F463549

General Info

Members Datasets Scaffolds Average Seq Length
559 309 1118 175

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100343888|Ga0097621_1003438882
Length 172
Sequence MSEANYTAHESLADGSRIDIRALRREDEADMLAAIGNTSAQSLQRRFFVMKRHFSDKERAFFMDVDFKNHVALVALGEQEGRKIIVGGGRYVVFEPGRAELAFVVIDAWQGRGIGSILMRCLIEIARAARLQELTAEVLPENAAMRGVFGKFGFRPVSRQDPQTIHLALTLA

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
293 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
294 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
295 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
296 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
297 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
298 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
299 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
300 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
303 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
304 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
305 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
306 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
307 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
308 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.48
Nodule 0
Rhizoplane 7.33
Rhizosphere 75.31
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100343888 3300006237 Bacteria 1325
2 rootL2_10082123 3300003322 Bacteria 1453
3 rootH1_10299528 3300003323 Bacteria 2070
4 JGI25405J52794_10019163 3300003911 Bacteria 1370
5 Ga0070658_10009817 3300005327 Bacteria 7691
6 Ga0070683_100109711 3300005329 Bacteria 2603
7 Ga0070683_101466382 3300005329 Bacteria 656
8 Ga0070670_100219173 3300005331 Bacteria 1655
9 Ga0070670_100316967 3300005331 Bacteria 1366
10 Ga0068869_100027560 3300005334 Bacteria 3963
11 Ga0068869_100156782 3300005334 Bacteria 1770
12 Ga0068869_100167256 3300005334 Bacteria 1715
13 Ga0070680_100414440 3300005336 Bacteria 1149
14 Ga0070680_100549994 3300005336 Unclassified 989
15 Ga0070682_100089108 3300005337 Bacteria 2015
16 Ga0070682_100386628 3300005337 Bacteria 1054
17 Ga0068868_100052901 3300005338 Bacteria 3197
18 Ga0068868_100280273 3300005338 Bacteria 1411
19 Ga0070689_101093883 3300005340 Bacteria 712
20 Ga0070691_10453155 3300005341 Bacteria 733
21 Ga0070661_100100848 3300005344 Bacteria 2147
22 Ga0070692_10158759 3300005345 Bacteria 1294
23 Ga0070668_100008471 3300005347 Bacteria 7638
24 Ga0070668_100034222 3300005347 Bacteria 3871
25 Ga0070668_100198958 3300005347 Bacteria 1644
26 Ga0070669_100058899 3300005353 Bacteria 2819
27 Ga0070669_100425075 3300005353 Bacteria 1091
28 Ga0070675_100122063 3300005354 Bacteria 2214
29 Ga0070671_100030926 3300005355 Bacteria 4419
30 Ga0070671_100046629 3300005355 Bacteria 3604
31 Ga0070671_100274281 3300005355 Bacteria 1434
32 Ga0070673_100686104 3300005364 Bacteria 940
33 Ga0070688_100084334 3300005365 Bacteria 2064
34 Ga0070688_100608426 3300005365 Bacteria 837
35 Ga0070659_100131294 3300005366 Bacteria 2035
36 Ga0070659_101489257 3300005366 Bacteria 603
37 Ga0070667_100053615 3300005367 Bacteria 3403
38 Ga0070667_100883341 3300005367 Bacteria 832
39 Ga0070703_10009501 3300005406 Bacteria 2742
40 Ga0070714_101003884 3300005435 Bacteria 812
41 Ga0070714_101507475 3300005435 Bacteria 657
42 Ga0070713_100052262 3300005436 Bacteria 3383
43 Ga0070713_100703408 3300005436 Bacteria 965
44 Ga0070711_100492829 3300005439 Bacteria 1009
45 Ga0070700_100094667 3300005441 Bacteria 1956
46 Ga0070700_100120952 3300005441 Bacteria 1754
47 Ga0070700_100539459 3300005441 Bacteria 904
48 Ga0070663_100013006 3300005455 Bacteria 5287
49 Ga0070663_100015608 3300005455 Bacteria 4909
50 Ga0070663_100321711 3300005455 Bacteria 1244
51 Ga0070678_100029254 3300005456 Bacteria 3770
52 Ga0070678_100041571 3300005456 Bacteria 3260
53 Ga0070678_100091222 3300005456 Bacteria 2338
54 Ga0070678_100221161 3300005456 Bacteria 1574
55 Ga0070662_100037967 3300005457 Bacteria 3418
56 Ga0070662_100157478 3300005457 Bacteria 1774
57 Ga0070698_100076093 3300005471 Bacteria 3360
58 Ga0070698_100076261 3300005471 Bacteria 3355
59 Ga0070699_100030945 3300005518 Bacteria 4621
60 Ga0070684_100014162 3300005535 Bacteria 6450
61 Ga0070697_100311706 3300005536 Bacteria 1354
62 Ga0068853_100023084 3300005539 Bacteria 5206
63 Ga0068853_100260887 3300005539 Bacteria 1593
64 Ga0070672_100141612 3300005543 Bacteria 1984
65 Ga0070672_100420918 3300005543 Bacteria 1147
66 Ga0070686_100707889 3300005544 Bacteria 804
67 Ga0070693_100195120 3300005547 Bacteria 1312
68 Ga0070693_100236362 3300005547 Bacteria 1205
69 Ga0070665_100002210 3300005548 Bacteria 21716
70 Ga0070665_100053120 3300005548 Bacteria 4064
71 Ga0070665_100085997 3300005548 Bacteria 3150
72 Ga0070665_100160044 3300005548 Bacteria 2253
73 Ga0070665_100246334 3300005548 Bacteria 1787
74 Ga0070665_101520217 3300005548 Bacteria 678
75 Ga0068855_100608271 3300005563 Bacteria 1178
76 Ga0070664_100079022 3300005564 Bacteria 2831
77 Ga0070664_100235291 3300005564 Bacteria 1643
78 Ga0068854_100892388 3300005578 Bacteria 781
79 Ga0068856_100287615 3300005614 Bacteria 1661
80 Ga0068852_100192198 3300005616 Bacteria 1927
81 Ga0068859_100057553 3300005617 Bacteria 3916
82 Ga0068859_100082117 3300005617 Bacteria 3266
83 Ga0068859_100658564 3300005617 Bacteria 1139
84 Ga0068864_100111827 3300005618 Bacteria 2434
85 Ga0068864_100210599 3300005618 Bacteria 1790
86 Ga0068866_10061851 3300005718 Bacteria 1946
87 Ga0068866_10847435 3300005718 Bacteria 639
88 Ga0068861_100590947 3300005719 Bacteria 1017
89 Ga0068851_10195943 3300005834 Bacteria 1125
90 Ga0068870_10063059 3300005840 Bacteria 1998
91 Ga0068870_10634843 3300005840 Bacteria 730
92 Ga0068858_100131091 3300005842 Bacteria 2351
93 Ga0068858_100208667 3300005842 Bacteria 1848
94 Ga0068858_100340315 3300005842 Bacteria 1436
95 Ga0068858_100572270 3300005842 Bacteria 1094
96 Ga0068858_100654968 3300005842 Bacteria 1020
97 Ga0068860_100025783 3300005843 Bacteria 5671
98 Ga0068860_100114570 3300005843 Bacteria 2578
99 Ga0068860_100148707 3300005843 Bacteria 2255
100 Ga0068860_100172596 3300005843 Bacteria 2089
101 Ga0068862_100089143 3300005844 Bacteria 2684
102 Ga0068862_100190200 3300005844 Bacteria 1846
103 Ga0081455_10016840 3300005937 Bacteria 7030
104 Ga0081455_10017511 3300005937 Bacteria 6865
105 Ga0081455_10032868 3300005937 Bacteria 4669
106 Ga0081538_10006408 3300005981 Bacteria 10370
107 Ga0081538_10123309 3300005981 Bacteria 1239
108 Ga0081540_1002180 3300005983 Bacteria 16191
109 Ga0081540_1010873 3300005983 Bacteria 6112
110 Ga0081539_10029920 3300005985 Bacteria 3392
111 Ga0070717_10130219 3300006028 Bacteria 2163
112 Ga0070717_10879118 3300006028 Bacteria 816
113 Ga0075365_10005149 3300006038 Bacteria 7025
114 Ga0075365_10240803 3300006038 Bacteria 1271
115 Ga0075368_10195195 3300006042 Bacteria 856
116 Ga0075363_100000375 3300006048 Bacteria 13473
117 Ga0075363_100070719 3300006048 Bacteria 1895
118 Ga0075364_10019971 3300006051 Bacteria 4211
119 Ga0075364_10223204 3300006051 Bacteria 1279
120 Ga0075364_10437799 3300006051 Bacteria 893
121 Ga0070715_10145448 3300006163 Bacteria 1156
122 Ga0070712_100054961 3300006175 Bacteria 2786
123 Ga0075362_10117658 3300006177 Bacteria 1256
124 Ga0075362_10461486 3300006177 Bacteria 646
125 Ga0075367_10000828 3300006178 Bacteria 12261
126 Ga0075367_10027217 3300006178 Bacteria 3251
127 Ga0075367_10097895 3300006178 Bacteria 1790
128 Ga0075367_10170235 3300006178 Bacteria 1357
129 Ga0075367_10460209 3300006178 Bacteria 806
130 Ga0075366_10422123 3300006195 Bacteria 822
131 Ga0097621_100244053 3300006237 Bacteria 1571
132 Ga0097621_100661747 3300006237 Bacteria 959
133 Ga0075370_10148493 3300006353 Bacteria 1373
134 Ga0068871_100080426 3300006358 Bacteria 2698
135 Ga0068871_100419140 3300006358 Bacteria 1195
136 Ga0068871_100897571 3300006358 Bacteria 821
137 Ga0075428_100046895 3300006844 Bacteria 4746
138 Ga0075431_100862673 3300006847 Bacteria 876
139 Ga0075429_100559479 3300006880 Bacteria 1002
140 Ga0097620_100057551 3300006931 Bacteria 3916
141 Ga0097620_100082116 3300006931 Bacteria 3266
142 Ga0097620_100658598 3300006931 Bacteria 1139
143 Ga0099794_10005171 3300007265 Bacteria 5211
144 Ga0099795_10083603 3300007788 Bacteria 1226
145 Ga0105250_10021510 3300009092 Bacteria 2603
146 Ga0105240_10216231 3300009093 Bacteria 2236
147 Ga0105245_10015200 3300009098 Bacteria 6706
148 Ga0105245_10043608 3300009098 Bacteria 4001
149 Ga0105245_10307123 3300009098 Bacteria 1558
150 Ga0105247_10006387 3300009101 Bacteria 7297
151 Ga0105247_10012925 3300009101 Bacteria 5007
152 Ga0105247_10023391 3300009101 Bacteria 3723
153 Ga0105247_10036856 3300009101 Bacteria 2981
154 Ga0105247_10060579 3300009101 Bacteria 2346
155 Ga0105247_10348706 3300009101 Bacteria 1040
156 Ga0114129_10578648 3300009147 Bacteria 1457
157 Ga0105243_10218850 3300009148 Bacteria 1682
158 Ga0105243_10422295 3300009148 Bacteria 1244
159 Ga0105243_10744116 3300009148 Bacteria 960
160 Ga0105243_10932950 3300009148 Bacteria 866
161 Ga0105241_10237471 3300009174 Bacteria 1539
162 Ga0105241_10313705 3300009174 Bacteria 1350
163 Ga0105241_10556385 3300009174 Bacteria 1031
164 Ga0105242_10043753 3300009176 Bacteria 3624
165 Ga0105242_10080089 3300009176 Bacteria 2729
166 Ga0105242_10238690 3300009176 Bacteria 1633
167 Ga0105242_11232173 3300009176 Bacteria 769
168 Ga0105248_10027402 3300009177 Bacteria 6344
169 Ga0105248_10176749 3300009177 Bacteria 2405
170 Ga0105237_10052207 3300009545 Bacteria 4105
171 Ga0105237_10100816 3300009545 Bacteria 2879
172 Ga0105237_10724954 3300009545 Bacteria 1001
173 Ga0105238_10054889 3300009551 Bacteria 4001
174 Ga0105238_10105529 3300009551 Bacteria 2799
175 Ga0105238_10204894 3300009551 Bacteria 1948
176 Ga0105238_10280155 3300009551 Bacteria 1648
177 Ga0105238_10805491 3300009551 Bacteria 955
178 Ga0105249_10089305 3300009553 Bacteria 2880
179 Ga0105249_10318517 3300009553 Bacteria 1566
180 Ga0099796_10040295 3300010159 Bacteria 1576
181 Ga0105239_10032367 3300010375 Bacteria 5747
182 Ga0105239_10175600 3300010375 Bacteria 2396
183 Ga0105239_10178193 3300010375 Bacteria 2377
184 Ga0105246_10004429 3300011119 Bacteria 8548
185 Ga0105246_10058891 3300011119 Bacteria 2663
186 Ga0157370_10001125 3300013104 Bacteria 33417
187 Ga0157374_10023630 3300013296 Bacteria 5500
188 Ga0157374_10026474 3300013296 Bacteria 5219
189 Ga0157378_10046030 3300013297 Bacteria 3879
190 Ga0157378_10065272 3300013297 Bacteria 3258
191 Ga0163162_10011192 3300013306 Bacteria 8744
192 Ga0163162_10052256 3300013306 Bacteria 4104
193 Ga0163162_10108687 3300013306 Bacteria 2870
194 Ga0163162_10232244 3300013306 Bacteria 1975
195 Ga0157372_11595992 3300013307 Bacteria 751
196 Ga0157375_10138003 3300013308 Bacteria 2564
197 Ga0157375_10201588 3300013308 Bacteria 2146
198 Ga0157375_10291685 3300013308 Bacteria 1794
199 Ga0163163_10053815 3300014325 Bacteria 3975
200 Ga0163163_10081028 3300014325 Bacteria 3247
201 Ga0163163_10130725 3300014325 Bacteria 2551
202 Ga0163163_10244123 3300014325 Bacteria 1846
203 Ga0163163_10660445 3300014325 Bacteria 1109
204 Ga0163163_10808603 3300014325 Bacteria 1001
205 Ga0157380_10371334 3300014326 Bacteria 1346
206 Ga0157379_10154538 3300014968 Bacteria 2070
207 Ga0157379_10164142 3300014968 Bacteria 2005
208 Ga0157379_10995457 3300014968 Bacteria 799
209 Ga0157376_10005970 3300014969 Bacteria 8556
210 Ga0157376_10017754 3300014969 Bacteria 5437
211 Ga0157376_10320687 3300014969 Bacteria 1473
212 Ga0157376_10587845 3300014969 Bacteria 1107
213 Ga0209758_1000131 3300025297 Bacteria 184259
214 Ga0209758_1001774 3300025297 Bacteria 23930
215 Ga0209758_1089976 3300025297 Bacteria 901
216 Ga0207697_10050535 3300025315 Bacteria 1717
217 Ga0207697_10133232 3300025315 Bacteria 1075
218 Ga0207656_10048851 3300025321 Bacteria 1823
219 Ga0207642_10131126 3300025899 Bacteria 1308
220 Ga0207710_10045467 3300025900 Bacteria 1958
221 Ga0207710_10118004 3300025900 Bacteria 1265
222 Ga0207710_10250401 3300025900 Bacteria 885
223 Ga0207688_10018216 3300025901 Bacteria 3823
224 Ga0207685_10258472 3300025905 Bacteria 845
225 Ga0207643_10047222 3300025908 Bacteria 2435
226 Ga0207705_10024368 3300025909 Bacteria 4319
227 Ga0207684_10338312 3300025910 Bacteria 1296
228 Ga0207654_10143679 3300025911 Bacteria 1524
229 Ga0207654_10994000 3300025911 Bacteria 610
230 Ga0207671_10077703 3300025914 Bacteria 2485
231 Ga0207671_10149455 3300025914 Bacteria 1804
232 Ga0207693_10016307 3300025915 Bacteria 5940
233 Ga0207693_10133197 3300025915 Bacteria 1954
234 Ga0207657_10131256 3300025919 Bacteria 2053
235 Ga0207657_10224640 3300025919 Bacteria 1503
236 Ga0207694_10031943 3300025924 Bacteria 4025
237 Ga0207694_10207948 3300025924 Bacteria 1594
238 Ga0207694_10305048 3300025924 Bacteria 1311
239 Ga0207650_10896297 3300025925 Bacteria 753
240 Ga0207659_10313159 3300025926 Bacteria 1293
241 Ga0207687_10004854 3300025927 Bacteria 8938
242 Ga0207687_10055381 3300025927 Bacteria 2779
243 Ga0207700_10032377 3300025928 Bacteria 3729
244 Ga0207700_10047022 3300025928 Bacteria 3196
245 Ga0207664_11381350 3300025929 Bacteria 625
246 Ga0207644_10058299 3300025931 Bacteria 2791
247 Ga0207644_10150386 3300025931 Bacteria 1801
248 Ga0207690_10103962 3300025932 Bacteria 2034
249 Ga0207706_10039536 3300025933 Bacteria 4183
250 Ga0207706_10446595 3300025933 Bacteria 1119
251 Ga0207686_10028759 3300025934 Bacteria 3271
252 Ga0207686_10037055 3300025934 Bacteria 2941
253 Ga0207686_10328693 3300025934 Bacteria 1145
254 Ga0207709_10025858 3300025935 Bacteria 3365
255 Ga0207670_11035705 3300025936 Bacteria 691
256 Ga0207669_10153419 3300025937 Bacteria 1617
257 Ga0207704_10267146 3300025938 Bacteria 1293
258 Ga0207691_10420383 3300025940 Bacteria 1139
259 Ga0207711_10059759 3300025941 Bacteria 3283
260 Ga0207711_10472088 3300025941 Bacteria 1168
261 Ga0207689_10015218 3300025942 Bacteria 6513
262 Ga0207689_10018847 3300025942 Bacteria 5821
263 Ga0207689_10060786 3300025942 Bacteria 3107
264 Ga0207679_10169118 3300025945 Bacteria 1798
265 Ga0207651_10677371 3300025960 Bacteria 907
266 Ga0207712_10026483 3300025961 Bacteria 3864
267 Ga0207712_10816258 3300025961 Bacteria 820
268 Ga0207668_10015239 3300025972 Bacteria 4771
269 Ga0207668_10067509 3300025972 Bacteria 2539
270 Ga0207668_10437307 3300025972 Bacteria 1113
271 Ga0207668_11258975 3300025972 Bacteria 665
272 Ga0207658_10161314 3300025986 Bacteria 1838
273 Ga0207658_10765304 3300025986 Bacteria 875
274 Ga0207677_10011950 3300026023 Bacteria 4971
275 Ga0207677_10022028 3300026023 Bacteria 3908
276 Ga0207703_10073715 3300026035 Bacteria 2824
277 Ga0207703_10086939 3300026035 Bacteria 2620
278 Ga0207703_10140677 3300026035 Bacteria 2094
279 Ga0207703_10365598 3300026035 Bacteria 1331
280 Ga0207703_10546891 3300026035 Bacteria 1091
281 Ga0207639_10215374 3300026041 Bacteria 1656
282 Ga0207678_10009204 3300026067 Bacteria 8692
283 Ga0207678_10009378 3300026067 Bacteria 8613
284 Ga0207678_10158459 3300026067 Bacteria 1933
285 Ga0207678_10188827 3300026067 Bacteria 1760
286 Ga0207678_10686845 3300026067 Bacteria 900
287 Ga0207708_10170229 3300026075 Bacteria 1725
288 Ga0207708_10539678 3300026075 Bacteria 982
289 Ga0207708_11028549 3300026075 Bacteria 716
290 Ga0207702_10150022 3300026078 Bacteria 2119
291 Ga0207641_10143622 3300026088 Bacteria 2156
292 Ga0207648_10538757 3300026089 Bacteria 1071
293 Ga0207676_10013713 3300026095 Bacteria 5820
294 Ga0207674_10049104 3300026116 Bacteria 4317
295 Ga0207675_100033643 3300026118 Bacteria 4775
296 Ga0207675_100034159 3300026118 Bacteria 4741
297 Ga0207683_10017269 3300026121 Bacteria 6147
298 Ga0207683_10038382 3300026121 Bacteria 4174
299 Ga0207683_10046030 3300026121 Bacteria 3816
300 Ga0207683_10124265 3300026121 Bacteria 2318
301 Ga0207683_10230442 3300026121 Bacteria 1689
302 Ga0207683_11070909 3300026121 Bacteria 748
303 Ga0209179_1001926 3300027512 Bacteria 2685
304 Ga0209588_1003513 3300027671 Bacteria 4354
305 Ga0268266_10002192 3300028379 Bacteria 21357
306 Ga0268266_10018687 3300028379 Bacteria 5906
307 Ga0268266_10049306 3300028379 Bacteria 3611
308 Ga0268266_10152587 3300028379 Bacteria 2083
309 Ga0268266_11356521 3300028379 Bacteria 686
310 Ga0268265_10036510 3300028380 Bacteria 3600
311 Ga0268265_10122498 3300028380 Bacteria 2145
312 Ga0268265_10509637 3300028380 Bacteria 1135
313 Ga0268264_10115152 3300028381 Bacteria 2361
314 Ga0268264_10223867 3300028381 Bacteria 1733
315 Ga0268264_10290520 3300028381 Bacteria 1535
316 Ga0307517_10000042 3300028786 Bacteria 166943
317 Ga0307511_10228549 3300030521 Bacteria 924
318 Ga0307511_10234758 3300030521 Bacteria 902
319 Ga0307512_10221039 3300030522 Bacteria 990
320 Ga0307513_10997572 3300031456 Bacteria 547
321 Ga0307509_10007518 3300031507 Bacteria 14203
322 Ga0307509_10091488 3300031507 Bacteria 3113
323 Ga0307408_100458093 3300031548 Bacteria 1108
324 Ga0307508_10684274 3300031616 Bacteria 634
325 Ga0307516_10000729 3300031730 Bacteria 44867
326 Ga0307516_10126087 3300031730 Bacteria 2345
327 Ga0307516_10346380 3300031730 Bacteria 1152
328 Ga0307516_10565622 3300031730 Bacteria 791
329 Ga0307416_100031310 3300032002 Bacteria 4003
330 Ga0307415_100193446 3300032126 Bacteria 1607
331 Ga0307507_10023803 3300033179 Bacteria 6701
332 Ga0307510_10015257 3300033180 Bacteria 9083
333 Ga0373926_0098674 3300035083 Bacteria 1091
334 Ga0373932_0007661 3300035112 Bacteria 2575
335 Ga0373941_0095690 3300035115 Bacteria 1026
336 Ga0373943_0082604 3300035170 Bacteria 1650
337 Ga0373961_0061533 3300035241 Bacteria 1141
338 Ga0373931_0001003 3300035691 Bacteria 11944
339 Ga0373935_0021768 3300035692 Bacteria 3925
340 Ga0373927_0042091 3300035695 Bacteria 2961
341 Ga0373927_0053631 3300035695 Bacteria 2609
342 Ga0373947_0564155 3300035725 Bacteria 775
343 Ga0373925_0100031 3300037068 Bacteria 2228
344 Ga0373925_0218427 3300037068 Bacteria 1521
345 Ga0373925_0636290 3300037068 Bacteria 879
346 Ga0439465_0083340 3300041413 Bacteria 1087
347 Ga0451853_2186501 3300041512 Bacteria 1114
348 Ga0495603_0035748 3300046455 Bacteria 2983
349 Ga0495590_0126990 3300046457 Bacteria 916
350 Ga0495629_0122714 3300046459 Bacteria 1810
351 Ga0495641_0011068 3300046461 Bacteria 5168
352 Ga0495651_0007218 3300046462 Bacteria 8494
353 Ga0495653_0134454 3300046463 Bacteria 1746
354 Ga0495662_0252829 3300046476 Bacteria 868
355 Ga0495664_0007166 3300046477 Bacteria 6181
356 Ga0495584_0237192 3300046491 Bacteria 927
357 Ga0495585_0059101 3300046492 Bacteria 2114
358 Ga0495594_0033613 3300046499 Bacteria 2789
359 Ga0495583_0095052 3300046506 Bacteria 1279
360 Ga0495620_0041284 3300046515 Bacteria 2025
361 Ga0495620_0225781 3300046515 Bacteria 716
362 Ga0495628_0009485 3300046516 Bacteria 8308
363 Ga0495630_0198264 3300046517 Bacteria 1532
364 Ga0495632_0229571 3300046519 Bacteria 837
365 Ga0495643_0016433 3300046522 Bacteria 4346
366 Ga0495644_0122582 3300046523 Bacteria 989
367 Ga0495644_0128935 3300046523 Bacteria 964
368 Ga0495648_0101315 3300046524 Bacteria 1589
369 Ga0495652_0018755 3300046529 Bacteria 6166
370 Ga0495640_0126110 3300046533 Bacteria 1660
371 Ga0495587_0002427 3300046536 Bacteria 12431
372 Ga0495598_0089890 3300046537 Bacteria 1000
373 Ga0495609_0327891 3300046538 Bacteria 620
374 Ga0495621_0192574 3300046539 Bacteria 818
375 Ga0495645_0598491 3300046543 Unclassified 678
376 Ga0495622_0060997 3300046557 Bacteria 1747
377 Ga0495622_0078632 3300046557 Bacteria 1519
378 Ga0495622_0242131 3300046557 Bacteria 795
379 Ga0495667_0008341 3300046559 Bacteria 7028
380 Ga0495656_0037992 3300046615 Bacteria 1992
381 Ga0495668_0122532 3300046616 Bacteria 1422
382 Ga0495668_0154612 3300046616 Bacteria 1256
383 Ga0495668_0215599 3300046616 Bacteria 1051
384 Ga0495634_0070108 3300046642 Bacteria 2311
385 Ga0495635_0024054 3300046663 Bacteria 4246
386 Ga0495661_0379978 3300046665 Bacteria 690
387 Ga0495588_0033741 3300046674 Bacteria 2586
388 Ga0495657_0004039 3300046675 Bacteria 11767
389 Ga0495599_0044453 3300046678 Bacteria 2785
390 Ga0495623_0013608 3300046679 Bacteria 5273
391 Ga0495658_0200481 3300046683 Bacteria 1244
392 Ga0495669_0026423 3300046684 Bacteria 2537
393 Ga0495669_0030726 3300046684 Bacteria 2358
394 Ga0495669_0066676 3300046684 Bacteria 1635
395 Ga0495669_0145555 3300046684 Bacteria 1120
396 Ga0495671_0065704 3300046692 Bacteria 1785
397 Ga0495671_0233189 3300046692 Bacteria 890
398 Ga0495649_0147401 3300046694 Bacteria 1237
399 Ga0495649_0244032 3300046694 Bacteria 924
400 Ga0495589_0286514 3300046794 Bacteria 765
401 Ga0495600_0001919 3300046809 Bacteria 11672
402 Ga0495604_0007939 3300047317 Bacteria 8405
403 Ga0495674_0125684 3300047319 Bacteria 2164
404 Ga0495674_0676376 3300047319 Bacteria 812
405 Ga0495672_0042863 3300047320 Bacteria 2725
406 Ga0495676_0068889 3300047321 Bacteria 2732
407 Ga0495680_0061337 3300047322 Bacteria 2893
408 Ga0495683_0039377 3300047323 Bacteria 2389
409 Ga0495675_0006467 3300047444 Bacteria 7171
410 Ga0495673_0016536 3300047469 Bacteria 3770
411 Ga0495673_0142096 3300047469 Bacteria 935
412 Ga0495673_0225093 3300047469 Bacteria 693
413 Ga0495686_0230154 3300047472 Bacteria 1050
414 Ga0495602_0008085 3300048088 Bacteria 10991
415 Ga0495626_0186691 3300048091 Bacteria 857
416 Ga0496100_0009577 3300048903 Bacteria 5444
417 Ga0496100_0586782 3300048903 Bacteria 864
418 Ga0496101_0438333 3300048904 Unclassified 1030
419 Ga0496102_0001763 3300048905 Bacteria 18847
420 Ga0496102_0845889 3300048905 Bacteria 837
421 Ga0496103_0037462 3300048906 Bacteria 2972
422 Ga0496104_0004092 3300048907 Bacteria 12653
423 Ga0496104_0117924 3300048907 Bacteria 2547
424 Ga0496104_0200019 3300048907 Bacteria 1910
425 Ga0496104_0394695 3300048907 Bacteria 1296
426 Ga0496105_0098077 3300048908 Bacteria 2420
427 Ga0496105_0653004 3300048908 Bacteria 811
428 Ga0496105_0832693 3300048908 Bacteria 699
429 Ga0496106_0004187 3300048909 Bacteria 10754
430 Ga0496106_0009663 3300048909 Bacteria 7123
431 Ga0496106_0117468 3300048909 Bacteria 2076
432 Ga0496107_0029420 3300048910 Bacteria 3907
433 Ga0496107_0637730 3300048910 Bacteria 786
434 Ga0496108_0026414 3300048911 Bacteria 4788
435 Ga0496108_0086973 3300048911 Bacteria 2654
436 Ga0496108_0132516 3300048911 Bacteria 2142
437 Ga0496109_0018847 3300048912 Bacteria 6072
438 Ga0496109_0018960 3300048912 Bacteria 6058
439 Ga0496109_0019089 3300048912 Bacteria 6038
440 Ga0496109_0122435 3300048912 Bacteria 2424
441 Ga0496109_0247620 3300048912 Bacteria 1678
442 Ga0496110_0019448 3300048913 Bacteria 5715
443 Ga0496110_0039455 3300048913 Bacteria 4111
444 Ga0496110_0258420 3300048913 Bacteria 1585
445 Ga0496111_0023616 3300048914 Bacteria 4319
446 Ga0496111_0030489 3300048914 Bacteria 3835
447 Ga0496111_0110245 3300048914 Bacteria 2027
448 Ga0496112_0011009 3300048915 Bacteria 8242
449 Ga0496112_0172175 3300048915 Bacteria 2130
450 Ga0496112_0172291 3300048915 Bacteria 2129
451 Ga0496112_0281377 3300048915 Bacteria 1610
452 Ga0496113_0034817 3300048916 Bacteria 3677
453 Ga0496113_0388881 3300048916 Bacteria 1120
454 Ga0496113_0512214 3300048916 Bacteria 963
455 Ga0496114_0066497 3300048917 Bacteria 3022
456 Ga0496115_0000894 3300048918 Bacteria 21630
457 Ga0496117_0083197 3300048920 Bacteria 2093
458 Ga0496117_0234098 3300048920 Bacteria 1013
459 Ga0496118_0006821 3300048921 Bacteria 12391
460 Ga0496118_0137150 3300048921 Bacteria 1559
461 Ga0496119_0125383 3300048922 Bacteria 1406
462 Ga0496121_0000218 3300048924 Bacteria 126175
463 Ga0496121_0001057 3300048924 Bacteria 48772
464 Ga0496121_0025795 3300048924 Bacteria 5562
465 Ga0496121_0028119 3300048924 Bacteria 5241
466 Ga0496121_0063690 3300048924 Bacteria 3010
467 Ga0496121_0093871 3300048924 Bacteria 2335
468 Ga0496121_0617767 3300048924 Bacteria 666
469 Ga0496124_0001333 3300048927 Bacteria 37071
470 Ga0496124_0051478 3300048927 Bacteria 3504
471 Ga0496124_0059186 3300048927 Bacteria 3219
472 Ga0496124_0710119 3300048927 Bacteria 636
473 Ga0496125_0030078 3300048928 Bacteria 4865
474 Ga0496125_0054246 3300048928 Bacteria 3278
475 Ga0496125_0055548 3300048928 Bacteria 3225
476 Ga0496126_0001598 3300048929 Bacteria 34515
477 Ga0496126_0001827 3300048929 Bacteria 31077
478 Ga0496126_0015697 3300048929 Bacteria 7610
479 Ga0496126_0051713 3300048929 Bacteria 3738
480 Ga0496126_0069215 3300048929 Bacteria 3149
481 Ga0496126_0105298 3300048929 Bacteria 2463
482 Ga0496126_0285927 3300048929 Bacteria 1365
483 Ga0496126_0405050 3300048929 Bacteria 1105
484 Ga0495682_0084987 3300049460 Bacteria 1137
485 Ga0501032_0005337 3300049569 Bacteria 9563
486 Ga0501032_0017435 3300049569 Bacteria 5044
487 Ga0501032_0025759 3300049569 Bacteria 4053
488 Ga0501033_0000839 3300049570 Bacteria 28060
489 Ga0501034_0141753 3300049571 Bacteria 2382
490 Ga0501036_0020407 3300049572 Bacteria 5565
491 Ga0501037_0000228 3300049573 Bacteria 49067
492 Ga0501037_0039823 3300049573 Bacteria 3458
493 Ga0501038_0001410 3300049574 Bacteria 22000
494 Ga0501038_0349453 3300049574 Bacteria 1152
495 Ga0501039_0007392 3300049575 Bacteria 8376
496 Ga0501039_1095329 3300049575 Unclassified 617
497 Ga0501040_0003410 3300049576 Bacteria 10252
498 Ga0501042_0106261 3300049578 Bacteria 2020
499 Ga0501042_0139074 3300049578 Bacteria 1750
500 Ga0501043_0052890 3300049579 Bacteria 3189
501 Ga0501046_0034106 3300049580 Bacteria 4109
502 Ga0501047_0264915 3300049581 Bacteria 1565
503 Ga0501048_0006568 3300049582 Bacteria 8838
504 Ga0501067_0001927 3300049583 Bacteria 11406
505 Ga0501067_0052670 3300049583 Bacteria 2255
506 Ga0501068_0016702 3300049584 Bacteria 4234
507 Ga0501068_0306000 3300049584 Bacteria 1018
508 Ga0501070_0025761 3300049586 Bacteria 4934
509 Ga0501074_0063118 3300049590 Bacteria 2668
510 Ga0501076_0526022 3300049592 Bacteria 975
511 Ga0501079_0091044 3300049741 Bacteria 2363
512 Ga0501080_0010763 3300049742 Bacteria 8370
513 Ga0501083_0026488 3300049744 Bacteria 4007
514 Ga0501035_0001120 3300049822 Bacteria 28018
515 Ga0501035_0261275 3300049822 Bacteria 1467
516 Ga0501044_0016887 3300049823 Bacteria 7831
517 Ga0501044_0033578 3300049823 Bacteria 5391
518 Ga0501044_0071513 3300049823 Bacteria 3527
519 Ga0501044_0197047 3300049823 Bacteria 1973
520 Ga0501045_0007603 3300049824 Bacteria 7531
521 nmdc:mga03n38_66_c1 3300050490 Bacteria 22277
522 nmdc:mga00v17_279418_c1 3300050491 Bacteria 1084
523 nmdc:mga00v17_372259_c1 3300050491 Bacteria 929
524 nmdc:mga0yw44_3810_c1 3300050492 Bacteria 6774
525 nmdc:mga0k408_231215_c1 3300050493 Bacteria 1104
526 nmdc:mga0k408_310938_c1 3300050493 Bacteria 940
527 nmdc:mga0k408_47377_c1 3300050493 Bacteria 2484
528 nmdc:mga06z11_155365_c1 3300050494 Bacteria 1304
529 nmdc:mga06z11_19244_c1 3300050494 Bacteria 3135
530 nmdc:mga06z11_23466_c1 3300050494 Bacteria 2898
531 nmdc:mga06z11_487238_c1 3300050494 Bacteria 746
532 nmdc:mga04h51_116292_c1 3300050495 Bacteria 991
533 nmdc:mga07m45_104679_c1 3300050496 Bacteria 1627
534 nmdc:mga05p37_1684953_c1 3300050507 Bacteria 619
535 nmdc:mga05p37_332830_c1 3300050507 Bacteria 1793
536 nmdc:mga0n895_264413_c1 3300050512 Bacteria 1745
537 nmdc:mga0sz30_37334_c1 3300050516 Bacteria 2033
538 Ga0495601_0557023 3300053077 Unclassified 737
539 Ga0500610_0210621 3300053079 Bacteria 929
540 Ga0500635_0003477 3300053080 Bacteria 3968
541 Ga0495655_0002281 3300053083 Bacteria 3031
542 Ga0500646_0028254 3300053090 Bacteria 1531
543 Ga0500583_0396860 3300053092 Bacteria 662
544 Ga0500566_0103001 3300053094 Bacteria 1562
545 Ga0500641_0000805 3300053096 Bacteria 11318
546 Ga0500650_0058420 3300053098 Bacteria 1799
547 Ga0500562_055763 3300053108 Bacteria 1059
548 Ga0500595_019098 3300053119 Bacteria 2493
549 Ga0500595_019716 3300053119 Bacteria 2441
550 Ga0500595_091965 3300053119 Bacteria 877
551 Ga0500621_139816 3300053126 Bacteria 920
552 Ga0500642_0064924 3300053130 Bacteria 1649
553 Ga0500642_0101260 3300053130 Bacteria 1340
554 Ga0500655_012355 3300053133 Bacteria 1552
555 Ga0500633_0329052 3300053160 Bacteria 559
556 Ga0500636_0117136 3300053177 Bacteria 1498
557 Ga0500637_0065768 3300053178 Bacteria 2080
558 Ga0500645_022331 3300053730 Bacteria 1947
559 Ga0501084_0027686 3300054114 Bacteria 4736
560 Ga0097621_100343888
561 rootL2_10082123
562 rootH1_10299528
563 JGI25405J52794_10019163
564 Ga0070658_10009817
565 Ga0070683_100109711
566 Ga0070683_101466382
567 Ga0070670_100219173
568 Ga0070670_100316967
569 Ga0068869_100027560
570 Ga0068869_100156782
571 Ga0068869_100167256
572 Ga0070680_100414440
573 Ga0070680_100549994
574 Ga0070682_100089108
575 Ga0070682_100386628
576 Ga0068868_100052901
577 Ga0068868_100280273
578 Ga0070689_101093883
579 Ga0070691_10453155
580 Ga0070661_100100848
581 Ga0070692_10158759
582 Ga0070668_100008471
583 Ga0070668_100034222
584 Ga0070668_100198958
585 Ga0070669_100058899
586 Ga0070669_100425075
587 Ga0070675_100122063
588 Ga0070671_100030926
589 Ga0070671_100046629
590 Ga0070671_100274281
591 Ga0070673_100686104
592 Ga0070688_100084334
593 Ga0070688_100608426
594 Ga0070659_100131294
595 Ga0070659_101489257
596 Ga0070667_100053615
597 Ga0070667_100883341
598 Ga0070703_10009501
599 Ga0070714_101003884
600 Ga0070714_101507475
601 Ga0070713_100052262
602 Ga0070713_100703408
603 Ga0070711_100492829
604 Ga0070700_100094667
605 Ga0070700_100120952
606 Ga0070700_100539459
607 Ga0070663_100013006
608 Ga0070663_100015608
609 Ga0070663_100321711
610 Ga0070678_100029254
611 Ga0070678_100041571
612 Ga0070678_100091222
613 Ga0070678_100221161
614 Ga0070662_100037967
615 Ga0070662_100157478
616 Ga0070698_100076093
617 Ga0070698_100076261
618 Ga0070699_100030945
619 Ga0070684_100014162
620 Ga0070697_100311706
621 Ga0068853_100023084
622 Ga0068853_100260887
623 Ga0070672_100141612
624 Ga0070672_100420918
625 Ga0070686_100707889
626 Ga0070693_100195120
627 Ga0070693_100236362
628 Ga0070665_100002210
629 Ga0070665_100053120
630 Ga0070665_100085997
631 Ga0070665_100160044
632 Ga0070665_100246334
633 Ga0070665_101520217
634 Ga0068855_100608271
635 Ga0070664_100079022
636 Ga0070664_100235291
637 Ga0068854_100892388
638 Ga0068856_100287615
639 Ga0068852_100192198
640 Ga0068859_100057553
641 Ga0068859_100082117
642 Ga0068859_100658564
643 Ga0068864_100111827
644 Ga0068864_100210599
645 Ga0068866_10061851
646 Ga0068866_10847435
647 Ga0068861_100590947
648 Ga0068851_10195943
649 Ga0068870_10063059
650 Ga0068870_10634843
651 Ga0068858_100131091
652 Ga0068858_100208667
653 Ga0068858_100340315
654 Ga0068858_100572270
655 Ga0068858_100654968
656 Ga0068860_100025783
657 Ga0068860_100114570
658 Ga0068860_100148707
659 Ga0068860_100172596
660 Ga0068862_100089143
661 Ga0068862_100190200
662 Ga0081455_10016840
663 Ga0081455_10017511
664 Ga0081455_10032868
665 Ga0081538_10006408
666 Ga0081538_10123309
667 Ga0081540_1002180
668 Ga0081540_1010873
669 Ga0081539_10029920
670 Ga0070717_10130219
671 Ga0070717_10879118
672 Ga0075365_10005149
673 Ga0075365_10240803
674 Ga0075368_10195195
675 Ga0075363_100000375
676 Ga0075363_100070719
677 Ga0075364_10019971
678 Ga0075364_10223204
679 Ga0075364_10437799
680 Ga0070715_10145448
681 Ga0070712_100054961
682 Ga0075362_10117658
683 Ga0075362_10461486
684 Ga0075367_10000828
685 Ga0075367_10027217
686 Ga0075367_10097895
687 Ga0075367_10170235
688 Ga0075367_10460209
689 Ga0075366_10422123
690 Ga0097621_100244053
691 Ga0097621_100661747
692 Ga0075370_10148493
693 Ga0068871_100080426
694 Ga0068871_100419140
695 Ga0068871_100897571
696 Ga0075428_100046895
697 Ga0075431_100862673
698 Ga0075429_100559479
699 Ga0097620_100057551
700 Ga0097620_100082116
701 Ga0097620_100658598
702 Ga0099794_10005171
703 Ga0099795_10083603
704 Ga0105250_10021510
705 Ga0105240_10216231
706 Ga0105245_10015200
707 Ga0105245_10043608
708 Ga0105245_10307123
709 Ga0105247_10006387
710 Ga0105247_10012925
711 Ga0105247_10023391
712 Ga0105247_10036856
713 Ga0105247_10060579
714 Ga0105247_10348706
715 Ga0114129_10578648
716 Ga0105243_10218850
717 Ga0105243_10422295
718 Ga0105243_10744116
719 Ga0105243_10932950
720 Ga0105241_10237471
721 Ga0105241_10313705
722 Ga0105241_10556385
723 Ga0105242_10043753
724 Ga0105242_10080089
725 Ga0105242_10238690
726 Ga0105242_11232173
727 Ga0105248_10027402
728 Ga0105248_10176749
729 Ga0105237_10052207
730 Ga0105237_10100816
731 Ga0105237_10724954
732 Ga0105238_10054889
733 Ga0105238_10105529
734 Ga0105238_10204894
735 Ga0105238_10280155
736 Ga0105238_10805491
737 Ga0105249_10089305
738 Ga0105249_10318517
739 Ga0099796_10040295
740 Ga0105239_10032367
741 Ga0105239_10175600
742 Ga0105239_10178193
743 Ga0105246_10004429
744 Ga0105246_10058891
745 Ga0157370_10001125
746 Ga0157374_10023630
747 Ga0157374_10026474
748 Ga0157378_10046030
749 Ga0157378_10065272
750 Ga0163162_10011192
751 Ga0163162_10052256
752 Ga0163162_10108687
753 Ga0163162_10232244
754 Ga0157372_11595992
755 Ga0157375_10138003
756 Ga0157375_10201588
757 Ga0157375_10291685
758 Ga0163163_10053815
759 Ga0163163_10081028
760 Ga0163163_10130725
761 Ga0163163_10244123
762 Ga0163163_10660445
763 Ga0163163_10808603
764 Ga0157380_10371334
765 Ga0157379_10154538
766 Ga0157379_10164142
767 Ga0157379_10995457
768 Ga0157376_10005970
769 Ga0157376_10017754
770 Ga0157376_10320687
771 Ga0157376_10587845
772 Ga0209758_1000131
773 Ga0209758_1001774
774 Ga0209758_1089976
775 Ga0207697_10050535
776 Ga0207697_10133232
777 Ga0207656_10048851
778 Ga0207642_10131126
779 Ga0207710_10045467
780 Ga0207710_10118004
781 Ga0207710_10250401
782 Ga0207688_10018216
783 Ga0207685_10258472
784 Ga0207643_10047222
785 Ga0207705_10024368
786 Ga0207684_10338312
787 Ga0207654_10143679
788 Ga0207654_10994000
789 Ga0207671_10077703
790 Ga0207671_10149455
791 Ga0207693_10016307
792 Ga0207693_10133197
793 Ga0207657_10131256
794 Ga0207657_10224640
795 Ga0207694_10031943
796 Ga0207694_10207948
797 Ga0207694_10305048
798 Ga0207650_10896297
799 Ga0207659_10313159
800 Ga0207687_10004854
801 Ga0207687_10055381
802 Ga0207700_10032377
803 Ga0207700_10047022
804 Ga0207664_11381350
805 Ga0207644_10058299
806 Ga0207644_10150386
807 Ga0207690_10103962
808 Ga0207706_10039536
809 Ga0207706_10446595
810 Ga0207686_10028759
811 Ga0207686_10037055
812 Ga0207686_10328693
813 Ga0207709_10025858
814 Ga0207670_11035705
815 Ga0207669_10153419
816 Ga0207704_10267146
817 Ga0207691_10420383
818 Ga0207711_10059759
819 Ga0207711_10472088
820 Ga0207689_10015218
821 Ga0207689_10018847
822 Ga0207689_10060786
823 Ga0207679_10169118
824 Ga0207651_10677371
825 Ga0207712_10026483
826 Ga0207712_10816258
827 Ga0207668_10015239
828 Ga0207668_10067509
829 Ga0207668_10437307
830 Ga0207668_11258975
831 Ga0207658_10161314
832 Ga0207658_10765304
833 Ga0207677_10011950
834 Ga0207677_10022028
835 Ga0207703_10073715
836 Ga0207703_10086939
837 Ga0207703_10140677
838 Ga0207703_10365598
839 Ga0207703_10546891
840 Ga0207639_10215374
841 Ga0207678_10009204
842 Ga0207678_10009378
843 Ga0207678_10158459
844 Ga0207678_10188827
845 Ga0207678_10686845
846 Ga0207708_10170229
847 Ga0207708_10539678
848 Ga0207708_11028549
849 Ga0207702_10150022
850 Ga0207641_10143622
851 Ga0207648_10538757
852 Ga0207676_10013713
853 Ga0207674_10049104
854 Ga0207675_100033643
855 Ga0207675_100034159
856 Ga0207683_10017269
857 Ga0207683_10038382
858 Ga0207683_10046030
859 Ga0207683_10124265
860 Ga0207683_10230442
861 Ga0207683_11070909
862 Ga0209179_1001926
863 Ga0209588_1003513
864 Ga0268266_10002192
865 Ga0268266_10018687
866 Ga0268266_10049306
867 Ga0268266_10152587
868 Ga0268266_11356521
869 Ga0268265_10036510
870 Ga0268265_10122498
871 Ga0268265_10509637
872 Ga0268264_10115152
873 Ga0268264_10223867
874 Ga0268264_10290520
875 Ga0307517_10000042
876 Ga0307511_10228549
877 Ga0307511_10234758
878 Ga0307512_10221039
879 Ga0307513_10997572
880 Ga0307509_10007518
881 Ga0307509_10091488
882 Ga0307408_100458093
883 Ga0307508_10684274
884 Ga0307516_10000729
885 Ga0307516_10126087
886 Ga0307516_10346380
887 Ga0307516_10565622
888 Ga0307416_100031310
889 Ga0307415_100193446
890 Ga0307507_10023803
891 Ga0307510_10015257
892 Ga0373926_0098674
893 Ga0373932_0007661
894 Ga0373941_0095690
895 Ga0373943_0082604
896 Ga0373961_0061533
897 Ga0373931_0001003
898 Ga0373935_0021768
899 Ga0373927_0042091
900 Ga0373927_0053631
901 Ga0373947_0564155
902 Ga0373925_0100031
903 Ga0373925_0218427
904 Ga0373925_0636290
905 Ga0439465_0083340
906 Ga0451853_2186501
907 Ga0495603_0035748
908 Ga0495590_0126990
909 Ga0495629_0122714
910 Ga0495641_0011068
911 Ga0495651_0007218
912 Ga0495653_0134454
913 Ga0495662_0252829
914 Ga0495664_0007166
915 Ga0495584_0237192
916 Ga0495585_0059101
917 Ga0495594_0033613
918 Ga0495583_0095052
919 Ga0495620_0041284
920 Ga0495620_0225781
921 Ga0495628_0009485
922 Ga0495630_0198264
923 Ga0495632_0229571
924 Ga0495643_0016433
925 Ga0495644_0122582
926 Ga0495644_0128935
927 Ga0495648_0101315
928 Ga0495652_0018755
929 Ga0495640_0126110
930 Ga0495587_0002427
931 Ga0495598_0089890
932 Ga0495609_0327891
933 Ga0495621_0192574
934 Ga0495645_0598491
935 Ga0495622_0060997
936 Ga0495622_0078632
937 Ga0495622_0242131
938 Ga0495667_0008341
939 Ga0495656_0037992
940 Ga0495668_0122532
941 Ga0495668_0154612
942 Ga0495668_0215599
943 Ga0495634_0070108
944 Ga0495635_0024054
945 Ga0495661_0379978
946 Ga0495588_0033741
947 Ga0495657_0004039
948 Ga0495599_0044453
949 Ga0495623_0013608
950 Ga0495658_0200481
951 Ga0495669_0026423
952 Ga0495669_0030726
953 Ga0495669_0066676
954 Ga0495669_0145555
955 Ga0495671_0065704
956 Ga0495671_0233189
957 Ga0495649_0147401
958 Ga0495649_0244032
959 Ga0495589_0286514
960 Ga0495600_0001919
961 Ga0495604_0007939
962 Ga0495674_0125684
963 Ga0495674_0676376
964 Ga0495672_0042863
965 Ga0495676_0068889
966 Ga0495680_0061337
967 Ga0495683_0039377
968 Ga0495675_0006467
969 Ga0495673_0016536
970 Ga0495673_0142096
971 Ga0495673_0225093
972 Ga0495686_0230154
973 Ga0495602_0008085
974 Ga0495626_0186691
975 Ga0496100_0009577
976 Ga0496100_0586782
977 Ga0496101_0438333
978 Ga0496102_0001763
979 Ga0496102_0845889
980 Ga0496103_0037462
981 Ga0496104_0004092
982 Ga0496104_0117924
983 Ga0496104_0200019
984 Ga0496104_0394695
985 Ga0496105_0098077
986 Ga0496105_0653004
987 Ga0496105_0832693
988 Ga0496106_0004187
989 Ga0496106_0009663
990 Ga0496106_0117468
991 Ga0496107_0029420
992 Ga0496107_0637730
993 Ga0496108_0026414
994 Ga0496108_0086973
995 Ga0496108_0132516
996 Ga0496109_0018847
997 Ga0496109_0018960
998 Ga0496109_0019089
999 Ga0496109_0122435
1000 Ga0496109_0247620
1001 Ga0496110_0019448
1002 Ga0496110_0039455
1003 Ga0496110_0258420
1004 Ga0496111_0023616
1005 Ga0496111_0030489
1006 Ga0496111_0110245
1007 Ga0496112_0011009
1008 Ga0496112_0172175
1009 Ga0496112_0172291
1010 Ga0496112_0281377
1011 Ga0496113_0034817
1012 Ga0496113_0388881
1013 Ga0496113_0512214
1014 Ga0496114_0066497
1015 Ga0496115_0000894
1016 Ga0496117_0083197
1017 Ga0496117_0234098
1018 Ga0496118_0006821
1019 Ga0496118_0137150
1020 Ga0496119_0125383
1021 Ga0496121_0000218
1022 Ga0496121_0001057
1023 Ga0496121_0025795
1024 Ga0496121_0028119
1025 Ga0496121_0063690
1026 Ga0496121_0093871
1027 Ga0496121_0617767
1028 Ga0496124_0001333
1029 Ga0496124_0051478
1030 Ga0496124_0059186
1031 Ga0496124_0710119
1032 Ga0496125_0030078
1033 Ga0496125_0054246
1034 Ga0496125_0055548
1035 Ga0496126_0001598
1036 Ga0496126_0001827
1037 Ga0496126_0015697
1038 Ga0496126_0051713
1039 Ga0496126_0069215
1040 Ga0496126_0105298
1041 Ga0496126_0285927
1042 Ga0496126_0405050
1043 Ga0495682_0084987
1044 Ga0501032_0005337
1045 Ga0501032_0017435
1046 Ga0501032_0025759
1047 Ga0501033_0000839
1048 Ga0501034_0141753
1049 Ga0501036_0020407
1050 Ga0501037_0000228
1051 Ga0501037_0039823
1052 Ga0501038_0001410
1053 Ga0501038_0349453
1054 Ga0501039_0007392
1055 Ga0501039_1095329
1056 Ga0501040_0003410
1057 Ga0501042_0106261
1058 Ga0501042_0139074
1059 Ga0501043_0052890
1060 Ga0501046_0034106
1061 Ga0501047_0264915
1062 Ga0501048_0006568
1063 Ga0501067_0001927
1064 Ga0501067_0052670
1065 Ga0501068_0016702
1066 Ga0501068_0306000
1067 Ga0501070_0025761
1068 Ga0501074_0063118
1069 Ga0501076_0526022
1070 Ga0501079_0091044
1071 Ga0501080_0010763
1072 Ga0501083_0026488
1073 Ga0501035_0001120
1074 Ga0501035_0261275
1075 Ga0501044_0016887
1076 Ga0501044_0033578
1077 Ga0501044_0071513
1078 Ga0501044_0197047
1079 Ga0501045_0007603
1080 nmdc:mga03n38_66_c1
1081 nmdc:mga00v17_279418_c1
1082 nmdc:mga00v17_372259_c1
1083 nmdc:mga0yw44_3810_c1
1084 nmdc:mga0k408_231215_c1
1085 nmdc:mga0k408_310938_c1
1086 nmdc:mga0k408_47377_c1
1087 nmdc:mga06z11_155365_c1
1088 nmdc:mga06z11_19244_c1
1089 nmdc:mga06z11_23466_c1
1090 nmdc:mga06z11_487238_c1
1091 nmdc:mga04h51_116292_c1
1092 nmdc:mga07m45_104679_c1
1093 nmdc:mga05p37_1684953_c1
1094 nmdc:mga05p37_332830_c1
1095 nmdc:mga0n895_264413_c1
1096 nmdc:mga0sz30_37334_c1
1097 Ga0495601_0557023
1098 Ga0500610_0210621
1099 Ga0500635_0003477
1100 Ga0495655_0002281
1101 Ga0500646_0028254
1102 Ga0500583_0396860
1103 Ga0500566_0103001
1104 Ga0500641_0000805
1105 Ga0500650_0058420
1106 Ga0500562_055763
1107 Ga0500595_019098
1108 Ga0500595_019716
1109 Ga0500595_091965
1110 Ga0500621_139816
1111 Ga0500642_0064924
1112 Ga0500642_0101260
1113 Ga0500655_012355
1114 Ga0500633_0329052
1115 Ga0500636_0117136
1116 Ga0500637_0065768
1117 Ga0500645_022331
1118 Ga0501084_0027686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

37

154

0.79

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

17

155

0.71

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

68

156

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u5y-assembly1.cif.gz_A crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica 0.9188 8 172
4u5y-assembly1.cif.gz_A crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica 0.8874 8 172
4nxy-assembly1.cif.gz_A crystal structure of the gnat domain of s. lividans pat 0.8843 8 172
4zb3-assembly1.cif.gz_A-2 crystal structure of the apo atnudt7 0.8687 115 176
3f8k-assembly1.cif.gz_A crystal structure of protein acetyltransferase (pat) from sulfolobus solfataricus 0.8633 21 173
ID Description Score Start End Superfamily
af_B8A473_31_155_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.928 71 91 2.60.40.10
4u5yA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9188 8 172 3.40.630.30
af_E7F6N3_74_217_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9084 69 161 3.40.630.30
af_P76594_717_886_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.903 11 178 3.40.630.30
af_P76594_717_886_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.888 11 178 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1I4WH79-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9479 32 173 GO:0016747
AF-A0A1I4WH79-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9415 32 173 GO:0016747
AF-A0A5C9BLP5-F1-model_v4 GCN5-related N-acetyltransferase 0.9381 8 172 GO:0016747
AF-A0A7C7P1W2-F1-model_v4 GNAT family N-acetyltransferase 0.9375 8 172 GO:0005524
GO:0016747
AF-A0A6L4YFE6-F1-model_v4 GCN5-related N-acetyltransferase 0.9357 8 172 GO:0016747

Map