F463551
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 559 | 302 | 530 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10052599|Ga0105238_100525994 |
| Length | 351 |
| Sequence | MVAWFQNYTPKLCCTTLLEAHKRLPLTKQKLKSGNCKLGTDILFVFPEDLALAQQKFNVGLIQMSTTPDPDKNLQRAIDKIHQASARGAHIVCLPELFQTQYFCQRQDANLFDLAEPIPSPVTNRLATLAKQLRIVLIASLFEKRAPGVYHNTAVIFDADGSLRGLYRKMHIPDDPLYYEKYYFTPGDLGYRAFDTAVGRVGTLVCWDQWYPEGARLTALQGAQILFYPTAIGWHPSEKAEFGQAQHDAWRTIQRAHAIANGVYVAVVNRVGHETGDIRGNAVAGDGLEFWGASFLCDPFGRVTAEASHDKEEVLIGEVDFRVVEDVRRNWPFLRDRRIDSYGAITNRLSD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 2 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 3 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 4 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 5 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 6 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 7 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 8 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 9 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 10 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 11 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 12 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 13 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 14 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 15 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 16 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 17 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 18 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 19 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 20 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 21 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 22 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 23 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 24 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 25 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 26 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 88 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 89 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 177 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 218 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 219 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 220 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 221 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 222 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 223 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 261 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 262 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 263 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 277 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 280 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 294 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 295 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 297 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 300 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 301 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 302 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.1 |
| Metatranscriptomes | 0.72 |
| Isolates | 5.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.25 |
| Nodule | 0.89 |
| Rhizoplane | 3.22 |
| Rhizosphere | 88.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006562J51391_1006967 | 3300003578 | Bacteria | 972 |
| 2 | Ga0065714_10004146 | 3300005288 | Bacteria | 5965 |
| 3 | Ga0065714_10066564 | 3300005288 | Bacteria | 6644 |
| 4 | Ga0065714_10069104 | 3300005288 | Bacteria | 4368 |
| 5 | Ga0065714_10077319 | 3300005288 | Bacteria | 2701 |
| 6 | Ga0065712_10116560 | 3300005290 | Bacteria | 1734 |
| 7 | Ga0065715_10109837 | 3300005293 | Bacteria | 2649 |
| 8 | Ga0070658_10306633 | 3300005327 | Bacteria | 1354 |
| 9 | Ga0070683_100089029 | 3300005329 | Bacteria | 2897 |
| 10 | Ga0070683_100142852 | 3300005329 | Bacteria | 2267 |
| 11 | Ga0070683_100308101 | 3300005329 | Bacteria | 1507 |
| 12 | Ga0068869_100285342 | 3300005334 | Bacteria | 1329 |
| 13 | Ga0068869_100330994 | 3300005334 | Bacteria | 1237 |
| 14 | Ga0070666_10092117 | 3300005335 | Bacteria | 2083 |
| 15 | Ga0070680_100046697 | 3300005336 | Bacteria | 3524 |
| 16 | Ga0070682_100007246 | 3300005337 | Bacteria | 6249 |
| 17 | Ga0068868_100004905 | 3300005338 | Bacteria | 9396 |
| 18 | Ga0068868_100179453 | 3300005338 | Bacteria | 1756 |
| 19 | Ga0070660_100053497 | 3300005339 | Bacteria | 3114 |
| 20 | Ga0070689_100092621 | 3300005340 | Bacteria | 2384 |
| 21 | Ga0070691_10004988 | 3300005341 | Bacteria | 6038 |
| 22 | Ga0070673_100247586 | 3300005364 | Bacteria | 1552 |
| 23 | Ga0070659_100052298 | 3300005366 | Bacteria | 3212 |
| 24 | Ga0070667_100052802 | 3300005367 | Bacteria | 3430 |
| 25 | Ga0070709_10077486 | 3300005434 | Bacteria | 2161 |
| 26 | Ga0070709_10114134 | 3300005434 | Bacteria | 1820 |
| 27 | Ga0070709_10134806 | 3300005434 | Bacteria | 1690 |
| 28 | Ga0070714_100062522 | 3300005435 | Bacteria | 3200 |
| 29 | Ga0070714_100160752 | 3300005435 | Bacteria | 2032 |
| 30 | Ga0070713_100000671 | 3300005436 | Bacteria | 21916 |
| 31 | Ga0070713_100044503 | 3300005436 | Bacteria | 3634 |
| 32 | Ga0070713_100055770 | 3300005436 | Bacteria | 3285 |
| 33 | Ga0070713_100205524 | 3300005436 | Bacteria | 1780 |
| 34 | Ga0070711_100005278 | 3300005439 | Bacteria | 7711 |
| 35 | Ga0070711_100364363 | 3300005439 | Bacteria | 1165 |
| 36 | Ga0070705_100091310 | 3300005440 | Bacteria | 1898 |
| 37 | Ga0070708_100033387 | 3300005445 | Bacteria | 4471 |
| 38 | Ga0070708_100065359 | 3300005445 | Bacteria | 3262 |
| 39 | Ga0070708_100181214 | 3300005445 | Bacteria | 1969 |
| 40 | Ga0070663_100016186 | 3300005455 | Bacteria | 4834 |
| 41 | Ga0070663_100017583 | 3300005455 | Bacteria | 4670 |
| 42 | Ga0070681_10016992 | 3300005458 | Bacteria | 7270 |
| 43 | Ga0070681_10020317 | 3300005458 | Bacteria | 6657 |
| 44 | Ga0070681_10099687 | 3300005458 | Bacteria | 2851 |
| 45 | Ga0068867_100070565 | 3300005459 | Bacteria | 2612 |
| 46 | Ga0070706_100010274 | 3300005467 | Bacteria | 8697 |
| 47 | Ga0070706_100013873 | 3300005467 | Bacteria | 7450 |
| 48 | Ga0070706_100051944 | 3300005467 | Bacteria | 3784 |
| 49 | Ga0070706_100440219 | 3300005467 | Bacteria | 1213 |
| 50 | Ga0070707_100030715 | 3300005468 | Bacteria | 5117 |
| 51 | Ga0070707_100068123 | 3300005468 | Bacteria | 3424 |
| 52 | Ga0070707_100623873 | 3300005468 | Bacteria | 1040 |
| 53 | Ga0070698_100420296 | 3300005471 | Bacteria | 1271 |
| 54 | Ga0070699_100014010 | 3300005518 | Bacteria | 6898 |
| 55 | Ga0070699_100067938 | 3300005518 | Bacteria | 3095 |
| 56 | Ga0070699_100095156 | 3300005518 | Bacteria | 2607 |
| 57 | Ga0070699_100098316 | 3300005518 | Bacteria | 2564 |
| 58 | Ga0070679_100054386 | 3300005530 | Bacteria | 3985 |
| 59 | Ga0070684_100030327 | 3300005535 | Bacteria | 4593 |
| 60 | Ga0070684_100153703 | 3300005535 | Bacteria | 2086 |
| 61 | Ga0070697_100000056 | 3300005536 | Bacteria | 86619 |
| 62 | Ga0070697_100003325 | 3300005536 | Bacteria | 12350 |
| 63 | Ga0070697_100014354 | 3300005536 | Bacteria | 6222 |
| 64 | Ga0070697_100037446 | 3300005536 | Bacteria | 3919 |
| 65 | Ga0070697_100140395 | 3300005536 | Bacteria | 2032 |
| 66 | Ga0070697_100366207 | 3300005536 | Bacteria | 1246 |
| 67 | Ga0070695_100083942 | 3300005545 | Bacteria | 2112 |
| 68 | Ga0070696_100003740 | 3300005546 | Bacteria | 10162 |
| 69 | Ga0070696_100089873 | 3300005546 | Bacteria | 2184 |
| 70 | Ga0070665_100000059 | 3300005548 | Bacteria | 224560 |
| 71 | Ga0070665_100026102 | 3300005548 | Bacteria | 5882 |
| 72 | Ga0070704_100117018 | 3300005549 | Bacteria | 2039 |
| 73 | Ga0068855_100005496 | 3300005563 | Bacteria | 15463 |
| 74 | Ga0070664_100102415 | 3300005564 | Bacteria | 2491 |
| 75 | Ga0068857_100094948 | 3300005577 | Bacteria | 2670 |
| 76 | Ga0068857_100139584 | 3300005577 | Bacteria | 2190 |
| 77 | Ga0068854_100001808 | 3300005578 | Bacteria | 13009 |
| 78 | Ga0068856_100021190 | 3300005614 | Bacteria | 6313 |
| 79 | Ga0068856_100054304 | 3300005614 | Bacteria | 3951 |
| 80 | Ga0068856_100392361 | 3300005614 | Bacteria | 1408 |
| 81 | Ga0068852_100060005 | 3300005616 | Bacteria | 3300 |
| 82 | Ga0068859_100207493 | 3300005617 | Bacteria | 2045 |
| 83 | Ga0068864_100387604 | 3300005618 | Bacteria | 1326 |
| 84 | Ga0068866_10082389 | 3300005718 | Bacteria | 1731 |
| 85 | Ga0068858_100011173 | 3300005842 | Bacteria | 8489 |
| 86 | Ga0068860_100032066 | 3300005843 | Bacteria | 5051 |
| 87 | Ga0068860_100131493 | 3300005843 | Bacteria | 2402 |
| 88 | Ga0070717_10014279 | 3300006028 | Bacteria | 6108 |
| 89 | Ga0070717_10091306 | 3300006028 | Bacteria | 2571 |
| 90 | Ga0075364_10198911 | 3300006051 | Bacteria | 1358 |
| 91 | Ga0070716_100075269 | 3300006173 | Bacteria | 1997 |
| 92 | Ga0070712_100012345 | 3300006175 | Bacteria | 5429 |
| 93 | Ga0070712_100248550 | 3300006175 | Bacteria | 1420 |
| 94 | Ga0097621_100033259 | 3300006237 | Bacteria | 4104 |
| 95 | Ga0097621_100137625 | 3300006237 | Bacteria | 2084 |
| 96 | Ga0068871_100000746 | 3300006358 | Bacteria | 22033 |
| 97 | Ga0075428_100002951 | 3300006844 | Bacteria | 18545 |
| 98 | Ga0075428_100092022 | 3300006844 | Bacteria | 3307 |
| 99 | Ga0075428_100278158 | 3300006844 | Bacteria | 1801 |
| 100 | Ga0075431_100027400 | 3300006847 | Bacteria | 5846 |
| 101 | Ga0075434_100263666 | 3300006871 | Bacteria | 1742 |
| 102 | Ga0075429_100339995 | 3300006880 | Bacteria | 1314 |
| 103 | Ga0068865_100046255 | 3300006881 | Bacteria | 2985 |
| 104 | Ga0068865_100363607 | 3300006881 | Bacteria | 1176 |
| 105 | Ga0075436_100000786 | 3300006914 | Bacteria | 21067 |
| 106 | Ga0075436_100021569 | 3300006914 | Bacteria | 4421 |
| 107 | Ga0075436_100035931 | 3300006914 | Bacteria | 3418 |
| 108 | Ga0097620_100207490 | 3300006931 | Bacteria | 2045 |
| 109 | Ga0099824_1009165 | 3300006942 | Bacteria | 12295 |
| 110 | Ga0079104_1000179 | 3300006946 | Bacteria | 90381 |
| 111 | Ga0099826_10039471 | 3300006948 | Bacteria | 3302 |
| 112 | Ga0075435_100233244 | 3300007076 | Bacteria | 1564 |
| 113 | Ga0105244_10000004 | 3300009036 | Bacteria | 492478 |
| 114 | Ga0105240_10002067 | 3300009093 | Bacteria | 32884 |
| 115 | Ga0105240_10288550 | 3300009093 | Bacteria | 1882 |
| 116 | Ga0105240_10364574 | 3300009093 | Bacteria | 1635 |
| 117 | Ga0105240_10684781 | 3300009093 | Bacteria | 1121 |
| 118 | Ga0105240_10859012 | 3300009093 | Bacteria | 979 |
| 119 | Ga0105245_10016053 | 3300009098 | Bacteria | 6524 |
| 120 | Ga0105245_10137523 | 3300009098 | Bacteria | 2297 |
| 121 | Ga0105247_10112348 | 3300009101 | Bacteria | 1755 |
| 122 | Ga0105247_10186241 | 3300009101 | Bacteria | 1388 |
| 123 | Ga0114129_10030396 | 3300009147 | Bacteria | 7642 |
| 124 | Ga0114129_10068234 | 3300009147 | Bacteria | 4958 |
| 125 | Ga0114129_10359478 | 3300009147 | Bacteria | 1927 |
| 126 | Ga0105241_10008113 | 3300009174 | Bacteria | 7729 |
| 127 | Ga0105241_10009152 | 3300009174 | Bacteria | 7290 |
| 128 | Ga0105242_10018631 | 3300009176 | Bacteria | 5430 |
| 129 | Ga0105242_10072894 | 3300009176 | Bacteria | 2854 |
| 130 | Ga0105242_10153815 | 3300009176 | Bacteria | 2008 |
| 131 | Ga0105242_10211059 | 3300009176 | Bacteria | 1730 |
| 132 | Ga0105248_10022854 | 3300009177 | Bacteria | 6943 |
| 133 | Ga0105248_10074776 | 3300009177 | Bacteria | 3807 |
| 134 | Ga0105248_10303248 | 3300009177 | Bacteria | 1799 |
| 135 | Ga0105237_10120283 | 3300009545 | Bacteria | 2620 |
| 136 | Ga0105237_10126899 | 3300009545 | Bacteria | 2545 |
| 137 | Ga0105237_10401164 | 3300009545 | Bacteria | 1376 |
| 138 | Ga0105238_10052599 | 3300009551 | Bacteria | 4094 |
| 139 | Ga0105238_10069401 | 3300009551 | Bacteria | 3525 |
| 140 | Ga0105238_10607154 | 3300009551 | Bacteria | 1102 |
| 141 | Ga0105249_10146928 | 3300009553 | Bacteria | 2266 |
| 142 | Ga0105239_10132220 | 3300010375 | Bacteria | 2776 |
| 143 | Ga0105239_10569768 | 3300010375 | Bacteria | 1290 |
| 144 | Ga0105246_10163332 | 3300011119 | Bacteria | 1699 |
| 145 | Ga0105246_10229509 | 3300011119 | Bacteria | 1461 |
| 146 | Ga0157373_10000002 | 3300013100 | Bacteria | 750094 |
| 147 | Ga0157371_10008727 | 3300013102 | Bacteria | 8045 |
| 148 | Ga0157370_10001033 | 3300013104 | Bacteria | 35017 |
| 149 | Ga0157370_10003309 | 3300013104 | Bacteria | 19002 |
| 150 | Ga0157370_10012803 | 3300013104 | Bacteria | 8672 |
| 151 | Ga0157370_10013108 | 3300013104 | Bacteria | 8555 |
| 152 | Ga0157370_10026706 | 3300013104 | Bacteria | 5697 |
| 153 | Ga0157370_10275536 | 3300013104 | Bacteria | 1554 |
| 154 | Ga0157370_10311689 | 3300013104 | Bacteria | 1452 |
| 155 | Ga0157369_10075607 | 3300013105 | Bacteria | 3610 |
| 156 | Ga0157369_10214531 | 3300013105 | Bacteria | 2016 |
| 157 | Ga0157369_10349089 | 3300013105 | Bacteria | 1537 |
| 158 | Ga0157374_10027875 | 3300013296 | Bacteria | 5099 |
| 159 | Ga0157374_10038456 | 3300013296 | Bacteria | 4398 |
| 160 | Ga0157374_10203970 | 3300013296 | Bacteria | 1937 |
| 161 | Ga0157378_10001165 | 3300013297 | Bacteria | 23923 |
| 162 | Ga0157378_10002118 | 3300013297 | Bacteria | 17654 |
| 163 | Ga0157378_10195401 | 3300013297 | Bacteria | 1911 |
| 164 | Ga0157378_10349689 | 3300013297 | Bacteria | 1444 |
| 165 | Ga0163162_10004350 | 3300013306 | Bacteria | 13633 |
| 166 | Ga0163162_10052708 | 3300013306 | Bacteria | 4086 |
| 167 | Ga0163162_10189777 | 3300013306 | Bacteria | 2182 |
| 168 | Ga0163162_10200284 | 3300013306 | Bacteria | 2125 |
| 169 | Ga0157372_10023921 | 3300013307 | Bacteria | 6628 |
| 170 | Ga0157372_10037501 | 3300013307 | Bacteria | 5348 |
| 171 | Ga0157372_10038635 | 3300013307 | Bacteria | 5267 |
| 172 | Ga0157372_10055773 | 3300013307 | Bacteria | 4413 |
| 173 | Ga0157372_10104628 | 3300013307 | Bacteria | 3236 |
| 174 | Ga0157372_10195713 | 3300013307 | Bacteria | 2342 |
| 175 | Ga0157372_10370739 | 3300013307 | Bacteria | 1668 |
| 176 | Ga0157375_10282395 | 3300013308 | Bacteria | 1823 |
| 177 | Ga0157375_10672267 | 3300013308 | Bacteria | 1190 |
| 178 | Ga0163163_10013381 | 3300014325 | Bacteria | 7511 |
| 179 | Ga0163163_10052875 | 3300014325 | Bacteria | 4008 |
| 180 | Ga0163163_10058448 | 3300014325 | Bacteria | 3813 |
| 181 | Ga0157380_10035500 | 3300014326 | Bacteria | 3852 |
| 182 | Ga0157380_10160624 | 3300014326 | Bacteria | 1953 |
| 183 | Ga0157379_10002234 | 3300014968 | Bacteria | 16113 |
| 184 | Ga0157379_10008944 | 3300014968 | Bacteria | 8728 |
| 185 | Ga0157376_10025610 | 3300014969 | Bacteria | 4649 |
| 186 | Ga0157376_10091405 | 3300014969 | Bacteria | 2636 |
| 187 | Ga0182006_1017349 | 3300015261 | Bacteria | 3060 |
| 188 | Ga0163161_10000007 | 3300017792 | Bacteria | 301614 |
| 189 | Ga0213875_10000103 | 3300021388 | Bacteria | 96738 |
| 190 | Ga0213875_10007340 | 3300021388 | Bacteria | 5700 |
| 191 | Ga0213875_10045127 | 3300021388 | Bacteria | 2069 |
| 192 | Ga0224712_10139236 | 3300022467 | Bacteria | 1066 |
| 193 | Ga0228598_1003984 | 3300024227 | Bacteria | 3144 |
| 194 | Ga0207656_10082372 | 3300025321 | Bacteria | 1448 |
| 195 | Ga0207655_1000008 | 3300025728 | Bacteria | 734289 |
| 196 | Ga0207642_10028907 | 3300025899 | Bacteria | 2289 |
| 197 | Ga0207710_10062168 | 3300025900 | Bacteria | 1696 |
| 198 | Ga0207699_10025061 | 3300025906 | Bacteria | 3271 |
| 199 | Ga0207699_10042227 | 3300025906 | Bacteria | 2640 |
| 200 | Ga0207645_10012241 | 3300025907 | Bacteria | 5826 |
| 201 | Ga0207705_10014739 | 3300025909 | Bacteria | 5620 |
| 202 | Ga0207684_10017495 | 3300025910 | Bacteria | 6149 |
| 203 | Ga0207684_10076720 | 3300025910 | Bacteria | 2841 |
| 204 | Ga0207654_10034275 | 3300025911 | Bacteria | 2820 |
| 205 | Ga0207654_10047212 | 3300025911 | Bacteria | 2460 |
| 206 | Ga0207695_10005671 | 3300025913 | Bacteria | 16476 |
| 207 | Ga0207695_10007205 | 3300025913 | Bacteria | 14226 |
| 208 | Ga0207695_10010371 | 3300025913 | Bacteria | 11404 |
| 209 | Ga0207695_10081279 | 3300025913 | Bacteria | 3280 |
| 210 | Ga0207695_10501107 | 3300025913 | Bacteria | 1096 |
| 211 | Ga0207671_10038421 | 3300025914 | Bacteria | 3548 |
| 212 | Ga0207657_10009793 | 3300025919 | Bacteria | 9608 |
| 213 | Ga0207657_10041434 | 3300025919 | Bacteria | 4072 |
| 214 | Ga0207646_10000016 | 3300025922 | Bacteria | 337048 |
| 215 | Ga0207646_10068113 | 3300025922 | Bacteria | 3179 |
| 216 | Ga0207646_10209126 | 3300025922 | Bacteria | 1762 |
| 217 | Ga0207694_10002979 | 3300025924 | Bacteria | 13589 |
| 218 | Ga0207694_10058190 | 3300025924 | Bacteria | 3006 |
| 219 | Ga0207694_10097675 | 3300025924 | Bacteria | 2324 |
| 220 | Ga0207687_10002547 | 3300025927 | Bacteria | 12373 |
| 221 | Ga0207687_10109316 | 3300025927 | Bacteria | 2048 |
| 222 | Ga0207700_10001522 | 3300025928 | Bacteria | 13124 |
| 223 | Ga0207700_10007378 | 3300025928 | Bacteria | 6717 |
| 224 | Ga0207700_10119628 | 3300025928 | Bacteria | 2133 |
| 225 | Ga0207700_10272033 | 3300025928 | Bacteria | 1454 |
| 226 | Ga0207700_10351261 | 3300025928 | Bacteria | 1284 |
| 227 | Ga0207664_10010105 | 3300025929 | Bacteria | 6654 |
| 228 | Ga0207664_10066868 | 3300025929 | Bacteria | 2882 |
| 229 | Ga0207706_10000075 | 3300025933 | Bacteria | 102980 |
| 230 | Ga0207686_10016208 | 3300025934 | Bacteria | 4178 |
| 231 | Ga0207686_10048624 | 3300025934 | Bacteria | 2628 |
| 232 | Ga0207686_10085014 | 3300025934 | Bacteria | 2074 |
| 233 | Ga0207670_10083325 | 3300025936 | Bacteria | 2243 |
| 234 | Ga0207704_10019331 | 3300025938 | Bacteria | 3575 |
| 235 | Ga0207704_10141428 | 3300025938 | Bacteria | 1684 |
| 236 | Ga0207704_10247698 | 3300025938 | Bacteria | 1335 |
| 237 | Ga0207711_10147898 | 3300025941 | Bacteria | 2118 |
| 238 | Ga0207689_10042747 | 3300025942 | Bacteria | 3747 |
| 239 | Ga0207689_10071125 | 3300025942 | Bacteria | 2857 |
| 240 | Ga0207689_10090770 | 3300025942 | Bacteria | 2510 |
| 241 | Ga0207661_10064568 | 3300025944 | Bacteria | 2968 |
| 242 | Ga0207661_10426764 | 3300025944 | Bacteria | 1205 |
| 243 | Ga0207667_10001499 | 3300025949 | Bacteria | 29319 |
| 244 | Ga0207667_10007732 | 3300025949 | Bacteria | 12851 |
| 245 | Ga0207667_10046952 | 3300025949 | Bacteria | 4572 |
| 246 | Ga0207712_10043421 | 3300025961 | Bacteria | 3101 |
| 247 | Ga0207668_10004334 | 3300025972 | Bacteria | 8331 |
| 248 | Ga0207640_10012867 | 3300025981 | Bacteria | 4780 |
| 249 | Ga0207703_10147289 | 3300026035 | Bacteria | 2049 |
| 250 | Ga0207678_10000103 | 3300026067 | Bacteria | 69649 |
| 251 | Ga0207678_10026135 | 3300026067 | Bacteria | 5094 |
| 252 | Ga0207708_10079088 | 3300026075 | Bacteria | 2525 |
| 253 | Ga0207641_10027453 | 3300026088 | Bacteria | 4701 |
| 254 | Ga0207641_10244565 | 3300026088 | Bacteria | 1673 |
| 255 | Ga0207648_10006119 | 3300026089 | Bacteria | 11996 |
| 256 | Ga0207648_10009044 | 3300026089 | Bacteria | 9581 |
| 257 | Ga0207674_10009982 | 3300026116 | Bacteria | 10806 |
| 258 | Ga0207674_10101224 | 3300026116 | Bacteria | 2862 |
| 259 | Ga0207674_10137495 | 3300026116 | Bacteria | 2404 |
| 260 | Ga0207674_10711082 | 3300026116 | Bacteria | 970 |
| 261 | Ga0207675_100010887 | 3300026118 | Bacteria | 8520 |
| 262 | Ga0207675_100017027 | 3300026118 | Bacteria | 6792 |
| 263 | Ga0207683_10069806 | 3300026121 | Bacteria | 3103 |
| 264 | Ga0207683_10111174 | 3300026121 | Bacteria | 2453 |
| 265 | Ga0207683_10340208 | 3300026121 | Bacteria | 1376 |
| 266 | Ga0209281_1000116 | 3300027111 | Bacteria | 209707 |
| 267 | Ga0209282_1032878 | 3300027666 | Bacteria | 3166 |
| 268 | Ga0268266_10124559 | 3300028379 | Bacteria | 2298 |
| 269 | Ga0268266_10192144 | 3300028379 | Bacteria | 1864 |
| 270 | Ga0268266_10247871 | 3300028379 | Bacteria | 1647 |
| 271 | Ga0268264_10100482 | 3300028381 | Bacteria | 2512 |
| 272 | Ga0268264_10117162 | 3300028381 | Bacteria | 2342 |
| 273 | Ga0265337_1039542 | 3300028556 | Bacteria | 1363 |
| 274 | Ga0265326_10010989 | 3300028558 | Bacteria | 2678 |
| 275 | Ga0265334_10006298 | 3300028573 | Bacteria | 5124 |
| 276 | Ga0265334_10057252 | 3300028573 | Bacteria | 1478 |
| 277 | Ga0265318_10000224 | 3300028577 | Bacteria | 48801 |
| 278 | Ga0265318_10008554 | 3300028577 | Bacteria | 4548 |
| 279 | Ga0265323_10002895 | 3300028653 | Bacteria | 7698 |
| 280 | Ga0265323_10016687 | 3300028653 | Bacteria | 2861 |
| 281 | Ga0265323_10048631 | 3300028653 | Bacteria | 1512 |
| 282 | Ga0265336_10013437 | 3300028666 | Bacteria | 2730 |
| 283 | Ga0307515_10135185 | 3300028794 | Bacteria | 2686 |
| 284 | Ga0265338_10000016 | 3300028800 | Bacteria | 347424 |
| 285 | Ga0265338_10002506 | 3300028800 | Bacteria | 27353 |
| 286 | Ga0265338_10008201 | 3300028800 | Bacteria | 12730 |
| 287 | Ga0265338_10076627 | 3300028800 | Bacteria | 2831 |
| 288 | Ga0265338_10187940 | 3300028800 | Bacteria | 1568 |
| 289 | Ga0265324_10000022 | 3300029957 | Bacteria | 167667 |
| 290 | Ga0265324_10000063 | 3300029957 | Bacteria | 91952 |
| 291 | Ga0265324_10008096 | 3300029957 | Bacteria | 4209 |
| 292 | Ga0265324_10014546 | 3300029957 | Bacteria | 2910 |
| 293 | Ga0265760_10002015 | 3300031090 | Archaea | 5976 |
| 294 | Ga0265330_10000849 | 3300031235 | Bacteria | 19161 |
| 295 | Ga0265330_10002397 | 3300031235 | Bacteria | 10239 |
| 296 | Ga0265330_10002939 | 3300031235 | Bacteria | 9072 |
| 297 | Ga0265330_10004876 | 3300031235 | Bacteria | 6761 |
| 298 | Ga0265330_10015239 | 3300031235 | Bacteria | 3557 |
| 299 | Ga0265330_10024850 | 3300031235 | Bacteria | 2716 |
| 300 | Ga0265332_10000044 | 3300031238 | Bacteria | 114444 |
| 301 | Ga0265332_10000686 | 3300031238 | Bacteria | 21713 |
| 302 | Ga0265328_10008323 | 3300031239 | Bacteria | 4284 |
| 303 | Ga0265328_10010390 | 3300031239 | Bacteria | 3750 |
| 304 | Ga0265320_10004323 | 3300031240 | Bacteria | 9328 |
| 305 | Ga0265320_10005189 | 3300031240 | Bacteria | 8403 |
| 306 | Ga0265320_10118840 | 3300031240 | Bacteria | 1207 |
| 307 | Ga0265325_10001540 | 3300031241 | Bacteria | 16132 |
| 308 | Ga0265329_10000251 | 3300031242 | Bacteria | 28670 |
| 309 | Ga0265329_10003082 | 3300031242 | Bacteria | 7380 |
| 310 | Ga0265329_10005817 | 3300031242 | Bacteria | 4949 |
| 311 | Ga0265340_10000916 | 3300031247 | Bacteria | 16739 |
| 312 | Ga0265340_10017650 | 3300031247 | Bacteria | 3691 |
| 313 | Ga0265340_10048214 | 3300031247 | Bacteria | 2072 |
| 314 | Ga0265339_10000010 | 3300031249 | Bacteria | 214721 |
| 315 | Ga0265339_10015894 | 3300031249 | Bacteria | 4500 |
| 316 | Ga0265339_10031038 | 3300031249 | Bacteria | 3022 |
| 317 | Ga0265331_10000076 | 3300031250 | Bacteria | 145884 |
| 318 | Ga0265331_10046058 | 3300031250 | Bacteria | 2103 |
| 319 | Ga0265316_10000006 | 3300031344 | Bacteria | 289686 |
| 320 | Ga0265316_10000054 | 3300031344 | Bacteria | 124687 |
| 321 | Ga0265316_10002763 | 3300031344 | Bacteria | 17979 |
| 322 | Ga0265316_10004322 | 3300031344 | Bacteria | 14176 |
| 323 | Ga0265316_10022719 | 3300031344 | Bacteria | 5281 |
| 324 | Ga0265316_10027939 | 3300031344 | Bacteria | 4661 |
| 325 | Ga0265316_10035082 | 3300031344 | Bacteria | 4069 |
| 326 | Ga0265316_10080641 | 3300031344 | Bacteria | 2495 |
| 327 | Ga0265316_10296707 | 3300031344 | Bacteria | 1178 |
| 328 | Ga0307509_10123494 | 3300031507 | Bacteria | 2561 |
| 329 | Ga0307408_100002894 | 3300031548 | Bacteria | 11896 |
| 330 | Ga0265313_10003719 | 3300031595 | Bacteria | 12147 |
| 331 | Ga0265313_10028980 | 3300031595 | Bacteria | 2869 |
| 332 | Ga0265314_10000017 | 3300031711 | Bacteria | 340498 |
| 333 | Ga0265314_10000056 | 3300031711 | Bacteria | 171647 |
| 334 | Ga0265314_10003050 | 3300031711 | Bacteria | 16520 |
| 335 | Ga0265314_10004948 | 3300031711 | Bacteria | 12160 |
| 336 | Ga0265314_10103444 | 3300031711 | Bacteria | 1825 |
| 337 | Ga0265314_10138984 | 3300031711 | Bacteria | 1504 |
| 338 | Ga0265314_10207558 | 3300031711 | Bacteria | 1153 |
| 339 | Ga0265342_10000128 | 3300031712 | Bacteria | 84420 |
| 340 | Ga0265342_10000368 | 3300031712 | Bacteria | 49570 |
| 341 | Ga0265342_10012423 | 3300031712 | Bacteria | 5769 |
| 342 | Ga0265342_10026968 | 3300031712 | Bacteria | 3597 |
| 343 | Ga0265342_10058307 | 3300031712 | Bacteria | 2282 |
| 344 | Ga0265342_10141794 | 3300031712 | Bacteria | 1340 |
| 345 | Ga0316576_10130815 | 3300031727 | Bacteria | 1888 |
| 346 | Ga0307413_10003912 | 3300031824 | Bacteria | 6375 |
| 347 | Ga0307410_10000115 | 3300031852 | Bacteria | 28127 |
| 348 | Ga0307410_10004592 | 3300031852 | Bacteria | 7166 |
| 349 | Ga0307406_10000111 | 3300031901 | Bacteria | 46791 |
| 350 | Ga0307407_10008551 | 3300031903 | Bacteria | 4708 |
| 351 | Ga0307407_10126718 | 3300031903 | Bacteria | 1627 |
| 352 | Ga0307414_10000001 | 3300032004 | Bacteria | 1352954 |
| 353 | Ga0307414_10121444 | 3300032004 | Bacteria | 2009 |
| 354 | Ga0307414_10282008 | 3300032004 | Bacteria | 1396 |
| 355 | Ga0307411_10000013 | 3300032005 | Bacteria | 145335 |
| 356 | Ga0307411_10002284 | 3300032005 | Bacteria | 8393 |
| 357 | Ga0307411_10214715 | 3300032005 | Bacteria | 1488 |
| 358 | Ga0373959_0006217 | 3300034820 | Bacteria | 1976 |
| 359 | Ga0373926_0003601 | 3300035083 | Bacteria | 5025 |
| 360 | Ga0373926_0009181 | 3300035083 | Bacteria | 3300 |
| 361 | Ga0373926_0014350 | 3300035083 | Bacteria | 2693 |
| 362 | Ga0373926_0019795 | 3300035083 | Bacteria | 2322 |
| 363 | Ga0373929_0006477 | 3300035085 | Bacteria | 2117 |
| 364 | Ga0373923_0022455 | 3300035111 | Bacteria | 2475 |
| 365 | Ga0373923_0161770 | 3300035111 | Bacteria | 1021 |
| 366 | Ga0373932_0046409 | 3300035112 | Bacteria | 1274 |
| 367 | Ga0373936_0000679 | 3300035113 | Bacteria | 11833 |
| 368 | Ga0373936_0063037 | 3300035113 | Bacteria | 1517 |
| 369 | Ga0373953_0041548 | 3300035117 | Bacteria | 1830 |
| 370 | Ga0373956_0003328 | 3300035119 | Bacteria | 6473 |
| 371 | Ga0373956_0054175 | 3300035119 | Bacteria | 1807 |
| 372 | Ga0373943_0184738 | 3300035170 | Bacteria | 1147 |
| 373 | Ga0373955_0002990 | 3300035172 | Bacteria | 7405 |
| 374 | Ga0373942_0014620 | 3300035207 | Bacteria | 1903 |
| 375 | Ga0373924_0013101 | 3300035410 | Bacteria | 3111 |
| 376 | Ga0373931_0029780 | 3300035691 | Bacteria | 2806 |
| 377 | Ga0373935_0056029 | 3300035692 | Bacteria | 2512 |
| 378 | Ga0373935_0117773 | 3300035692 | Bacteria | 1771 |
| 379 | Ga0373927_0004452 | 3300035695 | Bacteria | 9815 |
| 380 | Ga0373927_0004743 | 3300035695 | Bacteria | 9472 |
| 381 | Ga0373927_0009837 | 3300035695 | Bacteria | 6409 |
| 382 | Ga0373933_0095011 | 3300035724 | Bacteria | 1844 |
| 383 | Ga0373933_0116569 | 3300035724 | Bacteria | 1670 |
| 384 | Ga0373947_0044626 | 3300035725 | Bacteria | 2650 |
| 385 | Ga0373937_0046658 | 3300036401 | Bacteria | 3962 |
| 386 | Ga0373937_0326650 | 3300036401 | Bacteria | 1452 |
| 387 | Ga0373925_0061915 | 3300037068 | Bacteria | 2812 |
| 388 | Ga0373925_0298449 | 3300037068 | Bacteria | 1300 |
| 389 | Ga0395898_0137759 | 3300037466 | Bacteria | 2337 |
| 390 | Ga0395905_0263386 | 3300037471 | Bacteria | 1609 |
| 391 | Ga0436364_0658052 | 3300037853 | Bacteria | 2452 |
| 392 | Ga0436364_0822356 | 3300037853 | Bacteria | 1276 |
| 393 | Ga0436364_1188517 | 3300037853 | Bacteria | 3709 |
| 394 | Ga0436364_1306996 | 3300037853 | Bacteria | 3732 |
| 395 | Ga0436365_0073490 | 3300039437 | Bacteria | 1206 |
| 396 | Ga0436365_0998318 | 3300039437 | Bacteria | 1350 |
| 397 | Ga0436360_0490098 | 3300039438 | Bacteria | 1674 |
| 398 | Ga0436362_0306584 | 3300039453 | Bacteria | 2306 |
| 399 | Ga0436362_0442697 | 3300039453 | Bacteria | 3279 |
| 400 | Ga0436362_1032274 | 3300039453 | Bacteria | 4257 |
| 401 | Ga0439447_002257 | 3300041407 | Bacteria | 7068 |
| 402 | Ga0439466_0002554 | 3300041411 | Bacteria | 7128 |
| 403 | Ga0451837_0054513 | 3300041494 | Bacteria | 2187 |
| 404 | Ga0439446_0005985 | 3300042156 | Bacteria | 3151 |
| 405 | Ga0439435_0021925 | 3300042436 | Bacteria | 1663 |
| 406 | Ga0451577_0000173 | 3300042876 | Bacteria | 142333 |
| 407 | Ga0451577_0000531 | 3300042876 | Bacteria | 63238 |
| 408 | Ga0451577_0003545 | 3300042876 | Bacteria | 17247 |
| 409 | Ga0451577_0004786 | 3300042876 | Bacteria | 14151 |
| 410 | Ga0451577_0030222 | 3300042876 | Bacteria | 4895 |
| 411 | Ga0451577_0041603 | 3300042876 | Bacteria | 4124 |
| 412 | Ga0451577_0089705 | 3300042876 | Bacteria | 2743 |
| 413 | Ga0451577_0098319 | 3300042876 | Bacteria | 2614 |
| 414 | Ga0451577_0166528 | 3300042876 | Bacteria | 1986 |
| 415 | Ga0451577_0374375 | 3300042876 | Bacteria | 1292 |
| 416 | Ga0453683_0000548 | 3300044673 | Bacteria | 41756 |
| 417 | Ga0453683_0013874 | 3300044673 | Bacteria | 5241 |
| 418 | Ga0453683_0042311 | 3300044673 | Bacteria | 2860 |
| 419 | Ga0466963_0000193 | 3300044694 | Bacteria | 25611 |
| 420 | Ga0453684_0000324 | 3300044712 | Bacteria | 201431 |
| 421 | Ga0453684_0000968 | 3300044712 | Bacteria | 94634 |
| 422 | Ga0453684_0001343 | 3300044712 | Bacteria | 72090 |
| 423 | Ga0453684_0001454 | 3300044712 | Bacteria | 67293 |
| 424 | Ga0453684_0019540 | 3300044712 | Bacteria | 10302 |
| 425 | Ga0453684_0049970 | 3300044712 | Bacteria | 5506 |
| 426 | Ga0453684_0470204 | 3300044712 | Bacteria | 1396 |
| 427 | Ga0466959_0135539 | 3300045049 | Bacteria | 1743 |
| 428 | Ga0451576_0000613 | 3300045051 | Bacteria | 74967 |
| 429 | Ga0451576_0005720 | 3300045051 | Bacteria | 15490 |
| 430 | Ga0451576_0147833 | 3300045051 | Bacteria | 2450 |
| 431 | Ga0466967_0001058 | 3300045976 | Bacteria | 15165 |
| 432 | Ga0466967_0098432 | 3300045976 | Bacteria | 2671 |
| 433 | Ga0466967_0652805 | 3300045976 | Bacteria | 1040 |
| 434 | Ga0495580_0006268 | 3300046472 | Bacteria | 9724 |
| 435 | Ga0495580_0026885 | 3300046472 | Bacteria | 4191 |
| 436 | Ga0495580_0029553 | 3300046472 | Bacteria | 3976 |
| 437 | Ga0495580_0039807 | 3300046472 | Bacteria | 3363 |
| 438 | Ga0495580_0112870 | 3300046472 | Bacteria | 1887 |
| 439 | Ga0495580_0317473 | 3300046472 | Bacteria | 1059 |
| 440 | Ga0495582_0000591 | 3300046473 | Bacteria | 20062 |
| 441 | Ga0495582_0014082 | 3300046473 | Bacteria | 4401 |
| 442 | Ga0495608_0036263 | 3300046511 | Bacteria | 3320 |
| 443 | Ga0495630_0248695 | 3300046517 | Bacteria | 1358 |
| 444 | Ga0495665_0001144 | 3300046531 | Bacteria | 14085 |
| 445 | Ga0495586_0014687 | 3300046535 | Bacteria | 4162 |
| 446 | Ga0495633_0142313 | 3300046558 | Bacteria | 1109 |
| 447 | Ga0495623_0027200 | 3300046679 | Bacteria | 3678 |
| 448 | Ga0495646_0003801 | 3300046680 | Bacteria | 9441 |
| 449 | Ga0495658_0084803 | 3300046683 | Bacteria | 1866 |
| 450 | Ga0495613_0160644 | 3300046689 | Bacteria | 1599 |
| 451 | Ga0495624_0006840 | 3300046690 | Bacteria | 8048 |
| 452 | Ga0495581_0106821 | 3300047315 | Bacteria | 1627 |
| 453 | Ga0495674_0007702 | 3300047319 | Bacteria | 10289 |
| 454 | Ga0495674_0055000 | 3300047319 | Bacteria | 3492 |
| 455 | Ga0495674_0159009 | 3300047319 | Bacteria | 1891 |
| 456 | Ga0495675_0019902 | 3300047444 | Bacteria | 4264 |
| 457 | Ga0495675_0198504 | 3300047444 | Bacteria | 1222 |
| 458 | Ga0495684_0027401 | 3300047471 | Bacteria | 4375 |
| 459 | Ga0495684_0058713 | 3300047471 | Bacteria | 2930 |
| 460 | Ga0495593_0009089 | 3300047673 | Bacteria | 5766 |
| 461 | Ga0496100_0100742 | 3300048903 | Bacteria | 1990 |
| 462 | Ga0496102_0002570 | 3300048905 | Bacteria | 15469 |
| 463 | Ga0496102_0116928 | 3300048905 | Bacteria | 2488 |
| 464 | Ga0496102_0567567 | 3300048905 | Bacteria | 1057 |
| 465 | Ga0496103_0016516 | 3300048906 | Bacteria | 4405 |
| 466 | Ga0496103_0085927 | 3300048906 | Bacteria | 1982 |
| 467 | Ga0496104_0026550 | 3300048907 | Bacteria | 5350 |
| 468 | Ga0496104_0146919 | 3300048907 | Bacteria | 2264 |
| 469 | Ga0496104_0245552 | 3300048907 | Bacteria | 1703 |
| 470 | Ga0496104_0266991 | 3300048907 | Bacteria | 1624 |
| 471 | Ga0496107_0092997 | 3300048910 | Bacteria | 2205 |
| 472 | Ga0496109_0212553 | 3300048912 | Bacteria | 1819 |
| 473 | Ga0496109_0381514 | 3300048912 | Bacteria | 1331 |
| 474 | Ga0496112_0035758 | 3300048915 | Bacteria | 4841 |
| 475 | Ga0496112_0141920 | 3300048915 | Bacteria | 2371 |
| 476 | Ga0496112_0182016 | 3300048915 | Bacteria | 2065 |
| 477 | Ga0496113_0222835 | 3300048916 | Bacteria | 1503 |
| 478 | Ga0496115_0316274 | 3300048918 | Bacteria | 1278 |
| 479 | Ga0496116_0000047 | 3300048919 | Bacteria | 315121 |
| 480 | Ga0496118_0075921 | 3300048921 | Bacteria | 2393 |
| 481 | Ga0496121_0009482 | 3300048924 | Bacteria | 11176 |
| 482 | Ga0496124_0024755 | 3300048927 | Bacteria | 5450 |
| 483 | Ga0496124_0152485 | 3300048927 | Bacteria | 1811 |
| 484 | Ga0496125_0000050 | 3300048928 | Bacteria | 286703 |
| 485 | Ga0496126_0005294 | 3300048929 | Bacteria | 14809 |
| 486 | Ga0501323_013347 | 3300049539 | Bacteria | 1015 |
| 487 | Ga0501031_0075344 | 3300049568 | Bacteria | 2197 |
| 488 | Ga0501034_0022373 | 3300049571 | Bacteria | 6443 |
| 489 | Ga0501039_0122677 | 3300049575 | Bacteria | 2037 |
| 490 | Ga0501041_0105516 | 3300049577 | Bacteria | 1746 |
| 491 | Ga0501042_0081683 | 3300049578 | Bacteria | 2316 |
| 492 | Ga0501046_0000028 | 3300049580 | Bacteria | 194675 |
| 493 | Ga0501047_0100734 | 3300049581 | Bacteria | 2768 |
| 494 | Ga0501048_0070562 | 3300049582 | Bacteria | 2467 |
| 495 | Ga0501048_0211690 | 3300049582 | Bacteria | 1375 |
| 496 | Ga0501071_0058745 | 3300049587 | Bacteria | 2781 |
| 497 | Ga0501073_0041528 | 3300049589 | Bacteria | 3250 |
| 498 | Ga0501075_0041214 | 3300049591 | Bacteria | 3460 |
| 499 | Ga0501077_0011246 | 3300049593 | Bacteria | 5585 |
| 500 | Ga0501249_000033 | 3300049679 | Bacteria | 73096 |
| 501 | Ga0501249_001379 | 3300049679 | Bacteria | 5013 |
| 502 | Ga0501257_039613 | 3300049686 | Bacteria | 1154 |
| 503 | Ga0501080_0111597 | 3300049742 | Bacteria | 2535 |
| 504 | Ga0501266_000005 | 3300049763 | Bacteria | 346750 |
| 505 | Ga0501269_012482 | 3300049766 | Bacteria | 1037 |
| 506 | Ga0501035_0071779 | 3300049822 | Bacteria | 3065 |
| 507 | Ga0501035_0248099 | 3300049822 | Bacteria | 1513 |
| 508 | Ga0501044_0004275 | 3300049823 | Bacteria | 16022 |
| 509 | Ga0501044_0045900 | 3300049823 | Bacteria | 4525 |
| 510 | Ga0501045_0108415 | 3300049824 | Bacteria | 2058 |
| 511 | nmdc:mga00v17_290599_c1 | 3300050491 | Bacteria | 1061 |
| 512 | nmdc:mga05p37_35920_c1 | 3300050507 | Bacteria | 6081 |
| 513 | nmdc:mga09592_329509_c1 | 3300050508 | Bacteria | 1322 |
| 514 | nmdc:mga0qj67_8316_c1 | 3300050509 | Bacteria | 7690 |
| 515 | nmdc:mga06r32_15116_c1 | 3300050510 | Bacteria | 7009 |
| 516 | nmdc:mga0n895_127273_c1 | 3300050512 | Bacteria | 2571 |
| 517 | nmdc:mga0n895_166621_c1 | 3300050512 | Bacteria | 2235 |
| 518 | nmdc:mga0rr50_216449_c1 | 3300050513 | Bacteria | 1580 |
| 519 | nmdc:mga0rr50_314450_c1 | 3300050513 | Bacteria | 1312 |
| 520 | nmdc:mga08x19_10402_c1 | 3300050514 | Bacteria | 5585 |
| 521 | nmdc:mga08x19_17930_c1 | 3300050514 | Bacteria | 4335 |
| 522 | nmdc:mga08x19_555_c2 | 3300050514 | Bacteria | 19623 |
| 523 | Ga0495619_0055744 | 3300053085 | Bacteria | 2619 |
| 524 | Ga0500646_0003732 | 3300053090 | Bacteria | 3901 |
| 525 | Ga0500641_0000027 | 3300053096 | Bacteria | 106908 |
| 526 | Ga0500641_0002278 | 3300053096 | Bacteria | 6808 |
| 527 | Ga0500658_0000021 | 3300053134 | Bacteria | 133042 |
| 528 | Ga0500559_0052890 | 3300053136 | Bacteria | 1796 |
| 529 | Ga0501084_0140321 | 3300054114 | Bacteria | 2035 |
| 530 | Ga0501082_0134860 | 3300060353 | Bacteria | 2142 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047444 | Ga0495675_0198504 | Ga0495675_0198504_15_734 | 238 |
| 2 | 3300031235 | Ga0265330_10004876 | Ga0265330_100048764 | 264 |
| 3 | 3300031344 | Ga0265316_10027939 | Ga0265316_100279393 | 264 |
| 4 | 3300031712 | Ga0265342_10141794 | Ga0265342_101417942 | 264 |
| 5 | 3300005548 | Ga0070665_100026102 | Ga0070665_1000261022 | 277 |
| 6 | 3300005518 | Ga0070699_100067938 | Ga0070699_1000679382 | 280 |
| 7 | 3300005546 | Ga0070696_100003740 | Ga0070696_1000037404 | 280 |
| 8 | 3300014326 | Ga0157380_10035500 | Ga0157380_100355002 | 280 |
| 9 | 3300014326 | Ga0157380_10160624 | Ga0157380_101606242 | 280 |
| 10 | 3300031090 | Ga0265760_10002015 | Ga0265760_100020151 | 280 |
| 11 | 3300046517 | Ga0495630_0248695 | Ga0495630_0248695_348_1193 | 280 |
| 12 | 3300049593 | Ga0501077_0011246 | Ga0501077_0011246_255_1103 | 280 |
| 13 | 3300005518 | Ga0070699_100095156 | Ga0070699_1000951563 | 281 |
| 14 | 3300031235 | Ga0265330_10024850 | Ga0265330_100248502 | 281 |
| 15 | 3300005445 | Ga0070708_100181214 | Ga0070708_1001812141 | 282 |
| 16 | 3300005536 | Ga0070697_100037446 | Ga0070697_1000374461 | 282 |
| 17 | 3300005718 | Ga0068866_10082389 | Ga0068866_100823892 | 282 |
| 18 | 3300006175 | Ga0070712_100248550 | Ga0070712_1002485502 | 282 |
| 19 | 3300006871 | Ga0075434_100263666 | Ga0075434_1002636662 | 282 |
| 20 | 3300009174 | Ga0105241_10009152 | Ga0105241_100091522 | 282 |
| 21 | 3300009545 | Ga0105237_10120283 | Ga0105237_101202832 | 282 |
| 22 | 3300013297 | Ga0157378_10195401 | Ga0157378_101954011 | 282 |
| 23 | 3300013306 | Ga0163162_10200284 | Ga0163162_102002842 | 282 |
| 24 | 3300013307 | Ga0157372_10037501 | Ga0157372_100375012 | 282 |
| 25 | 3300014968 | Ga0157379_10002234 | Ga0157379_1000223411 | 282 |
| 26 | 3300021388 | Ga0213875_10000103 | Ga0213875_100001033 | 282 |
| 27 | 3300025928 | Ga0207700_10351261 | Ga0207700_103512611 | 282 |
| 28 | 3300035083 | Ga0373926_0003601 | Ga0373926_0003601_3213_4079 | 282 |
| 29 | 3300035112 | Ga0373932_0046409 | Ga0373932_0046409_189_1055 | 282 |
| 30 | 3300035113 | Ga0373936_0000679 | Ga0373936_0000679_8623_9489 | 282 |
| 31 | 3300035691 | Ga0373931_0029780 | Ga0373931_0029780_1142_2008 | 282 |
| 32 | 3300035695 | Ga0373927_0004743 | Ga0373927_0004743_173_1039 | 282 |
| 33 | 3300046473 | Ga0495582_0000591 | Ga0495582_0000591_3116_3982 | 282 |
| 34 | 3300046531 | Ga0495665_0001144 | Ga0495665_0001144_4451_5317 | 282 |
| 35 | 3300046679 | Ga0495623_0027200 | Ga0495623_0027200_814_1680 | 282 |
| 36 | 3300047315 | Ga0495581_0106821 | Ga0495581_0106821_454_1320 | 282 |
| 37 | 3300048903 | Ga0496100_0100742 | Ga0496100_0100742_636_1502 | 282 |
| 38 | 3300048905 | Ga0496102_0002570 | Ga0496102_0002570_4990_5856 | 282 |
| 39 | 3300048905 | Ga0496102_0567567 | Ga0496102_0567567_16_882 | 282 |
| 40 | 3300048906 | Ga0496103_0085927 | Ga0496103_0085927_669_1535 | 282 |
| 41 | 3300048907 | Ga0496104_0026550 | Ga0496104_0026550_4408_5274 | 282 |
| 42 | 3300048907 | Ga0496104_0245552 | Ga0496104_0245552_795_1661 | 282 |
| 43 | 3300048910 | Ga0496107_0092997 | Ga0496107_0092997_1061_1927 | 282 |
| 44 | 3300048912 | Ga0496109_0381514 | Ga0496109_0381514_372_1238 | 282 |
| 45 | 3300048915 | Ga0496112_0035758 | Ga0496112_0035758_3944_4810 | 282 |
| 46 | 3300050514 | nmdc:mga08x19_10402_c1 | nmdc:mga08x19_10402_c1_1610_2476 | 282 |
| 47 | 3300005334 | Ga0068869_100285342 | Ga0068869_1002853422 | 283 |
| 48 | 3300005341 | Ga0070691_10004988 | Ga0070691_100049884 | 283 |
| 49 | 3300025942 | Ga0207689_10042747 | Ga0207689_100427472 | 283 |
| 50 | 3300028381 | Ga0268264_10100482 | Ga0268264_101004822 | 283 |
| 51 | 3300028558 | Ga0265326_10010989 | Ga0265326_100109893 | 283 |
| 52 | 3300028573 | Ga0265334_10006298 | Ga0265334_100062987 | 283 |
| 53 | 3300028653 | Ga0265323_10002895 | Ga0265323_100028954 | 283 |
| 54 | 3300028653 | Ga0265323_10016687 | Ga0265323_100166872 | 283 |
| 55 | 3300028653 | Ga0265323_10048631 | Ga0265323_100486312 | 283 |
| 56 | 3300028800 | Ga0265338_10076627 | Ga0265338_100766272 | 283 |
| 57 | 3300031235 | Ga0265330_10000849 | Ga0265330_100008497 | 283 |
| 58 | 3300031235 | Ga0265330_10002939 | Ga0265330_100029395 | 283 |
| 59 | 3300031235 | Ga0265330_10015239 | Ga0265330_100152392 | 283 |
| 60 | 3300031242 | Ga0265329_10000251 | Ga0265329_100002515 | 283 |
| 61 | 3300031247 | Ga0265340_10000916 | Ga0265340_100009165 | 283 |
| 62 | 3300031344 | Ga0265316_10000054 | Ga0265316_1000005415 | 283 |
| 63 | 3300031344 | Ga0265316_10002763 | Ga0265316_1000276319 | 283 |
| 64 | 3300031344 | Ga0265316_10022719 | Ga0265316_100227192 | 283 |
| 65 | 3300031344 | Ga0265316_10035082 | Ga0265316_100350822 | 283 |
| 66 | 3300031344 | Ga0265316_10296707 | Ga0265316_102967071 | 283 |
| 67 | 3300031711 | Ga0265314_10000017 | Ga0265314_10000017138 | 283 |
| 68 | 3300031711 | Ga0265314_10207558 | Ga0265314_102075581 | 283 |
| 69 | 3300031712 | Ga0265342_10012423 | Ga0265342_100124231 | 283 |
| 70 | 3300039437 | Ga0436365_0073490 | Ga0436365_0073490_18_902 | 283 |
| 71 | 3300042436 | Ga0439435_0021925 | Ga0439435_0021925_488_1360 | 283 |
| 72 | 3300045976 | Ga0466967_0652805 | Ga0466967_0652805_130_1026 | 283 |
| 73 | 3300048918 | Ga0496115_0316274 | Ga0496115_0316274_406_1266 | 283 |
| 74 | 3300049580 | Ga0501046_0000028 | Ga0501046_0000028_110818_111705 | 285 |
| 75 | 3300060353 | Ga0501082_0134860 | Ga0501082_0134860_1008_1895 | 285 |
| 76 | 3300029957 | Ga0265324_10000022 | Ga0265324_1000002253 | 286 |
| 77 | 3300031711 | Ga0265314_10138984 | Ga0265314_101389842 | 286 |
| 78 | 3300046680 | Ga0495646_0003801 | Ga0495646_0003801_8071_8934 | 286 |
| 79 | 3300005340 | Ga0070689_100092621 | Ga0070689_1000926212 | 287 |
| 80 | 3300009553 | Ga0105249_10146928 | Ga0105249_101469282 | 287 |
| 81 | 3300014325 | Ga0163163_10013381 | Ga0163163_100133814 | 287 |
| 82 | 3300025936 | Ga0207670_10083325 | Ga0207670_100833253 | 287 |
| 83 | 3300006844 | Ga0075428_100002951 | Ga0075428_10000295110 | 288 |
| 84 | 3300026116 | Ga0207674_10711082 | Ga0207674_107110821 | 288 |
| 85 | 3300028666 | Ga0265336_10013437 | Ga0265336_100134372 | 288 |
| 86 | 3300049571 | Ga0501034_0022373 | Ga0501034_0022373_56_955 | 288 |
| 87 | 3300009101 | Ga0105247_10186241 | Ga0105247_101862411 | 289 |
| 88 | 3300014325 | Ga0163163_10052875 | Ga0163163_100528753 | 289 |
| 89 | 3300026121 | Ga0207683_10340208 | Ga0207683_103402081 | 289 |
| 90 | 3300031238 | Ga0265332_10000044 | Ga0265332_1000004429 | 289 |
| 91 | 3300031239 | Ga0265328_10008323 | Ga0265328_100083235 | 289 |
| 92 | 3300031240 | Ga0265320_10118840 | Ga0265320_101188401 | 289 |
| 93 | 3300031242 | Ga0265329_10005817 | Ga0265329_100058171 | 289 |
| 94 | 3300031249 | Ga0265339_10031038 | Ga0265339_100310383 | 289 |
| 95 | 3300031250 | Ga0265331_10000076 | Ga0265331_1000007694 | 289 |
| 96 | 3300031344 | Ga0265316_10000006 | Ga0265316_10000006152 | 289 |
| 97 | 3300031711 | Ga0265314_10000056 | Ga0265314_1000005658 | 289 |
| 98 | 3300031712 | Ga0265342_10058307 | Ga0265342_100583073 | 289 |
| 99 | 3300047319 | Ga0495674_0007702 | Ga0495674_0007702_6046_6987 | 289 |
| 100 | 3300047471 | Ga0495684_0027401 | Ga0495684_0027401_2584_3525 | 289 |
| 101 | 3300005434 | Ga0070709_10134806 | Ga0070709_101348062 | 290 |
| 102 | 3300005435 | Ga0070714_100160752 | Ga0070714_1001607522 | 290 |
| 103 | 3300005436 | Ga0070713_100000671 | Ga0070713_10000067117 | 290 |
| 104 | 3300005439 | Ga0070711_100005278 | Ga0070711_1000052784 | 290 |
| 105 | 3300006051 | Ga0075364_10198911 | Ga0075364_101989112 | 290 |
| 106 | 3300025906 | Ga0207699_10042227 | Ga0207699_100422272 | 290 |
| 107 | 3300025929 | Ga0207664_10010105 | Ga0207664_100101052 | 290 |
| 108 | 3300049589 | Ga0501073_0041528 | Ga0501073_0041528_1357_2289 | 290 |
| 109 | 3300050491 | nmdc:mga00v17_290599_c1 | nmdc:mga00v17_290599_c1_156_1031 | 290 |
| 110 | 3300005467 | Ga0070706_100051944 | Ga0070706_1000519445 | 291 |
| 111 | 3300009093 | Ga0105240_10859012 | Ga0105240_108590121 | 291 |
| 112 | 3300009147 | Ga0114129_10359478 | Ga0114129_103594781 | 291 |
| 113 | 3300025910 | Ga0207684_10076720 | Ga0207684_100767202 | 291 |
| 114 | 3300025922 | Ga0207646_10068113 | Ga0207646_100681133 | 291 |
| 115 | 3300028800 | Ga0265338_10000016 | Ga0265338_10000016219 | 291 |
| 116 | 3300028800 | Ga0265338_10002506 | Ga0265338_100025063 | 291 |
| 117 | 3300028800 | Ga0265338_10008201 | Ga0265338_1000820111 | 291 |
| 118 | 3300029957 | Ga0265324_10008096 | Ga0265324_100080964 | 291 |
| 119 | 3300031240 | Ga0265320_10005189 | Ga0265320_100051898 | 291 |
| 120 | 3300031241 | Ga0265325_10001540 | Ga0265325_1000154010 | 291 |
| 121 | 3300031247 | Ga0265340_10017650 | Ga0265340_100176504 | 291 |
| 122 | 3300031711 | Ga0265314_10003050 | Ga0265314_1000305020 | 291 |
| 123 | 3300031711 | Ga0265314_10103444 | Ga0265314_101034442 | 291 |
| 124 | 3300031712 | Ga0265342_10026968 | Ga0265342_100269682 | 291 |
| 125 | 3300035083 | Ga0373926_0014350 | Ga0373926_0014350_1261_2139 | 291 |
| 126 | 3300035111 | Ga0373923_0161770 | Ga0373923_0161770_30_908 | 291 |
| 127 | 3300035113 | Ga0373936_0063037 | Ga0373936_0063037_116_994 | 291 |
| 128 | 3300035410 | Ga0373924_0013101 | Ga0373924_0013101_1202_2080 | 291 |
| 129 | 3300035692 | Ga0373935_0117773 | Ga0373935_0117773_457_1356 | 291 |
| 130 | 3300046511 | Ga0495608_0036263 | Ga0495608_0036263_2122_3000 | 291 |
| 131 | 3300046690 | Ga0495624_0006840 | Ga0495624_0006840_538_1416 | 291 |
| 132 | 3300047444 | Ga0495675_0019902 | Ga0495675_0019902_410_1288 | 291 |
| 133 | 3300047673 | Ga0495593_0009089 | Ga0495593_0009089_1624_2502 | 291 |
| 134 | iso_pu_bacteria | 2513020052 | 2513236411 | 291 |
| 135 | iso_pu_bacteria | 2643221667 | 2644369848 | 291 |
| 136 | iso_pu_bacteria | 2738541279 | 2738731963 | 291 |
| 137 | iso_pu_bacteria | 2738541285 | 2738764528 | 291 |
| 138 | iso_pu_bacteria | 2738543007 | 2739213543 | 291 |
| 139 | iso_pu_bacteria | 2833640130 | 2833643088 | 291 |
| 140 | iso_pu_bacteria | 2904555929 | 2904556633 | 291 |
| 141 | iso_pu_bacteria | 2919683626 | 2919687800 | 291 |
| 142 | iso_pu_bacteria | 2929150217 | 2929153061 | 291 |
| 143 | iso_pu_bacteria | 8056440228 | 8056442923 | 291 |
| 144 | 3300005327 | Ga0070658_10306633 | Ga0070658_103066332 | 292 |
| 145 | 3300005329 | Ga0070683_100308101 | Ga0070683_1003081012 | 292 |
| 146 | 3300005364 | Ga0070673_100247586 | Ga0070673_1002475862 | 292 |
| 147 | 3300005436 | Ga0070713_100044503 | Ga0070713_1000445032 | 292 |
| 148 | 3300005439 | Ga0070711_100364363 | Ga0070711_1003643631 | 292 |
| 149 | 3300005455 | Ga0070663_100017583 | Ga0070663_1000175832 | 292 |
| 150 | 3300005458 | Ga0070681_10016992 | Ga0070681_100169924 | 292 |
| 151 | 3300005458 | Ga0070681_10099687 | Ga0070681_100996873 | 292 |
| 152 | 3300005459 | Ga0068867_100070565 | Ga0068867_1000705652 | 292 |
| 153 | 3300005563 | Ga0068855_100005496 | Ga0068855_1000054963 | 292 |
| 154 | 3300005617 | Ga0068859_100207493 | Ga0068859_1002074932 | 292 |
| 155 | 3300006237 | Ga0097621_100033259 | Ga0097621_1000332592 | 292 |
| 156 | 3300006847 | Ga0075431_100027400 | Ga0075431_1000274002 | 292 |
| 157 | 3300006880 | Ga0075429_100339995 | Ga0075429_1003399952 | 292 |
| 158 | 3300006881 | Ga0068865_100046255 | Ga0068865_1000462553 | 292 |
| 159 | 3300006881 | Ga0068865_100363607 | Ga0068865_1003636072 | 292 |
| 160 | 3300006914 | Ga0075436_100021569 | Ga0075436_1000215693 | 292 |
| 161 | 3300006931 | Ga0097620_100207490 | Ga0097620_1002074902 | 292 |
| 162 | 3300009093 | Ga0105240_10002067 | Ga0105240_100020675 | 292 |
| 163 | 3300009093 | Ga0105240_10364574 | Ga0105240_103645742 | 292 |
| 164 | 3300009093 | Ga0105240_10684781 | Ga0105240_106847812 | 292 |
| 165 | 3300009098 | Ga0105245_10137523 | Ga0105245_101375232 | 292 |
| 166 | 3300009174 | Ga0105241_10008113 | Ga0105241_100081136 | 292 |
| 167 | 3300009176 | Ga0105242_10072894 | Ga0105242_100728943 | 292 |
| 168 | 3300009176 | Ga0105242_10211059 | Ga0105242_102110592 | 292 |
| 169 | 3300009545 | Ga0105237_10126899 | Ga0105237_101268992 | 292 |
| 170 | 3300009551 | Ga0105238_10069401 | Ga0105238_100694012 | 292 |
| 171 | 3300009551 | Ga0105238_10607154 | Ga0105238_106071542 | 292 |
| 172 | 3300010375 | Ga0105239_10132220 | Ga0105239_101322203 | 292 |
| 173 | 3300011119 | Ga0105246_10163332 | Ga0105246_101633322 | 292 |
| 174 | 3300013104 | Ga0157370_10013108 | Ga0157370_100131083 | 292 |
| 175 | 3300013104 | Ga0157370_10275536 | Ga0157370_102755362 | 292 |
| 176 | 3300013104 | Ga0157370_10311689 | Ga0157370_103116892 | 292 |
| 177 | 3300013105 | Ga0157369_10349089 | Ga0157369_103490892 | 292 |
| 178 | 3300013297 | Ga0157378_10002118 | Ga0157378_100021189 | 292 |
| 179 | 3300013306 | Ga0163162_10189777 | Ga0163162_101897773 | 292 |
| 180 | 3300013307 | Ga0157372_10023921 | Ga0157372_100239212 | 292 |
| 181 | 3300013307 | Ga0157372_10104628 | Ga0157372_101046282 | 292 |
| 182 | 3300013307 | Ga0157372_10195713 | Ga0157372_101957131 | 292 |
| 183 | 3300013308 | Ga0157375_10282395 | Ga0157375_102823952 | 292 |
| 184 | 3300021388 | Ga0213875_10007340 | Ga0213875_100073407 | 292 |
| 185 | 3300021388 | Ga0213875_10045127 | Ga0213875_100451272 | 292 |
| 186 | 3300022467 | Ga0224712_10139236 | Ga0224712_101392361 | 292 |
| 187 | 3300025321 | Ga0207656_10082372 | Ga0207656_100823722 | 292 |
| 188 | 3300025909 | Ga0207705_10014739 | Ga0207705_100147395 | 292 |
| 189 | 3300025911 | Ga0207654_10047212 | Ga0207654_100472122 | 292 |
| 190 | 3300025913 | Ga0207695_10005671 | Ga0207695_1000567113 | 292 |
| 191 | 3300025913 | Ga0207695_10081279 | Ga0207695_100812792 | 292 |
| 192 | 3300025913 | Ga0207695_10501107 | Ga0207695_105011072 | 292 |
| 193 | 3300025922 | Ga0207646_10000016 | Ga0207646_1000001612 | 292 |
| 194 | 3300025924 | Ga0207694_10002979 | Ga0207694_1000297911 | 292 |
| 195 | 3300025924 | Ga0207694_10058190 | Ga0207694_100581903 | 292 |
| 196 | 3300025927 | Ga0207687_10002547 | Ga0207687_100025475 | 292 |
| 197 | 3300025927 | Ga0207687_10109316 | Ga0207687_101093162 | 292 |
| 198 | 3300025928 | Ga0207700_10001522 | Ga0207700_100015224 | 292 |
| 199 | 3300025934 | Ga0207686_10016208 | Ga0207686_100162082 | 292 |
| 200 | 3300025938 | Ga0207704_10019331 | Ga0207704_100193313 | 292 |
| 201 | 3300025938 | Ga0207704_10141428 | Ga0207704_101414282 | 292 |
| 202 | 3300025942 | Ga0207689_10090770 | Ga0207689_100907703 | 292 |
| 203 | 3300025944 | Ga0207661_10426764 | Ga0207661_104267642 | 292 |
| 204 | 3300025949 | Ga0207667_10001499 | Ga0207667_100014995 | 292 |
| 205 | 3300025949 | Ga0207667_10046952 | Ga0207667_100469524 | 292 |
| 206 | 3300025961 | Ga0207712_10043421 | Ga0207712_100434212 | 292 |
| 207 | 3300026067 | Ga0207678_10026135 | Ga0207678_100261352 | 292 |
| 208 | 3300026089 | Ga0207648_10009044 | Ga0207648_100090442 | 292 |
| 209 | 3300026118 | Ga0207675_100010887 | Ga0207675_1000108878 | 292 |
| 210 | 3300035083 | Ga0373926_0019795 | Ga0373926_0019795_208_1089 | 292 |
| 211 | 3300035119 | Ga0373956_0054175 | Ga0373956_0054175_236_1126 | 292 |
| 212 | 3300035695 | Ga0373927_0009837 | Ga0373927_0009837_3893_4774 | 292 |
| 213 | 3300037068 | Ga0373925_0298449 | Ga0373925_0298449_172_1062 | 292 |
| 214 | 3300037466 | Ga0395898_0137759 | Ga0395898_0137759_208_1128 | 292 |
| 215 | 3300037853 | Ga0436364_0658052 | Ga0436364_0658052_767_1678 | 292 |
| 216 | 3300037853 | Ga0436364_0822356 | Ga0436364_0822356_199_1110 | 292 |
| 217 | 3300037853 | Ga0436364_1188517 | Ga0436364_1188517_456_1367 | 292 |
| 218 | 3300037853 | Ga0436364_1306996 | Ga0436364_1306996_1039_1935 | 292 |
| 219 | 3300039437 | Ga0436365_0998318 | Ga0436365_0998318_63_959 | 292 |
| 220 | 3300039438 | Ga0436360_0490098 | Ga0436360_0490098_184_1095 | 292 |
| 221 | 3300039453 | Ga0436362_0306584 | Ga0436362_0306584_431_1342 | 292 |
| 222 | 3300039453 | Ga0436362_1032274 | Ga0436362_1032274_691_1572 | 292 |
| 223 | 3300042876 | Ga0451577_0098319 | Ga0451577_0098319_785_1669 | 292 |
| 224 | 3300044673 | Ga0453683_0000548 | Ga0453683_0000548_31928_32812 | 292 |
| 225 | 3300044712 | Ga0453684_0470204 | Ga0453684_0470204_274_1158 | 292 |
| 226 | 3300046472 | Ga0495580_0006268 | Ga0495580_0006268_6493_7383 | 292 |
| 227 | 3300046472 | Ga0495580_0317473 | Ga0495580_0317473_129_1031 | 292 |
| 228 | 3300046473 | Ga0495582_0014082 | Ga0495582_0014082_2543_3424 | 292 |
| 229 | 3300046535 | Ga0495586_0014687 | Ga0495586_0014687_1343_2224 | 292 |
| 230 | 3300046683 | Ga0495658_0084803 | Ga0495658_0084803_440_1321 | 292 |
| 231 | 3300047319 | Ga0495674_0159009 | Ga0495674_0159009_276_1157 | 292 |
| 232 | 3300048907 | Ga0496104_0266991 | Ga0496104_0266991_223_1104 | 292 |
| 233 | 3300049581 | Ga0501047_0100734 | Ga0501047_0100734_553_1434 | 292 |
| 234 | 3300049822 | Ga0501035_0071779 | Ga0501035_0071779_1522_2442 | 292 |
| 235 | 3300049823 | Ga0501044_0004275 | Ga0501044_0004275_2794_3714 | 292 |
| 236 | 3300049823 | Ga0501044_0045900 | Ga0501044_0045900_2512_3432 | 292 |
| 237 | 3300050508 | nmdc:mga09592_329509_c1 | nmdc:mga09592_329509_c1_169_1050 | 292 |
| 238 | 3300050510 | nmdc:mga06r32_15116_c1 | nmdc:mga06r32_15116_c1_64_945 | 292 |
| 239 | 3300050514 | nmdc:mga08x19_17930_c1 | nmdc:mga08x19_17930_c1_1192_2073 | 292 |
| 240 | iso_pu_bacteria | 2519899754 | 2520878842 | 292 |
| 241 | iso_pu_bacteria | 2643221600 | 2644011445 | 292 |
| 242 | iso_pu_bacteria | 2643221716 | 2644642308 | 292 |
| 243 | iso_pu_bacteria | 2643221725 | 2644685238 | 292 |
| 244 | iso_pu_bacteria | 2739367857 | 2740000812 | 292 |
| 245 | iso_pu_bacteria | 2739367858 | 2740005628 | 292 |
| 246 | iso_pu_bacteria | 2802428842 | 2802654152 | 292 |
| 247 | iso_pu_bacteria | 2816332280 | 2817415821 | 292 |
| 248 | iso_pu_bacteria | 2857613821 | 2857614558 | 292 |
| 249 | iso_pu_bacteria | 2857618242 | 2857619060 | 292 |
| 250 | iso_pu_bacteria | 2881359912 | 2881360466 | 292 |
| 251 | iso_pu_bacteria | 2903895155 | 2903898609 | 292 |
| 252 | iso_pu_bacteria | 2904419702 | 2904419845 | 292 |
| 253 | iso_pu_bacteria | 2919191525 | 2919194038 | 292 |
| 254 | iso_pu_bacteria | 2958458903 | 2958460881 | 292 |
| 255 | iso_pu_bacteria | 2977268062 | 2977269732 | 292 |
| 256 | iso_pu_bacteria | 8054307821 | 8054308205 | 292 |
| 257 | iso_pu_bacteria | 8055419101 | 8055421499 | 292 |
| 258 | iso_pu_bacteria | 8055592153 | 8055594027 | 292 |
| 259 | 3300005329 | Ga0070683_100089029 | Ga0070683_1000890293 | 293 |
| 260 | 3300005435 | Ga0070714_100062522 | Ga0070714_1000625223 | 293 |
| 261 | 3300005436 | Ga0070713_100205524 | Ga0070713_1002055242 | 293 |
| 262 | 3300005445 | Ga0070708_100033387 | Ga0070708_1000333874 | 293 |
| 263 | 3300005445 | Ga0070708_100065359 | Ga0070708_1000653594 | 293 |
| 264 | 3300005467 | Ga0070706_100010274 | Ga0070706_1000102742 | 293 |
| 265 | 3300005467 | Ga0070706_100013873 | Ga0070706_1000138737 | 293 |
| 266 | 3300005467 | Ga0070706_100440219 | Ga0070706_1004402191 | 293 |
| 267 | 3300005468 | Ga0070707_100030715 | Ga0070707_1000307152 | 293 |
| 268 | 3300005468 | Ga0070707_100623873 | Ga0070707_1006238731 | 293 |
| 269 | 3300005471 | Ga0070698_100420296 | Ga0070698_1004202962 | 293 |
| 270 | 3300005518 | Ga0070699_100014010 | Ga0070699_1000140106 | 293 |
| 271 | 3300005535 | Ga0070684_100153703 | Ga0070684_1001537031 | 293 |
| 272 | 3300005536 | Ga0070697_100003325 | Ga0070697_1000033258 | 293 |
| 273 | 3300005536 | Ga0070697_100366207 | Ga0070697_1003662072 | 293 |
| 274 | 3300006028 | Ga0070717_10014279 | Ga0070717_100142797 | 293 |
| 275 | 3300006914 | Ga0075436_100000786 | Ga0075436_10000078617 | 293 |
| 276 | 3300006914 | Ga0075436_100035931 | Ga0075436_1000359312 | 293 |
| 277 | 3300009093 | Ga0105240_10288550 | Ga0105240_102885501 | 293 |
| 278 | 3300009177 | Ga0105248_10022854 | Ga0105248_100228546 | 293 |
| 279 | 3300013307 | Ga0157372_10038635 | Ga0157372_100386354 | 293 |
| 280 | 3300013307 | Ga0157372_10055773 | Ga0157372_100557731 | 293 |
| 281 | 3300014325 | Ga0163163_10058448 | Ga0163163_100584483 | 293 |
| 282 | 3300025910 | Ga0207684_10017495 | Ga0207684_100174952 | 293 |
| 283 | 3300025913 | Ga0207695_10007205 | Ga0207695_1000720513 | 293 |
| 284 | 3300025928 | Ga0207700_10272033 | Ga0207700_102720331 | 293 |
| 285 | 3300025929 | Ga0207664_10066868 | Ga0207664_100668681 | 293 |
| 286 | 3300025941 | Ga0207711_10147898 | Ga0207711_101478981 | 293 |
| 287 | 3300025944 | Ga0207661_10064568 | Ga0207661_100645682 | 293 |
| 288 | 3300026088 | Ga0207641_10027453 | Ga0207641_100274532 | 293 |
| 289 | 3300026116 | Ga0207674_10101224 | Ga0207674_101012242 | 293 |
| 290 | 3300026121 | Ga0207683_10069806 | Ga0207683_100698063 | 293 |
| 291 | 3300028379 | Ga0268266_10247871 | Ga0268266_102478712 | 293 |
| 292 | 3300028573 | Ga0265334_10057252 | Ga0265334_100572522 | 293 |
| 293 | 3300028577 | Ga0265318_10000224 | Ga0265318_1000022424 | 293 |
| 294 | 3300028577 | Ga0265318_10008554 | Ga0265318_100085544 | 293 |
| 295 | 3300031235 | Ga0265330_10002397 | Ga0265330_100023974 | 293 |
| 296 | 3300031238 | Ga0265332_10000686 | Ga0265332_1000068618 | 293 |
| 297 | 3300031239 | Ga0265328_10010390 | Ga0265328_100103902 | 293 |
| 298 | 3300031240 | Ga0265320_10004323 | Ga0265320_100043234 | 293 |
| 299 | 3300031242 | Ga0265329_10003082 | Ga0265329_100030827 | 293 |
| 300 | 3300031250 | Ga0265331_10046058 | Ga0265331_100460582 | 293 |
| 301 | 3300031344 | Ga0265316_10080641 | Ga0265316_100806412 | 293 |
| 302 | 3300031507 | Ga0307509_10123494 | Ga0307509_101234942 | 293 |
| 303 | 3300031595 | Ga0265313_10028980 | Ga0265313_100289803 | 293 |
| 304 | 3300031711 | Ga0265314_10004948 | Ga0265314_1000494810 | 293 |
| 305 | 3300031712 | Ga0265342_10000368 | Ga0265342_100003684 | 293 |
| 306 | 3300031903 | Ga0307407_10126718 | Ga0307407_101267182 | 293 |
| 307 | 3300035083 | Ga0373926_0009181 | Ga0373926_0009181_103_990 | 293 |
| 308 | 3300035111 | Ga0373923_0022455 | Ga0373923_0022455_423_1310 | 293 |
| 309 | 3300035117 | Ga0373953_0041548 | Ga0373953_0041548_232_1119 | 293 |
| 310 | 3300035119 | Ga0373956_0003328 | Ga0373956_0003328_2300_3187 | 293 |
| 311 | 3300035172 | Ga0373955_0002990 | Ga0373955_0002990_1773_2660 | 293 |
| 312 | 3300035692 | Ga0373935_0056029 | Ga0373935_0056029_1536_2423 | 293 |
| 313 | 3300035695 | Ga0373927_0004452 | Ga0373927_0004452_2186_3073 | 293 |
| 314 | 3300035724 | Ga0373933_0095011 | Ga0373933_0095011_264_1151 | 293 |
| 315 | 3300035724 | Ga0373933_0116569 | Ga0373933_0116569_729_1616 | 293 |
| 316 | 3300035725 | Ga0373947_0044626 | Ga0373947_0044626_118_1005 | 293 |
| 317 | 3300036401 | Ga0373937_0046658 | Ga0373937_0046658_1548_2435 | 293 |
| 318 | 3300037068 | Ga0373925_0061915 | Ga0373925_0061915_151_1038 | 293 |
| 319 | 3300042876 | Ga0451577_0089705 | Ga0451577_0089705_484_1371 | 293 |
| 320 | 3300042876 | Ga0451577_0374375 | Ga0451577_0374375_32_928 | 293 |
| 321 | 3300045049 | Ga0466959_0135539 | Ga0466959_0135539_199_1098 | 293 |
| 322 | 3300046472 | Ga0495580_0029553 | Ga0495580_0029553_2486_3385 | 293 |
| 323 | 3300046689 | Ga0495613_0160644 | Ga0495613_0160644_187_1077 | 293 |
| 324 | 3300048915 | Ga0496112_0182016 | Ga0496112_0182016_623_1513 | 293 |
| 325 | 3300049582 | Ga0501048_0211690 | Ga0501048_0211690_188_1075 | 293 |
| 326 | 3300049686 | Ga0501257_039613 | Ga0501257_039613_174_1112 | 293 |
| 327 | 3300050509 | nmdc:mga0qj67_8316_c1 | nmdc:mga0qj67_8316_c1_2863_3807 | 293 |
| 328 | 3300050514 | nmdc:mga08x19_555_c2 | nmdc:mga08x19_555_c2_10724_11623 | 293 |
| 329 | 3300005290 | Ga0065712_10116560 | Ga0065712_101165602 | 294 |
| 330 | 3300005293 | Ga0065715_10109837 | Ga0065715_101098373 | 294 |
| 331 | 3300005329 | Ga0070683_100142852 | Ga0070683_1001428521 | 294 |
| 332 | 3300005334 | Ga0068869_100330994 | Ga0068869_1003309942 | 294 |
| 333 | 3300005335 | Ga0070666_10092117 | Ga0070666_100921172 | 294 |
| 334 | 3300005336 | Ga0070680_100046697 | Ga0070680_1000466972 | 294 |
| 335 | 3300005337 | Ga0070682_100007246 | Ga0070682_1000072464 | 294 |
| 336 | 3300005338 | Ga0068868_100004905 | Ga0068868_1000049055 | 294 |
| 337 | 3300005338 | Ga0068868_100179453 | Ga0068868_1001794531 | 294 |
| 338 | 3300005339 | Ga0070660_100053497 | Ga0070660_1000534973 | 294 |
| 339 | 3300005366 | Ga0070659_100052298 | Ga0070659_1000522982 | 294 |
| 340 | 3300005367 | Ga0070667_100052802 | Ga0070667_1000528023 | 294 |
| 341 | 3300005434 | Ga0070709_10077486 | Ga0070709_100774862 | 294 |
| 342 | 3300005434 | Ga0070709_10114134 | Ga0070709_101141343 | 294 |
| 343 | 3300005436 | Ga0070713_100055770 | Ga0070713_1000557703 | 294 |
| 344 | 3300005440 | Ga0070705_100091310 | Ga0070705_1000913101 | 294 |
| 345 | 3300005455 | Ga0070663_100016186 | Ga0070663_1000161862 | 294 |
| 346 | 3300005458 | Ga0070681_10020317 | Ga0070681_100203176 | 294 |
| 347 | 3300005468 | Ga0070707_100068123 | Ga0070707_1000681233 | 294 |
| 348 | 3300005518 | Ga0070699_100098316 | Ga0070699_1000983161 | 294 |
| 349 | 3300005530 | Ga0070679_100054386 | Ga0070679_1000543863 | 294 |
| 350 | 3300005535 | Ga0070684_100030327 | Ga0070684_1000303272 | 294 |
| 351 | 3300005536 | Ga0070697_100000056 | Ga0070697_10000005660 | 294 |
| 352 | 3300005536 | Ga0070697_100014354 | Ga0070697_1000143546 | 294 |
| 353 | 3300005536 | Ga0070697_100140395 | Ga0070697_1001403952 | 294 |
| 354 | 3300005545 | Ga0070695_100083942 | Ga0070695_1000839421 | 294 |
| 355 | 3300005546 | Ga0070696_100089873 | Ga0070696_1000898732 | 294 |
| 356 | 3300005549 | Ga0070704_100117018 | Ga0070704_1001170182 | 294 |
| 357 | 3300005564 | Ga0070664_100102415 | Ga0070664_1001024152 | 294 |
| 358 | 3300005577 | Ga0068857_100094948 | Ga0068857_1000949482 | 294 |
| 359 | 3300005577 | Ga0068857_100139584 | Ga0068857_1001395841 | 294 |
| 360 | 3300005578 | Ga0068854_100001808 | Ga0068854_10000180812 | 294 |
| 361 | 3300005614 | Ga0068856_100021190 | Ga0068856_1000211903 | 294 |
| 362 | 3300005614 | Ga0068856_100054304 | Ga0068856_1000543042 | 294 |
| 363 | 3300005614 | Ga0068856_100392361 | Ga0068856_1003923612 | 294 |
| 364 | 3300005616 | Ga0068852_100060005 | Ga0068852_1000600052 | 294 |
| 365 | 3300005618 | Ga0068864_100387604 | Ga0068864_1003876041 | 294 |
| 366 | 3300005842 | Ga0068858_100011173 | Ga0068858_1000111732 | 294 |
| 367 | 3300005843 | Ga0068860_100032066 | Ga0068860_1000320663 | 294 |
| 368 | 3300005843 | Ga0068860_100131493 | Ga0068860_1001314932 | 294 |
| 369 | 3300006028 | Ga0070717_10091306 | Ga0070717_100913062 | 294 |
| 370 | 3300006173 | Ga0070716_100075269 | Ga0070716_1000752693 | 294 |
| 371 | 3300006175 | Ga0070712_100012345 | Ga0070712_1000123453 | 294 |
| 372 | 3300006237 | Ga0097621_100137625 | Ga0097621_1001376252 | 294 |
| 373 | 3300006358 | Ga0068871_100000746 | Ga0068871_1000007469 | 294 |
| 374 | 3300007076 | Ga0075435_100233244 | Ga0075435_1002332441 | 294 |
| 375 | 3300009098 | Ga0105245_10016053 | Ga0105245_100160536 | 294 |
| 376 | 3300009101 | Ga0105247_10112348 | Ga0105247_101123482 | 294 |
| 377 | 3300009147 | Ga0114129_10068234 | Ga0114129_100682346 | 294 |
| 378 | 3300009176 | Ga0105242_10018631 | Ga0105242_100186313 | 294 |
| 379 | 3300009176 | Ga0105242_10153815 | Ga0105242_101538152 | 294 |
| 380 | 3300009177 | Ga0105248_10074776 | Ga0105248_100747762 | 294 |
| 381 | 3300009177 | Ga0105248_10303248 | Ga0105248_103032482 | 294 |
| 382 | 3300009551 | Ga0105238_10052599 | Ga0105238_100525994 | 294 |
| 383 | 3300010375 | Ga0105239_10569768 | Ga0105239_105697681 | 294 |
| 384 | 3300011119 | Ga0105246_10229509 | Ga0105246_102295092 | 294 |
| 385 | 3300013105 | Ga0157369_10075607 | Ga0157369_100756072 | 294 |
| 386 | 3300013296 | Ga0157374_10027875 | Ga0157374_100278753 | 294 |
| 387 | 3300013296 | Ga0157374_10038456 | Ga0157374_100384564 | 294 |
| 388 | 3300013296 | Ga0157374_10203970 | Ga0157374_102039702 | 294 |
| 389 | 3300013297 | Ga0157378_10001165 | Ga0157378_100011654 | 294 |
| 390 | 3300013297 | Ga0157378_10349689 | Ga0157378_103496892 | 294 |
| 391 | 3300013306 | Ga0163162_10004350 | Ga0163162_1000435011 | 294 |
| 392 | 3300013306 | Ga0163162_10052708 | Ga0163162_100527082 | 294 |
| 393 | 3300013307 | Ga0157372_10370739 | Ga0157372_103707392 | 294 |
| 394 | 3300013308 | Ga0157375_10672267 | Ga0157375_106722672 | 294 |
| 395 | 3300014968 | Ga0157379_10008944 | Ga0157379_100089442 | 294 |
| 396 | 3300014969 | Ga0157376_10025610 | Ga0157376_100256104 | 294 |
| 397 | 3300014969 | Ga0157376_10091405 | Ga0157376_100914052 | 294 |
| 398 | 3300024227 | Ga0228598_1003984 | Ga0228598_10039842 | 294 |
| 399 | 3300025899 | Ga0207642_10028907 | Ga0207642_100289072 | 294 |
| 400 | 3300025900 | Ga0207710_10062168 | Ga0207710_100621682 | 294 |
| 401 | 3300025906 | Ga0207699_10025061 | Ga0207699_100250612 | 294 |
| 402 | 3300025907 | Ga0207645_10012241 | Ga0207645_100122415 | 294 |
| 403 | 3300025911 | Ga0207654_10034275 | Ga0207654_100342753 | 294 |
| 404 | 3300025913 | Ga0207695_10010371 | Ga0207695_100103713 | 294 |
| 405 | 3300025914 | Ga0207671_10038421 | Ga0207671_100384213 | 294 |
| 406 | 3300025919 | Ga0207657_10009793 | Ga0207657_100097937 | 294 |
| 407 | 3300025919 | Ga0207657_10041434 | Ga0207657_100414343 | 294 |
| 408 | 3300025922 | Ga0207646_10209126 | Ga0207646_102091262 | 294 |
| 409 | 3300025924 | Ga0207694_10097675 | Ga0207694_100976752 | 294 |
| 410 | 3300025928 | Ga0207700_10007378 | Ga0207700_100073781 | 294 |
| 411 | 3300025928 | Ga0207700_10119628 | Ga0207700_101196282 | 294 |
| 412 | 3300025933 | Ga0207706_10000075 | Ga0207706_1000007583 | 294 |
| 413 | 3300025934 | Ga0207686_10048624 | Ga0207686_100486243 | 294 |
| 414 | 3300025934 | Ga0207686_10085014 | Ga0207686_100850141 | 294 |
| 415 | 3300025938 | Ga0207704_10247698 | Ga0207704_102476981 | 294 |
| 416 | 3300025942 | Ga0207689_10071125 | Ga0207689_100711253 | 294 |
| 417 | 3300025949 | Ga0207667_10007732 | Ga0207667_100077323 | 294 |
| 418 | 3300025972 | Ga0207668_10004334 | Ga0207668_100043349 | 294 |
| 419 | 3300025981 | Ga0207640_10012867 | Ga0207640_100128674 | 294 |
| 420 | 3300026035 | Ga0207703_10147289 | Ga0207703_101472891 | 294 |
| 421 | 3300026067 | Ga0207678_10000103 | Ga0207678_1000010321 | 294 |
| 422 | 3300026075 | Ga0207708_10079088 | Ga0207708_100790882 | 294 |
| 423 | 3300026088 | Ga0207641_10244565 | Ga0207641_102445652 | 294 |
| 424 | 3300026089 | Ga0207648_10006119 | Ga0207648_100061196 | 294 |
| 425 | 3300026116 | Ga0207674_10009982 | Ga0207674_100099824 | 294 |
| 426 | 3300026116 | Ga0207674_10137495 | Ga0207674_101374952 | 294 |
| 427 | 3300026118 | Ga0207675_100017027 | Ga0207675_1000170273 | 294 |
| 428 | 3300026121 | Ga0207683_10111174 | Ga0207683_101111742 | 294 |
| 429 | 3300028379 | Ga0268266_10124559 | Ga0268266_101245592 | 294 |
| 430 | 3300028379 | Ga0268266_10192144 | Ga0268266_101921441 | 294 |
| 431 | 3300028381 | Ga0268264_10117162 | Ga0268264_101171622 | 294 |
| 432 | 3300028556 | Ga0265337_1039542 | Ga0265337_10395422 | 294 |
| 433 | 3300029957 | Ga0265324_10000063 | Ga0265324_100000639 | 294 |
| 434 | 3300029957 | Ga0265324_10014546 | Ga0265324_100145463 | 294 |
| 435 | 3300031247 | Ga0265340_10048214 | Ga0265340_100482142 | 294 |
| 436 | 3300031249 | Ga0265339_10000010 | Ga0265339_10000010119 | 294 |
| 437 | 3300031344 | Ga0265316_10004322 | Ga0265316_1000432210 | 294 |
| 438 | 3300031595 | Ga0265313_10003719 | Ga0265313_100037199 | 294 |
| 439 | 3300031727 | Ga0316576_10130815 | Ga0316576_101308151 | 294 |
| 440 | 3300031852 | Ga0307410_10004592 | Ga0307410_100045925 | 294 |
| 441 | 3300032005 | Ga0307411_10002284 | Ga0307411_100022848 | 294 |
| 442 | 3300034820 | Ga0373959_0006217 | Ga0373959_0006217_19_921 | 294 |
| 443 | 3300035085 | Ga0373929_0006477 | Ga0373929_0006477_1075_1977 | 294 |
| 444 | 3300035170 | Ga0373943_0184738 | Ga0373943_0184738_168_1070 | 294 |
| 445 | 3300035207 | Ga0373942_0014620 | Ga0373942_0014620_572_1591 | 294 |
| 446 | 3300036401 | Ga0373937_0326650 | Ga0373937_0326650_298_1200 | 294 |
| 447 | 3300037471 | Ga0395905_0263386 | Ga0395905_0263386_187_1092 | 294 |
| 448 | 3300039453 | Ga0436362_0442697 | Ga0436362_0442697_643_1548 | 294 |
| 449 | 3300042876 | Ga0451577_0000531 | Ga0451577_0000531_58494_59402 | 294 |
| 450 | 3300042876 | Ga0451577_0041603 | Ga0451577_0041603_3031_3927 | 294 |
| 451 | 3300042876 | Ga0451577_0166528 | Ga0451577_0166528_1085_1969 | 294 |
| 452 | 3300044673 | Ga0453683_0013874 | Ga0453683_0013874_3346_4254 | 294 |
| 453 | 3300044694 | Ga0466963_0000193 | Ga0466963_0000193_8208_9110 | 294 |
| 454 | 3300044712 | Ga0453684_0000324 | Ga0453684_0000324_79744_80652 | 294 |
| 455 | 3300044712 | Ga0453684_0000968 | Ga0453684_0000968_170_1066 | 294 |
| 456 | 3300045051 | Ga0451576_0005720 | Ga0451576_0005720_3829_4737 | 294 |
| 457 | 3300045051 | Ga0451576_0147833 | Ga0451576_0147833_309_1211 | 294 |
| 458 | 3300045976 | Ga0466967_0001058 | Ga0466967_0001058_13136_14038 | 294 |
| 459 | 3300045976 | Ga0466967_0098432 | Ga0466967_0098432_1512_2414 | 294 |
| 460 | 3300046472 | Ga0495580_0039807 | Ga0495580_0039807_2074_2997 | 294 |
| 461 | 3300046472 | Ga0495580_0112870 | Ga0495580_0112870_775_1698 | 294 |
| 462 | 3300047319 | Ga0495674_0055000 | Ga0495674_0055000_1505_2428 | 294 |
| 463 | 3300047471 | Ga0495684_0058713 | Ga0495684_0058713_220_1122 | 294 |
| 464 | 3300048905 | Ga0496102_0116928 | Ga0496102_0116928_474_1493 | 294 |
| 465 | 3300048906 | Ga0496103_0016516 | Ga0496103_0016516_2695_3774 | 294 |
| 466 | 3300048907 | Ga0496104_0146919 | Ga0496104_0146919_1348_2250 | 294 |
| 467 | 3300048912 | Ga0496109_0212553 | Ga0496109_0212553_136_1155 | 294 |
| 468 | 3300048915 | Ga0496112_0141920 | Ga0496112_0141920_13_1032 | 294 |
| 469 | 3300050512 | nmdc:mga0n895_127273_c1 | nmdc:mga0n895_127273_c1_684_1592 | 294 |
| 470 | 3300050512 | nmdc:mga0n895_166621_c1 | nmdc:mga0n895_166621_c1_453_1355 | 294 |
| 471 | 3300050513 | nmdc:mga0rr50_216449_c1 | nmdc:mga0rr50_216449_c1_208_1110 | 294 |
| 472 | 3300050513 | nmdc:mga0rr50_314450_c1 | nmdc:mga0rr50_314450_c1_267_1175 | 294 |
| 473 | 3300005288 | Ga0065714_10004146 | Ga0065714_100041463 | 295 |
| 474 | 3300005288 | Ga0065714_10066564 | Ga0065714_100665643 | 295 |
| 475 | 3300005288 | Ga0065714_10077319 | Ga0065714_100773193 | 295 |
| 476 | 3300005548 | Ga0070665_100000059 | Ga0070665_100000059163 | 295 |
| 477 | 3300006844 | Ga0075428_100092022 | Ga0075428_1000920222 | 295 |
| 478 | 3300006844 | Ga0075428_100278158 | Ga0075428_1002781582 | 295 |
| 479 | 3300009036 | Ga0105244_10000004 | Ga0105244_10000004358 | 295 |
| 480 | 3300009147 | Ga0114129_10030396 | Ga0114129_100303965 | 295 |
| 481 | 3300009545 | Ga0105237_10401164 | Ga0105237_104011642 | 295 |
| 482 | 3300013104 | Ga0157370_10026706 | Ga0157370_100267063 | 295 |
| 483 | 3300017792 | Ga0163161_10000007 | Ga0163161_10000007186 | 295 |
| 484 | 3300025728 | Ga0207655_1000008 | Ga0207655_1000008230 | 295 |
| 485 | 3300028794 | Ga0307515_10135185 | Ga0307515_101351851 | 295 |
| 486 | 3300028800 | Ga0265338_10187940 | Ga0265338_101879402 | 295 |
| 487 | 3300031249 | Ga0265339_10015894 | Ga0265339_100158943 | 295 |
| 488 | 3300031712 | Ga0265342_10000128 | Ga0265342_1000012847 | 295 |
| 489 | 3300032004 | Ga0307414_10121444 | Ga0307414_101214442 | 295 |
| 490 | 3300032004 | Ga0307414_10282008 | Ga0307414_102820081 | 295 |
| 491 | 3300041494 | Ga0451837_0054513 | Ga0451837_0054513_467_1354 | 295 |
| 492 | 3300042156 | Ga0439446_0005985 | Ga0439446_0005985_1540_2517 | 295 |
| 493 | 3300042876 | Ga0451577_0000173 | Ga0451577_0000173_135399_136286 | 295 |
| 494 | 3300042876 | Ga0451577_0003545 | Ga0451577_0003545_3841_4728 | 295 |
| 495 | 3300042876 | Ga0451577_0004786 | Ga0451577_0004786_7927_8841 | 295 |
| 496 | 3300042876 | Ga0451577_0030222 | Ga0451577_0030222_559_1446 | 295 |
| 497 | 3300044712 | Ga0453684_0001343 | Ga0453684_0001343_24758_25729 | 295 |
| 498 | 3300044712 | Ga0453684_0001454 | Ga0453684_0001454_36297_37184 | 295 |
| 499 | 3300044712 | Ga0453684_0019540 | Ga0453684_0019540_1581_2600 | 295 |
| 500 | 3300044712 | Ga0453684_0049970 | Ga0453684_0049970_4402_5289 | 295 |
| 501 | 3300045051 | Ga0451576_0000613 | Ga0451576_0000613_36297_37184 | 295 |
| 502 | 3300046472 | Ga0495580_0026885 | Ga0495580_0026885_1611_2540 | 295 |
| 503 | 3300048916 | Ga0496113_0222835 | Ga0496113_0222835_182_1099 | 295 |
| 504 | 3300048928 | Ga0496125_0000050 | Ga0496125_0000050_66117_67004 | 295 |
| 505 | 3300048929 | Ga0496126_0005294 | Ga0496126_0005294_5234_6163 | 295 |
| 506 | 3300049568 | Ga0501031_0075344 | Ga0501031_0075344_1103_1999 | 295 |
| 507 | 3300049575 | Ga0501039_0122677 | Ga0501039_0122677_155_1051 | 295 |
| 508 | 3300049577 | Ga0501041_0105516 | Ga0501041_0105516_257_1153 | 295 |
| 509 | 3300049578 | Ga0501042_0081683 | Ga0501042_0081683_300_1196 | 295 |
| 510 | 3300049582 | Ga0501048_0070562 | Ga0501048_0070562_414_1310 | 295 |
| 511 | 3300049587 | Ga0501071_0058745 | Ga0501071_0058745_152_1048 | 295 |
| 512 | 3300049591 | Ga0501075_0041214 | Ga0501075_0041214_1871_2767 | 295 |
| 513 | 3300049679 | Ga0501249_000033 | Ga0501249_000033_2682_3569 | 295 |
| 514 | 3300049742 | Ga0501080_0111597 | Ga0501080_0111597_97_993 | 295 |
| 515 | 3300049822 | Ga0501035_0248099 | Ga0501035_0248099_134_1030 | 295 |
| 516 | 3300049824 | Ga0501045_0108415 | Ga0501045_0108415_712_1608 | 295 |
| 517 | 3300050507 | nmdc:mga05p37_35920_c1 | nmdc:mga05p37_35920_c1_1969_2865 | 295 |
| 518 | 3300053085 | Ga0495619_0055744 | Ga0495619_0055744_987_1889 | 295 |
| 519 | 3300053090 | Ga0500646_0003732 | Ga0500646_0003732_2804_3691 | 295 |
| 520 | 3300053096 | Ga0500641_0000027 | Ga0500641_0000027_43317_44204 | 295 |
| 521 | 3300053096 | Ga0500641_0002278 | Ga0500641_0002278_3528_4415 | 295 |
| 522 | 3300054114 | Ga0501084_0140321 | Ga0501084_0140321_485_1381 | 295 |
| 523 | 3300003578 | Ga0006562J51391_1006967 | Ga0006562J51391_10069671 | 296 |
| 524 | 3300005288 | Ga0065714_10069104 | Ga0065714_100691044 | 296 |
| 525 | 3300006942 | Ga0099824_1009165 | Ga0099824_10091658 | 296 |
| 526 | 3300006946 | Ga0079104_1000179 | Ga0079104_100017939 | 296 |
| 527 | 3300006948 | Ga0099826_10039471 | Ga0099826_100394713 | 296 |
| 528 | 3300013100 | Ga0157373_10000002 | Ga0157373_1000000265 | 296 |
| 529 | 3300013102 | Ga0157371_10008727 | Ga0157371_100087271 | 296 |
| 530 | 3300013104 | Ga0157370_10001033 | Ga0157370_1000103313 | 296 |
| 531 | 3300013104 | Ga0157370_10003309 | Ga0157370_1000330913 | 296 |
| 532 | 3300013104 | Ga0157370_10012803 | Ga0157370_1001280310 | 296 |
| 533 | 3300013105 | Ga0157369_10214531 | Ga0157369_102145312 | 296 |
| 534 | 3300015261 | Ga0182006_1017349 | Ga0182006_10173493 | 296 |
| 535 | 3300027111 | Ga0209281_1000116 | Ga0209281_1000116105 | 296 |
| 536 | 3300027666 | Ga0209282_1032878 | Ga0209282_10328782 | 296 |
| 537 | 3300031548 | Ga0307408_100002894 | Ga0307408_1000028946 | 296 |
| 538 | 3300031824 | Ga0307413_10003912 | Ga0307413_100039123 | 296 |
| 539 | 3300031852 | Ga0307410_10000115 | Ga0307410_1000011520 | 296 |
| 540 | 3300031901 | Ga0307406_10000111 | Ga0307406_1000011120 | 296 |
| 541 | 3300031903 | Ga0307407_10008551 | Ga0307407_100085512 | 296 |
| 542 | 3300032004 | Ga0307414_10000001 | Ga0307414_10000001789 | 296 |
| 543 | 3300032005 | Ga0307411_10000013 | Ga0307411_1000001355 | 296 |
| 544 | 3300032005 | Ga0307411_10214715 | Ga0307411_102147151 | 296 |
| 545 | 3300041407 | Ga0439447_002257 | Ga0439447_002257_1474_2364 | 296 |
| 546 | 3300041411 | Ga0439466_0002554 | Ga0439466_0002554_3881_4771 | 296 |
| 547 | 3300044673 | Ga0453683_0042311 | Ga0453683_0042311_363_1262 | 296 |
| 548 | 3300046558 | Ga0495633_0142313 | Ga0495633_0142313_103_993 | 296 |
| 549 | 3300048919 | Ga0496116_0000047 | Ga0496116_0000047_248814_249704 | 296 |
| 550 | 3300048921 | Ga0496118_0075921 | Ga0496118_0075921_44_934 | 296 |
| 551 | 3300048924 | Ga0496121_0009482 | Ga0496121_0009482_2110_3000 | 296 |
| 552 | 3300048927 | Ga0496124_0024755 | Ga0496124_0024755_310_1200 | 296 |
| 553 | 3300048927 | Ga0496124_0152485 | Ga0496124_0152485_218_1108 | 296 |
| 554 | 3300049539 | Ga0501323_013347 | Ga0501323_013347_31_921 | 296 |
| 555 | 3300049679 | Ga0501249_001379 | Ga0501249_001379_1474_2364 | 296 |
| 556 | 3300049763 | Ga0501266_000005 | Ga0501266_000005_40200_41090 | 296 |
| 557 | 3300049766 | Ga0501269_012482 | Ga0501269_012482_26_916 | 296 |
| 558 | 3300053134 | Ga0500658_0000021 | Ga0500658_0000021_114873_115763 | 296 |
| 559 | 3300053136 | Ga0500559_0052890 | Ga0500559_0052890_783_1673 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h8j-assembly1.cif.gz_H | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine | 0.9633 | 4 | 292 |
| 5h8i-assembly1.cif.gz_H | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine | 0.9595 | 4 | 293 |
| 5h8j-assembly2.cif.gz_P | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine | 0.9566 | 4 | 289 |
| 5h8l-assembly2.cif.gz_P | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine | 0.9498 | 4 | 289 |
| 5h8k-assembly1.cif.gz_H | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant | 0.9496 | 4 | 289 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5h8jH00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9633 | 4 | 292 | 3.60.110.10 |
| 6mg6B00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9437 | 5 | 294 | 3.60.110.10 |
| 5h8jH00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9353 | 4 | 292 | 3.60.110.10 |
| 6mg6B00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9312 | 5 | 294 | 3.60.110.10 |
| 5h8jC00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9305 | 4 | 296 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5S3QQQ3-F1-model_v4 | deleted | 0.9886 | 6 | 111 |
|
| AF-A0A6J4MZV2-F1-model_v4 | N-carbamoylputrescine amidase (EC 3.5.1.53) | 0.9871 | 17 | 185 |
GO:0033388
GO:0050126 |
| AF-A0A372GZC1-F1-model_v4 | Acyltransferase | 0.9869 | 4 | 295 |
GO:0016746
GO:0033388 GO:0050126 |
| AF-A0A1K2IH76-F1-model_v4 | N-carbamoylputrescine amidase | 0.9865 | 5 | 295 |
GO:0033388
GO:0050126 |
| AF-A0A7J4VEW5-F1-model_v4 | Acyltransferase | 0.9864 | 1 | 103 |
GO:0016746
GO:0033388 GO:0050126 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar