_10015894 Ga0265339_100158943 295
488 3300031712 Ga0265342_10000128 Ga0265342_1000012847 295
489 3300032004 Ga0307414_10121444 Ga0307414_101214442 295
490 3300032004 Ga0307414_10282008 Ga0307414_102820081 295
491 3300041494 Ga0451837_0054513 Ga0451837_0054513_467_1354 295
492 3300042156 Ga0439446_0005985 Ga0439446_0005985_1540_2517 295
493 3300042876 Ga0451577_0000173 Ga0451577_0000173_135399_136286 295
494 3300042876 Ga0451577_0003545 Ga0451577_0003545_3841_4728 295
495 3300042876 Ga0451577_0004786 Ga0451577_0004786_7927_8841 295
496 3300042876 Ga0451577_0030222 Ga0451577_0030222_559_1446 295
497 3300044712 Ga0453684_0001343 Ga0453684_0001343_24758_25729 295
498 3300044712 Ga0453684_0001454 Ga0453684_0001454_36297_37184 295
499 3300044712 Ga0453684_0019540 Ga0453684_0019540_1581_2600 295
500 3300044712 Ga0453684_0049970 Ga0453684_0049970_4402_5289 295
501 3300045051 Ga0451576_0000613 Ga0451576_0000613_36297_37184 295
502 3300046472 Ga0495580_0026885 Ga0495580_0026885_1611_2540 295
503 3300048916 Ga0496113_0222835 Ga0496113_0222835_182_1099 295
504 3300048928 Ga0496125_0000050 Ga0496125_0000050_66117_67004 295
505 3300048929 Ga0496126_0005294 Ga0496126_0005294_5234_6163 295
506 3300049568 Ga0501031_0075344 Ga0501031_0075344_1103_1999 295
507 3300049575 Ga0501039_0122677 Ga0501039_0122677_155_1051 295
508 3300049577 Ga0501041_0105516 Ga0501041_0105516_257_1153 295
509 3300049578 Ga0501042_0081683 Ga0501042_0081683_300_1196 295
510 3300049582 Ga0501048_0070562 Ga0501048_0070562_414_1310 295
511 3300049587 Ga0501071_0058745 Ga0501071_0058745_152_1048 295
512 3300049591 Ga0501075_0041214 Ga0501075_0041214_1871_2767 295
513 3300049679 Ga0501249_000033 Ga0501249_000033_2682_3569 295
514 3300049742 Ga0501080_0111597 Ga0501080_0111597_97_993 295
515 3300049822 Ga0501035_0248099 Ga0501035_0248099_134_1030 295
516 3300049824 Ga0501045_0108415 Ga0501045_0108415_712_1608 295
517 3300050507 nmdc:mga05p37_35920_c1 nmdc:mga05p37_35920_c1_1969_2865 295
518 3300053085 Ga0495619_0055744 Ga0495619_0055744_987_1889 295
519 3300053090 Ga0500646_0003732 Ga0500646_0003732_2804_3691 295
520 3300053096 Ga0500641_0000027 Ga0500641_0000027_43317_44204 295
521 3300053096 Ga0500641_0002278 Ga0500641_0002278_3528_4415 295
522 3300054114 Ga0501084_0140321 Ga0501084_0140321_485_1381 295
523 3300003578 Ga0006562J51391_1006967 Ga0006562J51391_10069671 296
524 3300005288 Ga0065714_10069104 Ga0065714_100691044 296
525 3300006942 Ga0099824_1009165 Ga0099824_10091658 296
526 3300006946 Ga0079104_1000179 Ga0079104_100017939 296
527 3300006948 Ga0099826_10039471 Ga0099826_100394713 296
528 3300013100 Ga0157373_10000002 Ga0157373_1000000265 296
529 3300013102 Ga0157371_10008727 Ga0157371_100087271 296
530 3300013104 Ga0157370_10001033 Ga0157370_1000103313 296
531 3300013104 Ga0157370_10003309 Ga0157370_1000330913 296
532 3300013104 Ga0157370_10012803 Ga0157370_1001280310 296
533 3300013105 Ga0157369_10214531 Ga0157369_102145312 296
534 3300015261 Ga0182006_1017349 Ga0182006_10173493 296
535 3300027111 Ga0209281_1000116 Ga0209281_1000116105 296
536 3300027666 Ga0209282_1032878 Ga0209282_10328782 296
537 3300031548 Ga0307408_100002894 Ga0307408_1000028946 296
538 3300031824 Ga0307413_10003912 Ga0307413_100039123 296
539 3300031852 Ga0307410_10000115 Ga0307410_1000011520 296
540 3300031901 Ga0307406_10000111 Ga0307406_1000011120 296
541 3300031903 Ga0307407_10008551 Ga0307407_100085512 296
542 3300032004 Ga0307414_10000001 Ga0307414_10000001789 296
543 3300032005 Ga0307411_10000013 Ga0307411_1000001355 296
544 3300032005 Ga0307411_10214715 Ga0307411_102147151 296
545 3300041407 Ga0439447_002257 Ga0439447_002257_1474_2364 296
546 3300041411 Ga0439466_0002554 Ga0439466_0002554_3881_4771 296
547 3300044673 Ga0453683_0042311 Ga0453683_0042311_363_1262 296
548 3300046558 Ga0495633_0142313 Ga0495633_0142313_103_993 296
549 3300048919 Ga0496116_0000047 Ga0496116_0000047_248814_249704 296
550 3300048921 Ga0496118_0075921 Ga0496118_0075921_44_934 296
551 3300048924 Ga0496121_0009482 Ga0496121_0009482_2110_3000 296
552 3300048927 Ga0496124_0024755 Ga0496124_0024755_310_1200 296
553 3300048927 Ga0496124_0152485 Ga0496124_0152485_218_1108 296
554 3300049539 Ga0501323_013347 Ga0501323_013347_31_921 296
555 3300049679 Ga0501249_001379 Ga0501249_001379_1474_2364 296
556 3300049763 Ga0501266_000005 Ga0501266_000005_40200_41090 296
557 3300049766 Ga0501269_012482 Ga0501269_012482_26_916 296
558 3300053134 Ga0500658_0000021 Ga0500658_0000021_114873_115763 296
559 3300053136 Ga0500559_0052890 Ga0500559_0052890_783_1673 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

58

329

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h8j-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9633 4 292
5h8i-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine 0.9595 4 293
5h8j-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9566 4 289
5h8l-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine 0.9498 4 289
5h8k-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant 0.9496 4 289
ID Description Score Start End Superfamily
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9633 4 292 3.60.110.10
6mg6B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9437 5 294 3.60.110.10
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9353 4 292 3.60.110.10
6mg6B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9312 5 294 3.60.110.10
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9305 4 296 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A5S3QQQ3-F1-model_v4 deleted 0.9886 6 111
AF-A0A6J4MZV2-F1-model_v4 N-carbamoylputrescine amidase (EC 3.5.1.53) 0.9871 17 185 GO:0033388
GO:0050126
AF-A0A372GZC1-F1-model_v4 Acyltransferase 0.9869 4 295 GO:0016746
GO:0033388
GO:0050126
AF-A0A1K2IH76-F1-model_v4 N-carbamoylputrescine amidase 0.9865 5 295 GO:0033388
GO:0050126
AF-A0A7J4VEW5-F1-model_v4 Acyltransferase 0.9864 1 103 GO:0016746
GO:0033388
GO:0050126

Feature Viewer

pLDDT pTM Quality
93.07 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map