F463521
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 559 | 364 | 556 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300003215|JGI25153J46596_10003511|JGI25153J46596_100035111 |
| Length | 234 |
| Sequence | MKARPAPDQHPGPMNHAWRLNPATMTEDGAYVSGHEALSSPMSVPKILVFAGSIRTGSFNARLAALAAKELATAGAEVTRLSLEDYPLPLYDGDEEQNNGAPAHAQNLKSMMAAHQGVFIASPEYNASVTPLLKNAIDWISRVRARDEAPLAAFKHRVFAIGGASNSPYGALRSLMALRQILELGCGALVLPEQITVFHASEAFDEMDNLKDERAAATLKRIALRLIETAQEFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 2 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 3 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 191 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 192 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 194 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 195 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 206 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 341 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 357 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 358 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 359 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 362 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.46 |
| Metatranscriptomes | 0 |
| Isolates | 0.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.16 |
| Nodule | 0.36 |
| Rhizoplane | 5.55 |
| Rhizosphere | 86.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10009031 | 3300001991 | Bacteria | 1760 |
| 2 | JGI24750J21931_1026476 | 3300002070 | Bacteria | 836 |
| 3 | JGI24748J21848_1014063 | 3300002074 | Bacteria | 949 |
| 4 | JGI24738J21930_10008382 | 3300002075 | Bacteria | 2353 |
| 5 | JGI24034J26672_10023034 | 3300002239 | Bacteria | 987 |
| 6 | JGI24742J22300_10016360 | 3300002244 | Bacteria | 1251 |
| 7 | JGI25153J46596_10003511 | 3300003215 | Bacteria | 8751 |
| 8 | rootH1_10340175 | 3300003323 | Bacteria | 1404 |
| 9 | JGI25404J52841_10005112 | 3300003659 | Bacteria | 2701 |
| 10 | Ga0070658_10472526 | 3300005327 | Bacteria | 1082 |
| 11 | Ga0070676_10024134 | 3300005328 | Bacteria | 3423 |
| 12 | Ga0070676_10048465 | 3300005328 | Bacteria | 2484 |
| 13 | Ga0070676_10270999 | 3300005328 | Bacteria | 1140 |
| 14 | Ga0070690_100012963 | 3300005330 | Bacteria | 4915 |
| 15 | Ga0070690_100075279 | 3300005330 | Bacteria | 2201 |
| 16 | Ga0070670_100039720 | 3300005331 | Bacteria | 4046 |
| 17 | Ga0070670_100273600 | 3300005331 | Bacteria | 1474 |
| 18 | Ga0068869_100136162 | 3300005334 | Bacteria | 1892 |
| 19 | Ga0068869_100304002 | 3300005334 | Bacteria | 1289 |
| 20 | Ga0070666_10063657 | 3300005335 | Bacteria | 2500 |
| 21 | Ga0070680_100003095 | 3300005336 | Bacteria | 12348 |
| 22 | Ga0070680_100015789 | 3300005336 | Bacteria | 5928 |
| 23 | Ga0070682_100000325 | 3300005337 | Bacteria | 32746 |
| 24 | Ga0070660_100347140 | 3300005339 | Bacteria | 1222 |
| 25 | Ga0070689_100002497 | 3300005340 | Bacteria | 12027 |
| 26 | Ga0070689_100274023 | 3300005340 | Bacteria | 1398 |
| 27 | Ga0070689_100364617 | 3300005340 | Bacteria | 1214 |
| 28 | Ga0070687_100013158 | 3300005343 | Bacteria | 3677 |
| 29 | Ga0070687_100092060 | 3300005343 | Bacteria | 1679 |
| 30 | Ga0070661_100182304 | 3300005344 | Bacteria | 1598 |
| 31 | Ga0070692_10090012 | 3300005345 | Bacteria | 1667 |
| 32 | Ga0070668_100137517 | 3300005347 | Bacteria | 1966 |
| 33 | Ga0070668_100319694 | 3300005347 | Bacteria | 1306 |
| 34 | Ga0070669_100032417 | 3300005353 | Bacteria | 3774 |
| 35 | Ga0070675_100012297 | 3300005354 | Bacteria | 6708 |
| 36 | Ga0070675_100118895 | 3300005354 | Bacteria | 2244 |
| 37 | Ga0070671_100050205 | 3300005355 | Bacteria | 3470 |
| 38 | Ga0070671_100772848 | 3300005355 | Bacteria | 835 |
| 39 | Ga0070674_100067283 | 3300005356 | Bacteria | 2519 |
| 40 | Ga0070688_100030935 | 3300005365 | Bacteria | 3216 |
| 41 | Ga0070688_100110863 | 3300005365 | Bacteria | 1824 |
| 42 | Ga0070659_100069353 | 3300005366 | Bacteria | 2798 |
| 43 | Ga0070659_100124101 | 3300005366 | Bacteria | 2094 |
| 44 | Ga0070667_100338176 | 3300005367 | Bacteria | 1361 |
| 45 | Ga0070709_10094443 | 3300005434 | Bacteria | 1979 |
| 46 | Ga0070714_100468338 | 3300005435 | Bacteria | 1198 |
| 47 | Ga0070714_101231419 | 3300005435 | Unclassified | 730 |
| 48 | Ga0070713_100258687 | 3300005436 | Unclassified | 1590 |
| 49 | Ga0070701_10019160 | 3300005438 | Bacteria | 3230 |
| 50 | Ga0070711_100092376 | 3300005439 | Bacteria | 2184 |
| 51 | Ga0070705_100045847 | 3300005440 | Bacteria | 2518 |
| 52 | Ga0070705_100261519 | 3300005440 | Bacteria | 1221 |
| 53 | Ga0070700_100068127 | 3300005441 | Bacteria | 2262 |
| 54 | Ga0070700_100159793 | 3300005441 | Bacteria | 1550 |
| 55 | Ga0070694_100158349 | 3300005444 | Bacteria | 1659 |
| 56 | Ga0070694_100871311 | 3300005444 | Bacteria | 742 |
| 57 | Ga0070708_100055171 | 3300005445 | Bacteria | 3533 |
| 58 | Ga0070708_100499177 | 3300005445 | Bacteria | 1148 |
| 59 | Ga0070663_100064406 | 3300005455 | Bacteria | 2649 |
| 60 | Ga0070663_100827547 | 3300005455 | Bacteria | 795 |
| 61 | Ga0070678_100096593 | 3300005456 | Bacteria | 2280 |
| 62 | Ga0070678_100293832 | 3300005456 | Bacteria | 1378 |
| 63 | Ga0070681_10035240 | 3300005458 | Bacteria | 5027 |
| 64 | Ga0070681_11233289 | 3300005458 | Bacteria | 670 |
| 65 | Ga0068867_100174763 | 3300005459 | Bacteria | 1703 |
| 66 | Ga0070685_10017184 | 3300005466 | Bacteria | 3869 |
| 67 | Ga0070685_10693474 | 3300005466 | Bacteria | 742 |
| 68 | Ga0070706_101246556 | 3300005467 | Bacteria | 683 |
| 69 | Ga0070707_100310223 | 3300005468 | Bacteria | 1533 |
| 70 | Ga0070698_101200642 | 3300005471 | Bacteria | 708 |
| 71 | Ga0070699_100002955 | 3300005518 | Bacteria | 15110 |
| 72 | Ga0070699_100032876 | 3300005518 | Bacteria | 4481 |
| 73 | Ga0070679_100012384 | 3300005530 | Bacteria | 8149 |
| 74 | Ga0070679_100060942 | 3300005530 | Bacteria | 3761 |
| 75 | Ga0070679_100254907 | 3300005530 | Bacteria | 1710 |
| 76 | Ga0070679_100256870 | 3300005530 | Bacteria | 1703 |
| 77 | Ga0070684_101096479 | 3300005535 | Bacteria | 748 |
| 78 | Ga0070697_100000575 | 3300005536 | Bacteria | 27699 |
| 79 | Ga0070697_101184663 | 3300005536 | Bacteria | 681 |
| 80 | Ga0070697_101208577 | 3300005536 | Bacteria | 674 |
| 81 | Ga0068853_100000927 | 3300005539 | Bacteria | 20513 |
| 82 | Ga0068853_100128934 | 3300005539 | Bacteria | 2262 |
| 83 | Ga0070686_100043848 | 3300005544 | Bacteria | 2808 |
| 84 | Ga0070695_100001268 | 3300005545 | Bacteria | 13912 |
| 85 | Ga0070696_100002501 | 3300005546 | Bacteria | 12179 |
| 86 | Ga0070693_100052489 | 3300005547 | Bacteria | 2338 |
| 87 | Ga0070693_100514913 | 3300005547 | Bacteria | 851 |
| 88 | Ga0070665_100100164 | 3300005548 | Bacteria | 2901 |
| 89 | Ga0068855_100048834 | 3300005563 | Bacteria | 4994 |
| 90 | Ga0070664_100108885 | 3300005564 | Bacteria | 2416 |
| 91 | Ga0068857_100206619 | 3300005577 | Bacteria | 1791 |
| 92 | Ga0068857_100494729 | 3300005577 | Bacteria | 1147 |
| 93 | Ga0068854_100058866 | 3300005578 | Bacteria | 2775 |
| 94 | Ga0068854_100091106 | 3300005578 | Bacteria | 2268 |
| 95 | Ga0068856_100123319 | 3300005614 | Bacteria | 2594 |
| 96 | Ga0068852_100078655 | 3300005616 | Bacteria | 2918 |
| 97 | Ga0068859_100223071 | 3300005617 | Bacteria | 1972 |
| 98 | Ga0068859_100467607 | 3300005617 | Bacteria | 1357 |
| 99 | Ga0068864_100069183 | 3300005618 | Bacteria | 3069 |
| 100 | Ga0068864_100282826 | 3300005618 | Bacteria | 1549 |
| 101 | Ga0068866_10074830 | 3300005718 | Bacteria | 1801 |
| 102 | Ga0068861_100352443 | 3300005719 | Bacteria | 1291 |
| 103 | Ga0068851_10069123 | 3300005834 | Bacteria | 1824 |
| 104 | Ga0068870_10218076 | 3300005840 | Bacteria | 1166 |
| 105 | Ga0068870_10373898 | 3300005840 | Bacteria | 920 |
| 106 | Ga0068863_100202577 | 3300005841 | Bacteria | 1909 |
| 107 | Ga0068858_100370867 | 3300005842 | Bacteria | 1373 |
| 108 | Ga0068860_100160483 | 3300005843 | Bacteria | 2168 |
| 109 | Ga0068862_100366781 | 3300005844 | Bacteria | 1339 |
| 110 | Ga0081455_10033713 | 3300005937 | Bacteria | 4597 |
| 111 | Ga0081540_1000055 | 3300005983 | Bacteria | 122642 |
| 112 | Ga0070717_10223604 | 3300006028 | Bacteria | 1655 |
| 113 | Ga0070717_10288046 | 3300006028 | Bacteria | 1458 |
| 114 | Ga0075365_10023018 | 3300006038 | Bacteria | 3913 |
| 115 | Ga0075365_10073525 | 3300006038 | Bacteria | 2304 |
| 116 | Ga0075368_10030936 | 3300006042 | Bacteria | 2074 |
| 117 | Ga0075368_10047079 | 3300006042 | Bacteria | 1707 |
| 118 | Ga0075368_10069330 | 3300006042 | Bacteria | 1422 |
| 119 | Ga0075363_100050314 | 3300006048 | Bacteria | 2220 |
| 120 | Ga0075363_100107026 | 3300006048 | Bacteria | 1551 |
| 121 | Ga0070715_10016951 | 3300006163 | Bacteria | 2748 |
| 122 | Ga0070716_100072370 | 3300006173 | Bacteria | 2030 |
| 123 | Ga0070716_100526540 | 3300006173 | Bacteria | 877 |
| 124 | Ga0070712_100347611 | 3300006175 | Bacteria | 1213 |
| 125 | Ga0070712_100368640 | 3300006175 | Bacteria | 1180 |
| 126 | Ga0075362_10171586 | 3300006177 | Bacteria | 1048 |
| 127 | Ga0075362_10236541 | 3300006177 | Bacteria | 896 |
| 128 | Ga0075367_10034925 | 3300006178 | Bacteria | 2907 |
| 129 | Ga0075367_10092774 | 3300006178 | Bacteria | 1838 |
| 130 | Ga0075367_10230677 | 3300006178 | Bacteria | 1159 |
| 131 | Ga0075369_10043986 | 3300006186 | Bacteria | 1918 |
| 132 | Ga0075366_10010892 | 3300006195 | Bacteria | 5116 |
| 133 | Ga0075366_10055659 | 3300006195 | Bacteria | 2349 |
| 134 | Ga0075366_10093845 | 3300006195 | Bacteria | 1798 |
| 135 | Ga0097621_100015369 | 3300006237 | Bacteria | 5757 |
| 136 | Ga0075370_10056904 | 3300006353 | Bacteria | 2222 |
| 137 | Ga0075370_10272941 | 3300006353 | Bacteria | 1004 |
| 138 | Ga0068871_100049571 | 3300006358 | Bacteria | 3394 |
| 139 | Ga0075428_101123297 | 3300006844 | Bacteria | 830 |
| 140 | Ga0075430_100051434 | 3300006846 | Bacteria | 3472 |
| 141 | Ga0075430_100081665 | 3300006846 | Bacteria | 2708 |
| 142 | Ga0075431_100004553 | 3300006847 | Bacteria | 13616 |
| 143 | Ga0075431_100009653 | 3300006847 | Bacteria | 9694 |
| 144 | Ga0075434_100102227 | 3300006871 | Bacteria | 2874 |
| 145 | Ga0075434_100222783 | 3300006871 | Bacteria | 1906 |
| 146 | Ga0075429_100002407 | 3300006880 | Bacteria | 15758 |
| 147 | Ga0068865_100290688 | 3300006881 | Bacteria | 1304 |
| 148 | Ga0075436_100001283 | 3300006914 | Bacteria | 17053 |
| 149 | Ga0097620_100223062 | 3300006931 | Bacteria | 1972 |
| 150 | Ga0097620_100467637 | 3300006931 | Bacteria | 1357 |
| 151 | Ga0075435_100021345 | 3300007076 | Bacteria | 4979 |
| 152 | Ga0075435_100038099 | 3300007076 | Bacteria | 3832 |
| 153 | Ga0075435_100181102 | 3300007076 | Bacteria | 1781 |
| 154 | Ga0075435_100213776 | 3300007076 | Bacteria | 1636 |
| 155 | Ga0075435_100493941 | 3300007076 | Bacteria | 1058 |
| 156 | Ga0099794_10008881 | 3300007265 | Bacteria | 4189 |
| 157 | Ga0111539_10000115 | 3300009094 | Bacteria | 88645 |
| 158 | Ga0111539_11186865 | 3300009094 | Unclassified | 887 |
| 159 | Ga0105245_10251526 | 3300009098 | Bacteria | 1717 |
| 160 | Ga0105247_10042175 | 3300009101 | Bacteria | 2793 |
| 161 | Ga0114129_10001209 | 3300009147 | Bacteria | 34278 |
| 162 | Ga0114129_12383619 | 3300009147 | Bacteria | 634 |
| 163 | Ga0105241_10020240 | 3300009174 | Bacteria | 4915 |
| 164 | Ga0105241_10376914 | 3300009174 | Bacteria | 1239 |
| 165 | Ga0105241_10501671 | 3300009174 | Bacteria | 1082 |
| 166 | Ga0105242_10123745 | 3300009176 | Bacteria | 2223 |
| 167 | Ga0105242_10143987 | 3300009176 | Bacteria | 2071 |
| 168 | Ga0105248_10001877 | 3300009177 | Bacteria | 23303 |
| 169 | Ga0105248_10153813 | 3300009177 | Bacteria | 2595 |
| 170 | Ga0105248_10629027 | 3300009177 | Bacteria | 1211 |
| 171 | Ga0105237_10649263 | 3300009545 | Bacteria | 1062 |
| 172 | Ga0105238_10256873 | 3300009551 | Bacteria | 1726 |
| 173 | Ga0105249_10011613 | 3300009553 | Bacteria | 7741 |
| 174 | Ga0105249_10116782 | 3300009553 | Bacteria | 2530 |
| 175 | Ga0105239_11371755 | 3300010375 | Bacteria | 816 |
| 176 | Ga0105246_10440191 | 3300011119 | Bacteria | 1093 |
| 177 | Ga0157373_10004101 | 3300013100 | Bacteria | 10980 |
| 178 | Ga0157370_10083016 | 3300013104 | Bacteria | 3013 |
| 179 | Ga0157378_10737990 | 3300013297 | Bacteria | 1007 |
| 180 | Ga0163162_10946030 | 3300013306 | Bacteria | 973 |
| 181 | Ga0163162_10967588 | 3300013306 | Bacteria | 962 |
| 182 | Ga0157372_10002662 | 3300013307 | Bacteria | 19349 |
| 183 | Ga0157375_10524371 | 3300013308 | Bacteria | 1348 |
| 184 | Ga0157375_10796739 | 3300013308 | Bacteria | 1094 |
| 185 | Ga0163163_10129437 | 3300014325 | Bacteria | 2564 |
| 186 | Ga0163163_10405805 | 3300014325 | Bacteria | 1421 |
| 187 | Ga0157380_10039978 | 3300014326 | Bacteria | 3650 |
| 188 | Ga0157380_10107014 | 3300014326 | Bacteria | 2341 |
| 189 | Ga0157380_10212543 | 3300014326 | Bacteria | 1725 |
| 190 | Ga0157380_10321492 | 3300014326 | Bacteria | 1435 |
| 191 | Ga0182008_10049039 | 3300014497 | Bacteria | 2096 |
| 192 | Ga0157377_10176041 | 3300014745 | Bacteria | 1341 |
| 193 | Ga0157377_10984796 | 3300014745 | Bacteria | 637 |
| 194 | Ga0157379_10364366 | 3300014968 | Bacteria | 1325 |
| 195 | Ga0157376_10739060 | 3300014969 | Bacteria | 992 |
| 196 | Ga0163161_10184409 | 3300017792 | Bacteria | 1602 |
| 197 | Ga0209758_1005755 | 3300025297 | Bacteria | 9322 |
| 198 | Ga0209758_1017976 | 3300025297 | Bacteria | 3490 |
| 199 | Ga0207426_1061834 | 3300025302 | Bacteria | 1074 |
| 200 | Ga0207697_10085266 | 3300025315 | Bacteria | 1334 |
| 201 | Ga0207653_10010065 | 3300025885 | Bacteria | 2950 |
| 202 | Ga0207692_10059981 | 3300025898 | Bacteria | 1966 |
| 203 | Ga0207692_10081593 | 3300025898 | Bacteria | 1731 |
| 204 | Ga0207642_10697826 | 3300025899 | Bacteria | 639 |
| 205 | Ga0207710_10015124 | 3300025900 | Bacteria | 3259 |
| 206 | Ga0207688_10010751 | 3300025901 | Bacteria | 4980 |
| 207 | Ga0207647_10038007 | 3300025904 | Bacteria | 3047 |
| 208 | Ga0207699_10052946 | 3300025906 | Bacteria | 2405 |
| 209 | Ga0207699_10144393 | 3300025906 | Bacteria | 1567 |
| 210 | Ga0207645_10005075 | 3300025907 | Bacteria | 9643 |
| 211 | Ga0207645_10055111 | 3300025907 | Bacteria | 2539 |
| 212 | Ga0207643_10000750 | 3300025908 | Bacteria | 19910 |
| 213 | Ga0207705_10371453 | 3300025909 | Bacteria | 1104 |
| 214 | Ga0207684_10008184 | 3300025910 | Bacteria | 9315 |
| 215 | Ga0207684_10224057 | 3300025910 | Bacteria | 1623 |
| 216 | Ga0207671_10154088 | 3300025914 | Bacteria | 1777 |
| 217 | Ga0207693_10075172 | 3300025915 | Bacteria | 2646 |
| 218 | Ga0207693_10217124 | 3300025915 | Bacteria | 1503 |
| 219 | Ga0207693_10326141 | 3300025915 | Bacteria | 1202 |
| 220 | Ga0207693_10662213 | 3300025915 | Bacteria | 810 |
| 221 | Ga0207663_10039076 | 3300025916 | Bacteria | 2873 |
| 222 | Ga0207660_10522352 | 3300025917 | Bacteria | 964 |
| 223 | Ga0207662_10104128 | 3300025918 | Bacteria | 1762 |
| 224 | Ga0207662_10249088 | 3300025918 | Bacteria | 1165 |
| 225 | Ga0207657_10027857 | 3300025919 | Bacteria | 5167 |
| 226 | Ga0207657_10083020 | 3300025919 | Bacteria | 2688 |
| 227 | Ga0207649_10097941 | 3300025920 | Bacteria | 1935 |
| 228 | Ga0207652_10022341 | 3300025921 | Bacteria | 5232 |
| 229 | Ga0207652_10115663 | 3300025921 | Bacteria | 2382 |
| 230 | Ga0207652_10427474 | 3300025921 | Bacteria | 1194 |
| 231 | Ga0207681_10084609 | 3300025923 | Bacteria | 2249 |
| 232 | Ga0207681_10232934 | 3300025923 | Bacteria | 1430 |
| 233 | Ga0207681_10235750 | 3300025923 | Bacteria | 1422 |
| 234 | Ga0207650_10034322 | 3300025925 | Bacteria | 3679 |
| 235 | Ga0207650_10153059 | 3300025925 | Bacteria | 1821 |
| 236 | Ga0207687_10138128 | 3300025927 | Bacteria | 1846 |
| 237 | Ga0207687_10710358 | 3300025927 | Bacteria | 854 |
| 238 | Ga0207700_10091514 | 3300025928 | Bacteria | 2403 |
| 239 | Ga0207664_10019573 | 3300025929 | Bacteria | 5005 |
| 240 | Ga0207664_10282955 | 3300025929 | Bacteria | 1455 |
| 241 | Ga0207664_10993684 | 3300025929 | Bacteria | 752 |
| 242 | Ga0207644_10044390 | 3300025931 | Bacteria | 3158 |
| 243 | Ga0207690_10087436 | 3300025932 | Bacteria | 2193 |
| 244 | Ga0207690_10427980 | 3300025932 | Bacteria | 1060 |
| 245 | Ga0207706_10001078 | 3300025933 | Bacteria | 27712 |
| 246 | Ga0207670_10041282 | 3300025936 | Bacteria | 3033 |
| 247 | Ga0207665_10240500 | 3300025939 | Bacteria | 1333 |
| 248 | Ga0207665_10635228 | 3300025939 | Bacteria | 836 |
| 249 | Ga0207691_10048712 | 3300025940 | Bacteria | 3883 |
| 250 | Ga0207711_10039770 | 3300025941 | Bacteria | 4000 |
| 251 | Ga0207711_10335528 | 3300025941 | Bacteria | 1399 |
| 252 | Ga0207711_10687679 | 3300025941 | Bacteria | 954 |
| 253 | Ga0207689_10024160 | 3300025942 | Bacteria | 5098 |
| 254 | Ga0207679_10965816 | 3300025945 | Bacteria | 780 |
| 255 | Ga0207667_10058679 | 3300025949 | Bacteria | 4035 |
| 256 | Ga0207712_10010202 | 3300025961 | Bacteria | 5957 |
| 257 | Ga0207712_10086384 | 3300025961 | Bacteria | 2298 |
| 258 | Ga0207668_10066897 | 3300025972 | Bacteria | 2549 |
| 259 | Ga0207668_10082714 | 3300025972 | Bacteria | 2333 |
| 260 | Ga0207668_10222492 | 3300025972 | Bacteria | 1517 |
| 261 | Ga0207668_10268786 | 3300025972 | Bacteria | 1393 |
| 262 | Ga0207640_10050921 | 3300025981 | Bacteria | 2689 |
| 263 | Ga0207640_10714930 | 3300025981 | Bacteria | 860 |
| 264 | Ga0207658_10055253 | 3300025986 | Bacteria | 2942 |
| 265 | Ga0207677_10317562 | 3300026023 | Bacteria | 1293 |
| 266 | Ga0207703_10152965 | 3300026035 | Bacteria | 2013 |
| 267 | Ga0207639_10003746 | 3300026041 | Bacteria | 10232 |
| 268 | Ga0207678_10015782 | 3300026067 | Bacteria | 6639 |
| 269 | Ga0207678_10132268 | 3300026067 | Bacteria | 2129 |
| 270 | Ga0207708_10001622 | 3300026075 | Bacteria | 16749 |
| 271 | Ga0207708_10095246 | 3300026075 | Bacteria | 2299 |
| 272 | Ga0207702_10578073 | 3300026078 | Bacteria | 1101 |
| 273 | Ga0207648_10050674 | 3300026089 | Bacteria | 3630 |
| 274 | Ga0207676_10169336 | 3300026095 | Bacteria | 1901 |
| 275 | Ga0207674_10050397 | 3300026116 | Bacteria | 4253 |
| 276 | Ga0207675_100001067 | 3300026118 | Bacteria | 27209 |
| 277 | Ga0207683_10005165 | 3300026121 | Bacteria | 11207 |
| 278 | Ga0207683_10022355 | 3300026121 | Bacteria | 5428 |
| 279 | Ga0209588_1014647 | 3300027671 | Bacteria | 2403 |
| 280 | Ga0207428_10002405 | 3300027907 | Bacteria | 18695 |
| 281 | Ga0268266_10397313 | 3300028379 | Bacteria | 1303 |
| 282 | Ga0268266_10552514 | 3300028379 | Bacteria | 1103 |
| 283 | Ga0268265_10033539 | 3300028380 | Bacteria | 3734 |
| 284 | Ga0268265_10871062 | 3300028380 | Bacteria | 882 |
| 285 | Ga0268264_10369646 | 3300028381 | Bacteria | 1370 |
| 286 | Ga0316575_10149685 | 3300031665 | Bacteria | 963 |
| 287 | Ga0265314_10039578 | 3300031711 | Bacteria | 3394 |
| 288 | Ga0316578_10096671 | 3300031728 | Bacteria | 1768 |
| 289 | Ga0307413_10193624 | 3300031824 | Bacteria | 1462 |
| 290 | Ga0307409_101447066 | 3300031995 | Bacteria | 714 |
| 291 | Ga0316585_10052198 | 3300032137 | Bacteria | 1314 |
| 292 | Ga0373930_0018118 | 3300034816 | Bacteria | 1350 |
| 293 | Ga0373938_0033522 | 3300034957 | Bacteria | 1111 |
| 294 | Ga0373926_0015325 | 3300035083 | Bacteria | 2613 |
| 295 | Ga0373926_0077305 | 3300035083 | Bacteria | 1228 |
| 296 | Ga0373929_0007021 | 3300035085 | Bacteria | 2048 |
| 297 | Ga0373944_0017827 | 3300035089 | Bacteria | 2020 |
| 298 | Ga0373951_0101775 | 3300035091 | Bacteria | 764 |
| 299 | Ga0373923_0000926 | 3300035111 | Bacteria | 7838 |
| 300 | Ga0373932_0045086 | 3300035112 | Bacteria | 1288 |
| 301 | Ga0373932_0063721 | 3300035112 | Bacteria | 1127 |
| 302 | Ga0373936_0002444 | 3300035113 | Bacteria | 6950 |
| 303 | Ga0373936_0078703 | 3300035113 | Bacteria | 1369 |
| 304 | Ga0373939_0005192 | 3300035114 | Bacteria | 3094 |
| 305 | Ga0373941_0022184 | 3300035115 | Bacteria | 1799 |
| 306 | Ga0373945_0012501 | 3300035116 | Bacteria | 2821 |
| 307 | Ga0373945_0098513 | 3300035116 | Bacteria | 1141 |
| 308 | Ga0373953_0000743 | 3300035117 | Bacteria | 9035 |
| 309 | Ga0373954_0021148 | 3300035118 | Bacteria | 2944 |
| 310 | Ga0373957_0007156 | 3300035120 | Bacteria | 3558 |
| 311 | Ga0373960_0036916 | 3300035121 | Bacteria | 1394 |
| 312 | Ga0373960_0082702 | 3300035121 | Bacteria | 1014 |
| 313 | Ga0373943_0003686 | 3300035170 | Bacteria | 6965 |
| 314 | Ga0373943_0032339 | 3300035170 | Bacteria | 2486 |
| 315 | Ga0373946_0000588 | 3300035171 | Bacteria | 12009 |
| 316 | Ga0373955_0000346 | 3300035172 | Bacteria | 19457 |
| 317 | Ga0373961_0013177 | 3300035241 | Bacteria | 2080 |
| 318 | Ga0316574_0006930 | 3300035398 | Bacteria | 6170 |
| 319 | Ga0316574_0175133 | 3300035398 | Bacteria | 1381 |
| 320 | Ga0373924_0015064 | 3300035410 | Bacteria | 2931 |
| 321 | Ga0373931_0009934 | 3300035691 | Bacteria | 4560 |
| 322 | Ga0373931_0015382 | 3300035691 | Bacteria | 3752 |
| 323 | Ga0373931_0353752 | 3300035691 | Bacteria | 920 |
| 324 | Ga0373935_0000056 | 3300035692 | Bacteria | 46025 |
| 325 | Ga0373935_0397388 | 3300035692 | Bacteria | 989 |
| 326 | Ga0373927_0005062 | 3300035695 | Bacteria | 9123 |
| 327 | Ga0373927_0291200 | 3300035695 | Bacteria | 1074 |
| 328 | Ga0373933_0028287 | 3300035724 | Bacteria | 3233 |
| 329 | Ga0373933_0167144 | 3300035724 | Bacteria | 1399 |
| 330 | Ga0373933_0760332 | 3300035724 | Bacteria | 638 |
| 331 | Ga0373947_0007138 | 3300035725 | Bacteria | 6478 |
| 332 | Ga0373947_0200452 | 3300035725 | Bacteria | 1305 |
| 333 | Ga0373937_0000075 | 3300036401 | Bacteria | 89727 |
| 334 | Ga0316584_0071826 | 3300036712 | Bacteria | 2593 |
| 335 | Ga0373925_0000159 | 3300037068 | Bacteria | 72851 |
| 336 | Ga0373925_0037415 | 3300037068 | Bacteria | 3583 |
| 337 | Ga0395899_0463047 | 3300037312 | Unclassified | 828 |
| 338 | Ga0395898_0718433 | 3300037466 | Bacteria | 941 |
| 339 | Ga0395898_0984529 | 3300037466 | Bacteria | 779 |
| 340 | Ga0395905_0037065 | 3300037471 | Bacteria | 4580 |
| 341 | Ga0436364_0268901 | 3300037853 | Bacteria | 819 |
| 342 | Ga0436364_0880057 | 3300037853 | Bacteria | 1577 |
| 343 | Ga0395901_0182931 | 3300038443 | Bacteria | 2198 |
| 344 | Ga0436361_0109240 | 3300039447 | Bacteria | 8125 |
| 345 | Ga0451807_1895779 | 3300041486 | Bacteria | 1357 |
| 346 | Ga0451837_0444460 | 3300041494 | Bacteria | 856 |
| 347 | Ga0451576_0014115 | 3300045051 | Bacteria | 8903 |
| 348 | Ga0495617_109768 | 3300046452 | Bacteria | 893 |
| 349 | Ga0495627_065943 | 3300046453 | Bacteria | 1064 |
| 350 | Ga0495592_0000102 | 3300046454 | Bacteria | 75767 |
| 351 | Ga0495603_0033794 | 3300046455 | Bacteria | 3076 |
| 352 | Ga0495590_0052249 | 3300046457 | Bacteria | 1428 |
| 353 | Ga0495629_0012813 | 3300046459 | Bacteria | 6068 |
| 354 | Ga0495641_0026393 | 3300046461 | Bacteria | 2834 |
| 355 | Ga0495651_0017925 | 3300046462 | Bacteria | 5483 |
| 356 | Ga0495653_0000036 | 3300046463 | Bacteria | 129776 |
| 357 | Ga0495605_0159024 | 3300046474 | Bacteria | 1004 |
| 358 | Ga0495639_0103935 | 3300046475 | Bacteria | 1343 |
| 359 | Ga0495639_0144649 | 3300046475 | Bacteria | 1144 |
| 360 | Ga0495662_0004822 | 3300046476 | Bacteria | 6761 |
| 361 | Ga0495664_0000016 | 3300046477 | Bacteria | 175933 |
| 362 | Ga0495584_0095952 | 3300046491 | Bacteria | 1497 |
| 363 | Ga0495585_0043789 | 3300046492 | Bacteria | 2502 |
| 364 | Ga0495594_0281126 | 3300046499 | Bacteria | 948 |
| 365 | Ga0495596_0150432 | 3300046500 | Bacteria | 904 |
| 366 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 367 | Ga0495616_0053236 | 3300046513 | Bacteria | 2012 |
| 368 | Ga0495618_0000057 | 3300046514 | Bacteria | 80298 |
| 369 | Ga0495620_0054031 | 3300046515 | Bacteria | 1699 |
| 370 | Ga0495628_0000018 | 3300046516 | Bacteria | 169916 |
| 371 | Ga0495630_0001707 | 3300046517 | Bacteria | 15337 |
| 372 | Ga0495632_0218766 | 3300046519 | Bacteria | 862 |
| 373 | Ga0495644_0018613 | 3300046523 | Bacteria | 2653 |
| 374 | Ga0495642_0180127 | 3300046528 | Bacteria | 920 |
| 375 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 376 | Ga0495652_0283167 | 3300046529 | Bacteria | 1213 |
| 377 | Ga0495652_0308637 | 3300046529 | Bacteria | 1147 |
| 378 | Ga0495665_0079367 | 3300046531 | Bacteria | 1727 |
| 379 | Ga0495640_0000007 | 3300046533 | Bacteria | 265481 |
| 380 | Ga0495586_0078797 | 3300046535 | Bacteria | 1808 |
| 381 | Ga0495587_0000043 | 3300046536 | Bacteria | 109717 |
| 382 | Ga0495598_0053798 | 3300046537 | Bacteria | 1220 |
| 383 | Ga0495598_0056399 | 3300046537 | Bacteria | 1199 |
| 384 | Ga0495609_0202264 | 3300046538 | Bacteria | 830 |
| 385 | Ga0495645_0000064 | 3300046543 | Bacteria | 74490 |
| 386 | Ga0495622_0166860 | 3300046557 | Bacteria | 991 |
| 387 | Ga0495667_0000023 | 3300046559 | Bacteria | 169343 |
| 388 | Ga0495656_0270534 | 3300046615 | Bacteria | 863 |
| 389 | Ga0495634_0000049 | 3300046642 | Bacteria | 95428 |
| 390 | Ga0495625_0426327 | 3300046660 | Unclassified | 824 |
| 391 | Ga0495635_0000021 | 3300046663 | Bacteria | 164643 |
| 392 | Ga0495659_0109287 | 3300046664 | Bacteria | 1078 |
| 393 | Ga0495588_0062749 | 3300046674 | Bacteria | 1926 |
| 394 | Ga0495657_0000063 | 3300046675 | Bacteria | 94380 |
| 395 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 396 | Ga0495623_0000056 | 3300046679 | Bacteria | 69307 |
| 397 | Ga0495646_0000007 | 3300046680 | Bacteria | 236764 |
| 398 | Ga0495647_0124184 | 3300046681 | Bacteria | 1088 |
| 399 | Ga0495647_0177506 | 3300046681 | Bacteria | 925 |
| 400 | Ga0495658_0100945 | 3300046683 | Bacteria | 1722 |
| 401 | Ga0495658_0224286 | 3300046683 | Bacteria | 1177 |
| 402 | Ga0495669_0147390 | 3300046684 | Bacteria | 1113 |
| 403 | Ga0495613_0129409 | 3300046689 | Bacteria | 1808 |
| 404 | Ga0495613_0194255 | 3300046689 | Bacteria | 1433 |
| 405 | Ga0495624_0014420 | 3300046690 | Bacteria | 5363 |
| 406 | Ga0495624_0290519 | 3300046690 | Bacteria | 986 |
| 407 | Ga0495670_0110496 | 3300046691 | Bacteria | 1422 |
| 408 | Ga0495671_0221863 | 3300046692 | Bacteria | 915 |
| 409 | Ga0495589_0075458 | 3300046794 | Bacteria | 1644 |
| 410 | Ga0495600_0000047 | 3300046809 | Bacteria | 71546 |
| 411 | Ga0495581_0096959 | 3300047315 | Bacteria | 1712 |
| 412 | Ga0495581_0273549 | 3300047315 | Bacteria | 987 |
| 413 | Ga0495604_0000014 | 3300047317 | Bacteria | 205481 |
| 414 | Ga0495604_0102754 | 3300047317 | Bacteria | 2098 |
| 415 | Ga0495674_0000014 | 3300047319 | Bacteria | 241211 |
| 416 | Ga0495674_0579888 | 3300047319 | Bacteria | 890 |
| 417 | Ga0495676_0083050 | 3300047321 | Bacteria | 2422 |
| 418 | Ga0495676_0274664 | 3300047321 | Bacteria | 1142 |
| 419 | Ga0495680_0000744 | 3300047322 | Bacteria | 36481 |
| 420 | Ga0495683_0225369 | 3300047323 | Bacteria | 834 |
| 421 | Ga0495675_0000940 | 3300047444 | Bacteria | 17639 |
| 422 | Ga0495675_0325914 | 3300047444 | Bacteria | 908 |
| 423 | Ga0495684_0000757 | 3300047471 | Bacteria | 26052 |
| 424 | Ga0495593_0001967 | 3300047673 | Bacteria | 12237 |
| 425 | Ga0495602_0000017 | 3300048088 | Bacteria | 184180 |
| 426 | Ga0495602_0217652 | 3300048088 | Bacteria | 1444 |
| 427 | Ga0495626_0167106 | 3300048091 | Bacteria | 919 |
| 428 | Ga0496100_0055698 | 3300048903 | Bacteria | 2584 |
| 429 | Ga0496100_0093571 | 3300048903 | Bacteria | 2056 |
| 430 | Ga0496101_0037064 | 3300048904 | Bacteria | 3457 |
| 431 | Ga0496102_0089466 | 3300048905 | Bacteria | 2848 |
| 432 | Ga0496102_0274114 | 3300048905 | Bacteria | 1590 |
| 433 | Ga0496103_0170733 | 3300048906 | Bacteria | 1396 |
| 434 | Ga0496105_0078111 | 3300048908 | Bacteria | 2733 |
| 435 | Ga0496106_0037953 | 3300048909 | Bacteria | 3604 |
| 436 | Ga0496106_0222812 | 3300048909 | Bacteria | 1504 |
| 437 | Ga0496107_0022620 | 3300048910 | Bacteria | 4442 |
| 438 | Ga0496108_0052444 | 3300048911 | Bacteria | 3418 |
| 439 | Ga0496108_0065122 | 3300048911 | Bacteria | 3071 |
| 440 | Ga0496108_0795001 | 3300048911 | Bacteria | 816 |
| 441 | Ga0496109_0114270 | 3300048912 | Bacteria | 2511 |
| 442 | Ga0496110_0011995 | 3300048913 | Bacteria | 7119 |
| 443 | Ga0496110_0031673 | 3300048913 | Bacteria | 4563 |
| 444 | Ga0496110_0041867 | 3300048913 | Bacteria | 3998 |
| 445 | Ga0496110_0342176 | 3300048913 | Bacteria | 1362 |
| 446 | Ga0496111_0010982 | 3300048914 | Bacteria | 6093 |
| 447 | Ga0496111_0086499 | 3300048914 | Bacteria | 2293 |
| 448 | Ga0496112_0015138 | 3300048915 | Bacteria | 7187 |
| 449 | Ga0496112_0152018 | 3300048915 | Bacteria | 2282 |
| 450 | Ga0496112_0500568 | 3300048915 | Bacteria | 1150 |
| 451 | Ga0496112_0513973 | 3300048915 | Bacteria | 1132 |
| 452 | Ga0496113_0009785 | 3300048916 | Bacteria | 6304 |
| 453 | Ga0496113_0018032 | 3300048916 | Bacteria | 4911 |
| 454 | Ga0496113_0179053 | 3300048916 | Bacteria | 1680 |
| 455 | Ga0496114_0036700 | 3300048917 | Bacteria | 4052 |
| 456 | Ga0496114_0250758 | 3300048917 | Bacteria | 1557 |
| 457 | Ga0496115_0399405 | 3300048918 | Bacteria | 1115 |
| 458 | Ga0501033_0030449 | 3300049570 | Bacteria | 4055 |
| 459 | Ga0501033_0065141 | 3300049570 | Bacteria | 2681 |
| 460 | Ga0501034_0082307 | 3300049571 | Bacteria | 3220 |
| 461 | Ga0501034_0165013 | 3300049571 | Bacteria | 2184 |
| 462 | Ga0501034_0206618 | 3300049571 | Bacteria | 1920 |
| 463 | Ga0501034_0208283 | 3300049571 | Bacteria | 1911 |
| 464 | Ga0501036_0010028 | 3300049572 | Bacteria | 7802 |
| 465 | Ga0501037_0001321 | 3300049573 | Bacteria | 18192 |
| 466 | Ga0501038_0038701 | 3300049574 | Bacteria | 4174 |
| 467 | Ga0501039_0001190 | 3300049575 | Bacteria | 19064 |
| 468 | Ga0501039_0565878 | 3300049575 | Bacteria | 892 |
| 469 | Ga0501041_0382146 | 3300049577 | Bacteria | 891 |
| 470 | Ga0501042_0051482 | 3300049578 | Bacteria | 2937 |
| 471 | Ga0501042_0487882 | 3300049578 | Bacteria | 894 |
| 472 | Ga0501043_0053079 | 3300049579 | Bacteria | 3183 |
| 473 | Ga0501046_0001578 | 3300049580 | Bacteria | 21792 |
| 474 | Ga0501047_0095548 | 3300049581 | Bacteria | 2851 |
| 475 | Ga0501047_0542765 | 3300049581 | Bacteria | 987 |
| 476 | Ga0501048_0004769 | 3300049582 | Bacteria | 10329 |
| 477 | Ga0501067_0026419 | 3300049583 | Bacteria | 3216 |
| 478 | Ga0501067_0030473 | 3300049583 | Bacteria | 2991 |
| 479 | Ga0501068_0158125 | 3300049584 | Bacteria | 1427 |
| 480 | Ga0501068_0238380 | 3300049584 | Bacteria | 1157 |
| 481 | Ga0501069_0003295 | 3300049585 | Bacteria | 8283 |
| 482 | Ga0501069_0222550 | 3300049585 | Bacteria | 1097 |
| 483 | Ga0501070_0199558 | 3300049586 | Bacteria | 1643 |
| 484 | Ga0501071_0191374 | 3300049587 | Bacteria | 1534 |
| 485 | Ga0501072_0090375 | 3300049588 | Bacteria | 2431 |
| 486 | Ga0501072_0154996 | 3300049588 | Bacteria | 1827 |
| 487 | Ga0501072_0177184 | 3300049588 | Bacteria | 1700 |
| 488 | Ga0501072_0556304 | 3300049588 | Bacteria | 906 |
| 489 | Ga0501074_0001331 | 3300049590 | Bacteria | 16408 |
| 490 | Ga0501074_0070396 | 3300049590 | Bacteria | 2515 |
| 491 | Ga0501075_0020600 | 3300049591 | Bacteria | 4799 |
| 492 | Ga0501075_0390627 | 3300049591 | Bacteria | 1061 |
| 493 | Ga0501076_0020819 | 3300049592 | Bacteria | 5023 |
| 494 | Ga0501077_0005773 | 3300049593 | Bacteria | 7540 |
| 495 | Ga0501079_0010726 | 3300049741 | Bacteria | 6978 |
| 496 | Ga0501079_0152864 | 3300049741 | Bacteria | 1799 |
| 497 | Ga0501080_0310247 | 3300049742 | Bacteria | 1430 |
| 498 | Ga0501080_0403583 | 3300049742 | Bacteria | 1229 |
| 499 | Ga0501080_0638912 | 3300049742 | Bacteria | 942 |
| 500 | Ga0501081_0006524 | 3300049743 | Bacteria | 7578 |
| 501 | Ga0501081_0105874 | 3300049743 | Bacteria | 1993 |
| 502 | Ga0501083_0038410 | 3300049744 | Bacteria | 3255 |
| 503 | Ga0501083_0420506 | 3300049744 | Bacteria | 870 |
| 504 | Ga0501083_0476488 | 3300049744 | Bacteria | 812 |
| 505 | Ga0501044_0000122 | 3300049823 | Bacteria | 93246 |
| 506 | nmdc:mga03683_108253_c1 | 3300050489 | Bacteria | 1226 |
| 507 | nmdc:mga00v17_477922_c1 | 3300050491 | Bacteria | 808 |
| 508 | nmdc:mga0k408_18964_c1 | 3300050493 | Bacteria | 3841 |
| 509 | nmdc:mga0k408_36595_c1 | 3300050493 | Bacteria | 2817 |
| 510 | nmdc:mga06z11_140292_c1 | 3300050494 | Bacteria | 1366 |
| 511 | nmdc:mga06z11_453092_c1 | 3300050494 | Bacteria | 775 |
| 512 | nmdc:mga06z11_719204_c1 | 3300050494 | Bacteria | 608 |
| 513 | nmdc:mga06z11_99859_c1 | 3300050494 | Bacteria | 1591 |
| 514 | nmdc:mga07m45_115129_c1 | 3300050496 | Bacteria | 1550 |
| 515 | nmdc:mga05p37_1046633_c1 | 3300050507 | Bacteria | 861 |
| 516 | nmdc:mga05p37_11064_c1 | 3300050507 | Bacteria | 10720 |
| 517 | nmdc:mga05p37_1288121_c1 | 3300050507 | Bacteria | 746 |
| 518 | nmdc:mga05p37_141777_c1 | 3300050507 | Bacteria | 2944 |
| 519 | nmdc:mga05p37_704306_c1 | 3300050507 | Bacteria | 1121 |
| 520 | nmdc:mga05p37_7481_c1 | 3300050507 | Bacteria | 12877 |
| 521 | nmdc:mga09592_1529_c1 | 3300050508 | Bacteria | 18637 |
| 522 | nmdc:mga09592_395568_c1 | 3300050508 | Bacteria | 1194 |
| 523 | nmdc:mga0qj67_100924_c1 | 3300050509 | Bacteria | 2326 |
| 524 | nmdc:mga0qj67_189388_c1 | 3300050509 | Bacteria | 1672 |
| 525 | nmdc:mga0qj67_473074_c1 | 3300050509 | Bacteria | 1008 |
| 526 | nmdc:mga06r32_108585_c1 | 3300050510 | Bacteria | 2728 |
| 527 | nmdc:mga06r32_770_c1 | 3300050510 | Bacteria | 28278 |
| 528 | nmdc:mga08y16_72_c1 | 3300050511 | Bacteria | 84439 |
| 529 | nmdc:mga08y16_815241_c1 | 3300050511 | Bacteria | 925 |
| 530 | nmdc:mga0rr50_200424_c1 | 3300050513 | Bacteria | 1640 |
| 531 | nmdc:mga0rr50_262881_c1 | 3300050513 | Bacteria | 1436 |
| 532 | nmdc:mga08x19_18_c1 | 3300050514 | Bacteria | 321445 |
| 533 | nmdc:mga0sz30_29998_c2 | 3300050516 | Bacteria | 1814 |
| 534 | Ga0495601_0000016 | 3300053077 | Bacteria | 207486 |
| 535 | Ga0495612_0000035 | 3300053078 | Bacteria | 69194 |
| 536 | Ga0495655_0045352 | 3300053083 | Bacteria | 1141 |
| 537 | Ga0495595_0000032 | 3300053084 | Bacteria | 87066 |
| 538 | Ga0495619_0000033 | 3300053085 | Bacteria | 138925 |
| 539 | Ga0500641_0177792 | 3300053096 | Bacteria | 914 |
| 540 | Ga0500593_000006 | 3300053117 | Bacteria | 88644 |
| 541 | Ga0500642_0083927 | 3300053130 | Bacteria | 1466 |
| 542 | Ga0500568_0000005 | 3300053139 | Bacteria | 614296 |
| 543 | Ga0500568_0104190 | 3300053139 | Bacteria | 1063 |
| 544 | Ga0500616_0023558 | 3300053153 | Bacteria | 3428 |
| 545 | Ga0500616_0125999 | 3300053153 | Bacteria | 1216 |
| 546 | Ga0500645_030509 | 3300053730 | Unclassified | 1622 |
| 547 | Ga0501084_0022961 | 3300054114 | Bacteria | 5207 |
| 548 | Ga0501084_0148907 | 3300054114 | Bacteria | 1972 |
| 549 | Ga0501084_0378977 | 3300054114 | Bacteria | 1196 |
| 550 | Ga0501082_0011858 | 3300060353 | Bacteria | 7492 |
| 551 | Ga0501082_0086774 | 3300060353 | Bacteria | 2699 |
| 552 | Ga0501082_0161513 | 3300060353 | Bacteria | 1947 |
| 553 | Ga0501082_0275090 | 3300060353 | Bacteria | 1466 |
| 554 | Ga0501082_0752153 | 3300060353 | Bacteria | 853 |
| 555 | Ga0530510_0346805 | 3300061734 | Bacteria | 1115 |
| 556 | Ga0530510_0586771 | 3300061734 | Bacteria | 847 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005471 | Ga0070698_101200642 | Ga0070698_1012006421 | 166 |
| 2 | 3300049578 | Ga0501042_0487882 | Ga0501042_0487882_187_759 | 176 |
| 3 | 3300049590 | Ga0501074_0070396 | Ga0501074_0070396_1829_2401 | 176 |
| 4 | 3300049591 | Ga0501075_0020600 | Ga0501075_0020600_2889_3461 | 176 |
| 5 | 3300049592 | Ga0501076_0020819 | Ga0501076_0020819_17_589 | 176 |
| 6 | 3300049593 | Ga0501077_0005773 | Ga0501077_0005773_2520_3092 | 176 |
| 7 | 3300049743 | Ga0501081_0006524 | Ga0501081_0006524_2584_3156 | 176 |
| 8 | 3300054114 | Ga0501084_0148907 | Ga0501084_0148907_786_1358 | 176 |
| 9 | 3300060353 | Ga0501082_0011858 | Ga0501082_0011858_2304_2876 | 176 |
| 10 | 3300061734 | Ga0530510_0346805 | Ga0530510_0346805_328_900 | 176 |
| 11 | 3300049743 | Ga0501081_0105874 | Ga0501081_0105874_1379_1933 | 184 |
| 12 | 3300053117 | Ga0500593_000006 | Ga0500593_000006_20880_21446 | 187 |
| 13 | 3300053139 | Ga0500568_0000005 | Ga0500568_0000005_319068_319634 | 187 |
| 14 | 3300031665 | Ga0316575_10149685 | Ga0316575_101496851 | 189 |
| 15 | 3300045051 | Ga0451576_0014115 | Ga0451576_0014115_3525_4097 | 189 |
| 16 | iso_pu_bacteria | 2885312484 | 2885314087 | 189 |
| 17 | iso_pu_bacteria | 2917554339 | 2917558211 | 189 |
| 18 | 3300003323 | rootH1_10340175 | rootH1_103401752 | 190 |
| 19 | 3300005336 | Ga0070680_100015789 | Ga0070680_1000157897 | 190 |
| 20 | 3300005337 | Ga0070682_100000325 | Ga0070682_10000032510 | 190 |
| 21 | 3300005366 | Ga0070659_100124101 | Ga0070659_1001241012 | 190 |
| 22 | 3300005435 | Ga0070714_101231419 | Ga0070714_1012314191 | 190 |
| 23 | 3300005436 | Ga0070713_100258687 | Ga0070713_1002586873 | 190 |
| 24 | 3300005440 | Ga0070705_100261519 | Ga0070705_1002615192 | 190 |
| 25 | 3300005444 | Ga0070694_100158349 | Ga0070694_1001583492 | 190 |
| 26 | 3300005444 | Ga0070694_100871311 | Ga0070694_1008713111 | 190 |
| 27 | 3300005455 | Ga0070663_100827547 | Ga0070663_1008275472 | 190 |
| 28 | 3300005458 | Ga0070681_10035240 | Ga0070681_100352404 | 190 |
| 29 | 3300005530 | Ga0070679_100012384 | Ga0070679_1000123847 | 190 |
| 30 | 3300005536 | Ga0070697_100000575 | Ga0070697_10000057511 | 190 |
| 31 | 3300005539 | Ga0068853_100000927 | Ga0068853_10000092714 | 190 |
| 32 | 3300005545 | Ga0070695_100001268 | Ga0070695_10000126814 | 190 |
| 33 | 3300005546 | Ga0070696_100002501 | Ga0070696_1000025015 | 190 |
| 34 | 3300005547 | Ga0070693_100052489 | Ga0070693_1000524894 | 190 |
| 35 | 3300005563 | Ga0068855_100048834 | Ga0068855_1000488344 | 190 |
| 36 | 3300005577 | Ga0068857_100206619 | Ga0068857_1002066193 | 190 |
| 37 | 3300005578 | Ga0068854_100058866 | Ga0068854_1000588663 | 190 |
| 38 | 3300006914 | Ga0075436_100001283 | Ga0075436_10000128317 | 190 |
| 39 | 3300007076 | Ga0075435_100038099 | Ga0075435_1000380994 | 190 |
| 40 | 3300009174 | Ga0105241_10020240 | Ga0105241_100202403 | 190 |
| 41 | 3300009553 | Ga0105249_10011613 | Ga0105249_100116134 | 190 |
| 42 | 3300013100 | Ga0157373_10004101 | Ga0157373_100041019 | 190 |
| 43 | 3300013104 | Ga0157370_10083016 | Ga0157370_100830164 | 190 |
| 44 | 3300013307 | Ga0157372_10002662 | Ga0157372_1000266216 | 190 |
| 45 | 3300025921 | Ga0207652_10022341 | Ga0207652_100223414 | 190 |
| 46 | 3300025932 | Ga0207690_10087436 | Ga0207690_100874362 | 190 |
| 47 | 3300025939 | Ga0207665_10635228 | Ga0207665_106352282 | 190 |
| 48 | 3300025949 | Ga0207667_10058679 | Ga0207667_100586792 | 190 |
| 49 | 3300025961 | Ga0207712_10010202 | Ga0207712_100102024 | 190 |
| 50 | 3300025981 | Ga0207640_10050921 | Ga0207640_100509213 | 190 |
| 51 | 3300026041 | Ga0207639_10003746 | Ga0207639_1000374610 | 190 |
| 52 | 3300026067 | Ga0207678_10132268 | Ga0207678_101322682 | 190 |
| 53 | 3300026116 | Ga0207674_10050397 | Ga0207674_100503972 | 190 |
| 54 | 3300031711 | Ga0265314_10039578 | Ga0265314_100395785 | 190 |
| 55 | 3300041486 | Ga0451807_1895779 | Ga0451807_1895779_41_616 | 190 |
| 56 | 3300046660 | Ga0495625_0426327 | Ga0495625_0426327_27_602 | 190 |
| 57 | 3300049571 | Ga0501034_0208283 | Ga0501034_0208283_783_1382 | 190 |
| 58 | 3300049583 | Ga0501067_0026419 | Ga0501067_0026419_1450_2049 | 190 |
| 59 | 3300050513 | nmdc:mga0rr50_200424_c1 | nmdc:mga0rr50_200424_c1_330_902 | 190 |
| 60 | 3300050514 | nmdc:mga08x19_18_c1 | nmdc:mga08x19_18_c1_220935_221507 | 190 |
| 61 | 3300053730 | Ga0500645_030509 | Ga0500645_030509_398_973 | 190 |
| 62 | 3300005466 | Ga0070685_10693474 | Ga0070685_106934741 | 191 |
| 63 | 3300049575 | Ga0501039_0565878 | Ga0501039_0565878_67_642 | 191 |
| 64 | 3300049577 | Ga0501041_0382146 | Ga0501041_0382146_35_610 | 191 |
| 65 | 3300049588 | Ga0501072_0556304 | Ga0501072_0556304_286_861 | 191 |
| 66 | 3300049591 | Ga0501075_0390627 | Ga0501075_0390627_333_908 | 191 |
| 67 | 3300049741 | Ga0501079_0152864 | Ga0501079_0152864_610_1185 | 191 |
| 68 | 3300054114 | Ga0501084_0378977 | Ga0501084_0378977_554_1129 | 191 |
| 69 | 3300005327 | Ga0070658_10472526 | Ga0070658_104725262 | 192 |
| 70 | 3300005336 | Ga0070680_100003095 | Ga0070680_1000030956 | 192 |
| 71 | 3300005530 | Ga0070679_100060942 | Ga0070679_1000609423 | 192 |
| 72 | 3300006042 | Ga0075368_10069330 | Ga0075368_100693302 | 192 |
| 73 | 3300006048 | Ga0075363_100107026 | Ga0075363_1001070262 | 192 |
| 74 | 3300006178 | Ga0075367_10230677 | Ga0075367_102306772 | 192 |
| 75 | 3300006353 | Ga0075370_10272941 | Ga0075370_102729411 | 192 |
| 76 | 3300025909 | Ga0207705_10371453 | Ga0207705_103714532 | 192 |
| 77 | 3300025919 | Ga0207657_10027857 | Ga0207657_100278574 | 192 |
| 78 | 3300025921 | Ga0207652_10115663 | Ga0207652_101156632 | 192 |
| 79 | 3300031824 | Ga0307413_10193624 | Ga0307413_101936242 | 192 |
| 80 | 3300031995 | Ga0307409_101447066 | Ga0307409_1014470662 | 192 |
| 81 | 3300035398 | Ga0316574_0175133 | Ga0316574_0175133_40_621 | 192 |
| 82 | 3300049570 | Ga0501033_0030449 | Ga0501033_0030449_2808_3386 | 192 |
| 83 | 3300049570 | Ga0501033_0065141 | Ga0501033_0065141_647_1258 | 192 |
| 84 | 3300049571 | Ga0501034_0082307 | Ga0501034_0082307_2282_2860 | 192 |
| 85 | 3300049571 | Ga0501034_0165013 | Ga0501034_0165013_564_1175 | 192 |
| 86 | 3300049571 | Ga0501034_0206618 | Ga0501034_0206618_726_1304 | 192 |
| 87 | 3300049572 | Ga0501036_0010028 | Ga0501036_0010028_6908_7486 | 192 |
| 88 | 3300049573 | Ga0501037_0001321 | Ga0501037_0001321_16410_16988 | 192 |
| 89 | 3300049574 | Ga0501038_0038701 | Ga0501038_0038701_1206_1784 | 192 |
| 90 | 3300049575 | Ga0501039_0001190 | Ga0501039_0001190_1092_1670 | 192 |
| 91 | 3300049578 | Ga0501042_0051482 | Ga0501042_0051482_904_1482 | 192 |
| 92 | 3300049579 | Ga0501043_0053079 | Ga0501043_0053079_2049_2627 | 192 |
| 93 | 3300049580 | Ga0501046_0001578 | Ga0501046_0001578_10872_11450 | 192 |
| 94 | 3300049581 | Ga0501047_0095548 | Ga0501047_0095548_2019_2597 | 192 |
| 95 | 3300049581 | Ga0501047_0542765 | Ga0501047_0542765_33_644 | 192 |
| 96 | 3300049582 | Ga0501048_0004769 | Ga0501048_0004769_7865_8443 | 192 |
| 97 | 3300049583 | Ga0501067_0030473 | Ga0501067_0030473_2173_2751 | 192 |
| 98 | 3300049584 | Ga0501068_0158125 | Ga0501068_0158125_570_1148 | 192 |
| 99 | 3300049585 | Ga0501069_0003295 | Ga0501069_0003295_2678_3256 | 192 |
| 100 | 3300049587 | Ga0501071_0191374 | Ga0501071_0191374_653_1231 | 192 |
| 101 | 3300049588 | Ga0501072_0154996 | Ga0501072_0154996_294_872 | 192 |
| 102 | 3300049590 | Ga0501074_0001331 | Ga0501074_0001331_1632_2210 | 192 |
| 103 | 3300049741 | Ga0501079_0010726 | Ga0501079_0010726_5852_6430 | 192 |
| 104 | 3300049744 | Ga0501083_0038410 | Ga0501083_0038410_2411_2989 | 192 |
| 105 | 3300049823 | Ga0501044_0000122 | Ga0501044_0000122_33307_33918 | 192 |
| 106 | 3300050494 | nmdc:mga06z11_140292_c1 | nmdc:mga06z11_140292_c1_238_816 | 192 |
| 107 | 3300050494 | nmdc:mga06z11_99859_c1 | nmdc:mga06z11_99859_c1_25_603 | 192 |
| 108 | 3300050516 | nmdc:mga0sz30_29998_c2 | nmdc:mga0sz30_29998_c2_1166_1747 | 192 |
| 109 | 3300053096 | Ga0500641_0177792 | Ga0500641_0177792_104_682 | 192 |
| 110 | 3300054114 | Ga0501084_0022961 | Ga0501084_0022961_1977_2555 | 192 |
| 111 | 3300060353 | Ga0501082_0086774 | Ga0501082_0086774_1924_2502 | 192 |
| 112 | iso_pu_bacteria | 2874123672 | 2874128389 | 192 |
| 113 | 3300001991 | JGI24743J22301_10009031 | JGI24743J22301_100090312 | 193 |
| 114 | 3300002070 | JGI24750J21931_1026476 | JGI24750J21931_10264761 | 193 |
| 115 | 3300002074 | JGI24748J21848_1014063 | JGI24748J21848_10140632 | 193 |
| 116 | 3300002075 | JGI24738J21930_10008382 | JGI24738J21930_100083821 | 193 |
| 117 | 3300002239 | JGI24034J26672_10023034 | JGI24034J26672_100230342 | 193 |
| 118 | 3300002244 | JGI24742J22300_10016360 | JGI24742J22300_100163602 | 193 |
| 119 | 3300003215 | JGI25153J46596_10003511 | JGI25153J46596_100035111 | 193 |
| 120 | 3300003659 | JGI25404J52841_10005112 | JGI25404J52841_100051123 | 193 |
| 121 | 3300005328 | Ga0070676_10024134 | Ga0070676_100241344 | 193 |
| 122 | 3300005328 | Ga0070676_10048465 | Ga0070676_100484652 | 193 |
| 123 | 3300005328 | Ga0070676_10270999 | Ga0070676_102709992 | 193 |
| 124 | 3300005330 | Ga0070690_100012963 | Ga0070690_1000129632 | 193 |
| 125 | 3300005330 | Ga0070690_100075279 | Ga0070690_1000752793 | 193 |
| 126 | 3300005331 | Ga0070670_100039720 | Ga0070670_1000397204 | 193 |
| 127 | 3300005331 | Ga0070670_100273600 | Ga0070670_1002736002 | 193 |
| 128 | 3300005334 | Ga0068869_100136162 | Ga0068869_1001361622 | 193 |
| 129 | 3300005334 | Ga0068869_100304002 | Ga0068869_1003040022 | 193 |
| 130 | 3300005335 | Ga0070666_10063657 | Ga0070666_100636573 | 193 |
| 131 | 3300005339 | Ga0070660_100347140 | Ga0070660_1003471402 | 193 |
| 132 | 3300005340 | Ga0070689_100002497 | Ga0070689_1000024972 | 193 |
| 133 | 3300005340 | Ga0070689_100274023 | Ga0070689_1002740232 | 193 |
| 134 | 3300005340 | Ga0070689_100364617 | Ga0070689_1003646172 | 193 |
| 135 | 3300005343 | Ga0070687_100013158 | Ga0070687_1000131583 | 193 |
| 136 | 3300005343 | Ga0070687_100092060 | Ga0070687_1000920602 | 193 |
| 137 | 3300005344 | Ga0070661_100182304 | Ga0070661_1001823041 | 193 |
| 138 | 3300005345 | Ga0070692_10090012 | Ga0070692_100900122 | 193 |
| 139 | 3300005347 | Ga0070668_100137517 | Ga0070668_1001375171 | 193 |
| 140 | 3300005347 | Ga0070668_100319694 | Ga0070668_1003196942 | 193 |
| 141 | 3300005353 | Ga0070669_100032417 | Ga0070669_1000324173 | 193 |
| 142 | 3300005354 | Ga0070675_100012297 | Ga0070675_1000122976 | 193 |
| 143 | 3300005354 | Ga0070675_100118895 | Ga0070675_1001188952 | 193 |
| 144 | 3300005355 | Ga0070671_100050205 | Ga0070671_1000502056 | 193 |
| 145 | 3300005355 | Ga0070671_100772848 | Ga0070671_1007728481 | 193 |
| 146 | 3300005356 | Ga0070674_100067283 | Ga0070674_1000672833 | 193 |
| 147 | 3300005365 | Ga0070688_100030935 | Ga0070688_1000309353 | 193 |
| 148 | 3300005365 | Ga0070688_100110863 | Ga0070688_1001108631 | 193 |
| 149 | 3300005366 | Ga0070659_100069353 | Ga0070659_1000693532 | 193 |
| 150 | 3300005367 | Ga0070667_100338176 | Ga0070667_1003381762 | 193 |
| 151 | 3300005434 | Ga0070709_10094443 | Ga0070709_100944433 | 193 |
| 152 | 3300005435 | Ga0070714_100468338 | Ga0070714_1004683382 | 193 |
| 153 | 3300005438 | Ga0070701_10019160 | Ga0070701_100191601 | 193 |
| 154 | 3300005439 | Ga0070711_100092376 | Ga0070711_1000923762 | 193 |
| 155 | 3300005440 | Ga0070705_100045847 | Ga0070705_1000458473 | 193 |
| 156 | 3300005441 | Ga0070700_100068127 | Ga0070700_1000681272 | 193 |
| 157 | 3300005441 | Ga0070700_100159793 | Ga0070700_1001597932 | 193 |
| 158 | 3300005445 | Ga0070708_100055171 | Ga0070708_1000551714 | 193 |
| 159 | 3300005445 | Ga0070708_100499177 | Ga0070708_1004991771 | 193 |
| 160 | 3300005455 | Ga0070663_100064406 | Ga0070663_1000644062 | 193 |
| 161 | 3300005456 | Ga0070678_100096593 | Ga0070678_1000965932 | 193 |
| 162 | 3300005456 | Ga0070678_100293832 | Ga0070678_1002938322 | 193 |
| 163 | 3300005458 | Ga0070681_11233289 | Ga0070681_112332891 | 193 |
| 164 | 3300005459 | Ga0068867_100174763 | Ga0068867_1001747632 | 193 |
| 165 | 3300005466 | Ga0070685_10017184 | Ga0070685_100171842 | 193 |
| 166 | 3300005467 | Ga0070706_101246556 | Ga0070706_1012465561 | 193 |
| 167 | 3300005468 | Ga0070707_100310223 | Ga0070707_1003102232 | 193 |
| 168 | 3300005518 | Ga0070699_100002955 | Ga0070699_10000295515 | 193 |
| 169 | 3300005518 | Ga0070699_100032876 | Ga0070699_1000328763 | 193 |
| 170 | 3300005530 | Ga0070679_100254907 | Ga0070679_1002549071 | 193 |
| 171 | 3300005530 | Ga0070679_100256870 | Ga0070679_1002568702 | 193 |
| 172 | 3300005535 | Ga0070684_101096479 | Ga0070684_1010964791 | 193 |
| 173 | 3300005536 | Ga0070697_101184663 | Ga0070697_1011846631 | 193 |
| 174 | 3300005536 | Ga0070697_101208577 | Ga0070697_1012085771 | 193 |
| 175 | 3300005539 | Ga0068853_100128934 | Ga0068853_1001289342 | 193 |
| 176 | 3300005544 | Ga0070686_100043848 | Ga0070686_1000438481 | 193 |
| 177 | 3300005547 | Ga0070693_100514913 | Ga0070693_1005149132 | 193 |
| 178 | 3300005548 | Ga0070665_100100164 | Ga0070665_1001001643 | 193 |
| 179 | 3300005564 | Ga0070664_100108885 | Ga0070664_1001088852 | 193 |
| 180 | 3300005577 | Ga0068857_100494729 | Ga0068857_1004947292 | 193 |
| 181 | 3300005578 | Ga0068854_100091106 | Ga0068854_1000911062 | 193 |
| 182 | 3300005614 | Ga0068856_100123319 | Ga0068856_1001233193 | 193 |
| 183 | 3300005616 | Ga0068852_100078655 | Ga0068852_1000786552 | 193 |
| 184 | 3300005617 | Ga0068859_100223071 | Ga0068859_1002230712 | 193 |
| 185 | 3300005617 | Ga0068859_100467607 | Ga0068859_1004676072 | 193 |
| 186 | 3300005618 | Ga0068864_100069183 | Ga0068864_1000691832 | 193 |
| 187 | 3300005618 | Ga0068864_100282826 | Ga0068864_1002828262 | 193 |
| 188 | 3300005718 | Ga0068866_10074830 | Ga0068866_100748302 | 193 |
| 189 | 3300005719 | Ga0068861_100352443 | Ga0068861_1003524432 | 193 |
| 190 | 3300005834 | Ga0068851_10069123 | Ga0068851_100691232 | 193 |
| 191 | 3300005840 | Ga0068870_10218076 | Ga0068870_102180762 | 193 |
| 192 | 3300005840 | Ga0068870_10373898 | Ga0068870_103738981 | 193 |
| 193 | 3300005841 | Ga0068863_100202577 | Ga0068863_1002025772 | 193 |
| 194 | 3300005842 | Ga0068858_100370867 | Ga0068858_1003708671 | 193 |
| 195 | 3300005843 | Ga0068860_100160483 | Ga0068860_1001604832 | 193 |
| 196 | 3300005844 | Ga0068862_100366781 | Ga0068862_1003667811 | 193 |
| 197 | 3300005937 | Ga0081455_10033713 | Ga0081455_100337134 | 193 |
| 198 | 3300005983 | Ga0081540_1000055 | Ga0081540_100005536 | 193 |
| 199 | 3300006028 | Ga0070717_10223604 | Ga0070717_102236042 | 193 |
| 200 | 3300006028 | Ga0070717_10288046 | Ga0070717_102880462 | 193 |
| 201 | 3300006038 | Ga0075365_10023018 | Ga0075365_100230183 | 193 |
| 202 | 3300006038 | Ga0075365_10073525 | Ga0075365_100735252 | 193 |
| 203 | 3300006042 | Ga0075368_10030936 | Ga0075368_100309363 | 193 |
| 204 | 3300006042 | Ga0075368_10047079 | Ga0075368_100470792 | 193 |
| 205 | 3300006048 | Ga0075363_100050314 | Ga0075363_1000503142 | 193 |
| 206 | 3300006163 | Ga0070715_10016951 | Ga0070715_100169512 | 193 |
| 207 | 3300006173 | Ga0070716_100072370 | Ga0070716_1000723701 | 193 |
| 208 | 3300006173 | Ga0070716_100526540 | Ga0070716_1005265402 | 193 |
| 209 | 3300006175 | Ga0070712_100347611 | Ga0070712_1003476112 | 193 |
| 210 | 3300006175 | Ga0070712_100368640 | Ga0070712_1003686402 | 193 |
| 211 | 3300006177 | Ga0075362_10171586 | Ga0075362_101715862 | 193 |
| 212 | 3300006177 | Ga0075362_10236541 | Ga0075362_102365412 | 193 |
| 213 | 3300006178 | Ga0075367_10034925 | Ga0075367_100349252 | 193 |
| 214 | 3300006178 | Ga0075367_10092774 | Ga0075367_100927742 | 193 |
| 215 | 3300006186 | Ga0075369_10043986 | Ga0075369_100439862 | 193 |
| 216 | 3300006195 | Ga0075366_10010892 | Ga0075366_100108924 | 193 |
| 217 | 3300006195 | Ga0075366_10055659 | Ga0075366_100556591 | 193 |
| 218 | 3300006195 | Ga0075366_10093845 | Ga0075366_100938453 | 193 |
| 219 | 3300006237 | Ga0097621_100015369 | Ga0097621_1000153695 | 193 |
| 220 | 3300006353 | Ga0075370_10056904 | Ga0075370_100569042 | 193 |
| 221 | 3300006358 | Ga0068871_100049571 | Ga0068871_1000495713 | 193 |
| 222 | 3300006844 | Ga0075428_101123297 | Ga0075428_1011232972 | 193 |
| 223 | 3300006846 | Ga0075430_100051434 | Ga0075430_1000514344 | 193 |
| 224 | 3300006846 | Ga0075430_100081665 | Ga0075430_1000816653 | 193 |
| 225 | 3300006847 | Ga0075431_100004553 | Ga0075431_10000455312 | 193 |
| 226 | 3300006847 | Ga0075431_100009653 | Ga0075431_1000096532 | 193 |
| 227 | 3300006871 | Ga0075434_100102227 | Ga0075434_1001022273 | 193 |
| 228 | 3300006871 | Ga0075434_100222783 | Ga0075434_1002227833 | 193 |
| 229 | 3300006880 | Ga0075429_100002407 | Ga0075429_10000240722 | 193 |
| 230 | 3300006881 | Ga0068865_100290688 | Ga0068865_1002906882 | 193 |
| 231 | 3300006931 | Ga0097620_100223062 | Ga0097620_1002230622 | 193 |
| 232 | 3300006931 | Ga0097620_100467637 | Ga0097620_1004676372 | 193 |
| 233 | 3300007076 | Ga0075435_100021345 | Ga0075435_1000213455 | 193 |
| 234 | 3300007076 | Ga0075435_100181102 | Ga0075435_1001811022 | 193 |
| 235 | 3300007076 | Ga0075435_100213776 | Ga0075435_1002137762 | 193 |
| 236 | 3300007076 | Ga0075435_100493941 | Ga0075435_1004939412 | 193 |
| 237 | 3300007265 | Ga0099794_10008881 | Ga0099794_100088814 | 193 |
| 238 | 3300009094 | Ga0111539_10000115 | Ga0111539_1000011570 | 193 |
| 239 | 3300009094 | Ga0111539_11186865 | Ga0111539_111868652 | 193 |
| 240 | 3300009098 | Ga0105245_10251526 | Ga0105245_102515262 | 193 |
| 241 | 3300009101 | Ga0105247_10042175 | Ga0105247_100421753 | 193 |
| 242 | 3300009147 | Ga0114129_10001209 | Ga0114129_1000120913 | 193 |
| 243 | 3300009147 | Ga0114129_12383619 | Ga0114129_123836191 | 193 |
| 244 | 3300009174 | Ga0105241_10376914 | Ga0105241_103769142 | 193 |
| 245 | 3300009174 | Ga0105241_10501671 | Ga0105241_105016712 | 193 |
| 246 | 3300009176 | Ga0105242_10123745 | Ga0105242_101237452 | 193 |
| 247 | 3300009176 | Ga0105242_10143987 | Ga0105242_101439873 | 193 |
| 248 | 3300009177 | Ga0105248_10001877 | Ga0105248_100018774 | 193 |
| 249 | 3300009177 | Ga0105248_10153813 | Ga0105248_101538133 | 193 |
| 250 | 3300009177 | Ga0105248_10629027 | Ga0105248_106290272 | 193 |
| 251 | 3300009545 | Ga0105237_10649263 | Ga0105237_106492632 | 193 |
| 252 | 3300009551 | Ga0105238_10256873 | Ga0105238_102568732 | 193 |
| 253 | 3300009553 | Ga0105249_10116782 | Ga0105249_101167823 | 193 |
| 254 | 3300010375 | Ga0105239_11371755 | Ga0105239_113717552 | 193 |
| 255 | 3300011119 | Ga0105246_10440191 | Ga0105246_104401912 | 193 |
| 256 | 3300013297 | Ga0157378_10737990 | Ga0157378_107379902 | 193 |
| 257 | 3300013306 | Ga0163162_10946030 | Ga0163162_109460302 | 193 |
| 258 | 3300013306 | Ga0163162_10967588 | Ga0163162_109675882 | 193 |
| 259 | 3300013308 | Ga0157375_10524371 | Ga0157375_105243712 | 193 |
| 260 | 3300013308 | Ga0157375_10796739 | Ga0157375_107967392 | 193 |
| 261 | 3300014325 | Ga0163163_10129437 | Ga0163163_101294374 | 193 |
| 262 | 3300014325 | Ga0163163_10405805 | Ga0163163_104058052 | 193 |
| 263 | 3300014326 | Ga0157380_10039978 | Ga0157380_100399783 | 193 |
| 264 | 3300014326 | Ga0157380_10107014 | Ga0157380_101070143 | 193 |
| 265 | 3300014326 | Ga0157380_10212543 | Ga0157380_102125432 | 193 |
| 266 | 3300014326 | Ga0157380_10321492 | Ga0157380_103214921 | 193 |
| 267 | 3300014497 | Ga0182008_10049039 | Ga0182008_100490393 | 193 |
| 268 | 3300014745 | Ga0157377_10176041 | Ga0157377_101760412 | 193 |
| 269 | 3300014745 | Ga0157377_10984796 | Ga0157377_109847961 | 193 |
| 270 | 3300014968 | Ga0157379_10364366 | Ga0157379_103643662 | 193 |
| 271 | 3300014969 | Ga0157376_10739060 | Ga0157376_107390601 | 193 |
| 272 | 3300017792 | Ga0163161_10184409 | Ga0163161_101844092 | 193 |
| 273 | 3300025297 | Ga0209758_1005755 | Ga0209758_10057551 | 193 |
| 274 | 3300025297 | Ga0209758_1017976 | Ga0209758_10179766 | 193 |
| 275 | 3300025302 | Ga0207426_1061834 | Ga0207426_10618341 | 193 |
| 276 | 3300025315 | Ga0207697_10085266 | Ga0207697_100852662 | 193 |
| 277 | 3300025885 | Ga0207653_10010065 | Ga0207653_100100652 | 193 |
| 278 | 3300025898 | Ga0207692_10059981 | Ga0207692_100599813 | 193 |
| 279 | 3300025898 | Ga0207692_10081593 | Ga0207692_100815932 | 193 |
| 280 | 3300025899 | Ga0207642_10697826 | Ga0207642_106978261 | 193 |
| 281 | 3300025900 | Ga0207710_10015124 | Ga0207710_100151243 | 193 |
| 282 | 3300025901 | Ga0207688_10010751 | Ga0207688_100107515 | 193 |
| 283 | 3300025904 | Ga0207647_10038007 | Ga0207647_100380074 | 193 |
| 284 | 3300025906 | Ga0207699_10052946 | Ga0207699_100529462 | 193 |
| 285 | 3300025906 | Ga0207699_10144393 | Ga0207699_101443933 | 193 |
| 286 | 3300025907 | Ga0207645_10005075 | Ga0207645_100050759 | 193 |
| 287 | 3300025907 | Ga0207645_10055111 | Ga0207645_100551113 | 193 |
| 288 | 3300025908 | Ga0207643_10000750 | Ga0207643_100007504 | 193 |
| 289 | 3300025910 | Ga0207684_10008184 | Ga0207684_100081842 | 193 |
| 290 | 3300025910 | Ga0207684_10224057 | Ga0207684_102240572 | 193 |
| 291 | 3300025914 | Ga0207671_10154088 | Ga0207671_101540882 | 193 |
| 292 | 3300025915 | Ga0207693_10075172 | Ga0207693_100751723 | 193 |
| 293 | 3300025915 | Ga0207693_10217124 | Ga0207693_102171242 | 193 |
| 294 | 3300025915 | Ga0207693_10326141 | Ga0207693_103261412 | 193 |
| 295 | 3300025915 | Ga0207693_10662213 | Ga0207693_106622132 | 193 |
| 296 | 3300025916 | Ga0207663_10039076 | Ga0207663_100390763 | 193 |
| 297 | 3300025917 | Ga0207660_10522352 | Ga0207660_105223521 | 193 |
| 298 | 3300025918 | Ga0207662_10104128 | Ga0207662_101041282 | 193 |
| 299 | 3300025918 | Ga0207662_10249088 | Ga0207662_102490881 | 193 |
| 300 | 3300025919 | Ga0207657_10083020 | Ga0207657_100830203 | 193 |
| 301 | 3300025920 | Ga0207649_10097941 | Ga0207649_100979413 | 193 |
| 302 | 3300025921 | Ga0207652_10427474 | Ga0207652_104274742 | 193 |
| 303 | 3300025923 | Ga0207681_10084609 | Ga0207681_100846092 | 193 |
| 304 | 3300025923 | Ga0207681_10232934 | Ga0207681_102329342 | 193 |
| 305 | 3300025923 | Ga0207681_10235750 | Ga0207681_102357502 | 193 |
| 306 | 3300025925 | Ga0207650_10034322 | Ga0207650_100343221 | 193 |
| 307 | 3300025925 | Ga0207650_10153059 | Ga0207650_101530592 | 193 |
| 308 | 3300025927 | Ga0207687_10138128 | Ga0207687_101381282 | 193 |
| 309 | 3300025927 | Ga0207687_10710358 | Ga0207687_107103582 | 193 |
| 310 | 3300025928 | Ga0207700_10091514 | Ga0207700_100915142 | 193 |
| 311 | 3300025929 | Ga0207664_10019573 | Ga0207664_100195732 | 193 |
| 312 | 3300025929 | Ga0207664_10282955 | Ga0207664_102829552 | 193 |
| 313 | 3300025929 | Ga0207664_10993684 | Ga0207664_109936841 | 193 |
| 314 | 3300025931 | Ga0207644_10044390 | Ga0207644_100443902 | 193 |
| 315 | 3300025932 | Ga0207690_10427980 | Ga0207690_104279802 | 193 |
| 316 | 3300025933 | Ga0207706_10001078 | Ga0207706_1000107819 | 193 |
| 317 | 3300025936 | Ga0207670_10041282 | Ga0207670_100412822 | 193 |
| 318 | 3300025939 | Ga0207665_10240500 | Ga0207665_102405002 | 193 |
| 319 | 3300025940 | Ga0207691_10048712 | Ga0207691_100487123 | 193 |
| 320 | 3300025941 | Ga0207711_10039770 | Ga0207711_100397703 | 193 |
| 321 | 3300025941 | Ga0207711_10335528 | Ga0207711_103355282 | 193 |
| 322 | 3300025941 | Ga0207711_10687679 | Ga0207711_106876791 | 193 |
| 323 | 3300025942 | Ga0207689_10024160 | Ga0207689_100241603 | 193 |
| 324 | 3300025945 | Ga0207679_10965816 | Ga0207679_109658161 | 193 |
| 325 | 3300025961 | Ga0207712_10086384 | Ga0207712_100863842 | 193 |
| 326 | 3300025972 | Ga0207668_10066897 | Ga0207668_100668972 | 193 |
| 327 | 3300025972 | Ga0207668_10082714 | Ga0207668_100827142 | 193 |
| 328 | 3300025972 | Ga0207668_10222492 | Ga0207668_102224922 | 193 |
| 329 | 3300025972 | Ga0207668_10268786 | Ga0207668_102687862 | 193 |
| 330 | 3300025981 | Ga0207640_10714930 | Ga0207640_107149301 | 193 |
| 331 | 3300025986 | Ga0207658_10055253 | Ga0207658_100552533 | 193 |
| 332 | 3300026023 | Ga0207677_10317562 | Ga0207677_103175622 | 193 |
| 333 | 3300026035 | Ga0207703_10152965 | Ga0207703_101529652 | 193 |
| 334 | 3300026067 | Ga0207678_10015782 | Ga0207678_100157826 | 193 |
| 335 | 3300026075 | Ga0207708_10001622 | Ga0207708_100016223 | 193 |
| 336 | 3300026075 | Ga0207708_10095246 | Ga0207708_100952462 | 193 |
| 337 | 3300026078 | Ga0207702_10578073 | Ga0207702_105780731 | 193 |
| 338 | 3300026089 | Ga0207648_10050674 | Ga0207648_100506742 | 193 |
| 339 | 3300026095 | Ga0207676_10169336 | Ga0207676_101693362 | 193 |
| 340 | 3300026118 | Ga0207675_100001067 | Ga0207675_1000010679 | 193 |
| 341 | 3300026121 | Ga0207683_10005165 | Ga0207683_100051654 | 193 |
| 342 | 3300026121 | Ga0207683_10022355 | Ga0207683_100223556 | 193 |
| 343 | 3300027671 | Ga0209588_1014647 | Ga0209588_10146473 | 193 |
| 344 | 3300027907 | Ga0207428_10002405 | Ga0207428_100024056 | 193 |
| 345 | 3300028379 | Ga0268266_10397313 | Ga0268266_103973131 | 193 |
| 346 | 3300028379 | Ga0268266_10552514 | Ga0268266_105525142 | 193 |
| 347 | 3300028380 | Ga0268265_10033539 | Ga0268265_100335395 | 193 |
| 348 | 3300028380 | Ga0268265_10871062 | Ga0268265_108710621 | 193 |
| 349 | 3300028381 | Ga0268264_10369646 | Ga0268264_103696462 | 193 |
| 350 | 3300031728 | Ga0316578_10096671 | Ga0316578_100966712 | 193 |
| 351 | 3300032137 | Ga0316585_10052198 | Ga0316585_100521982 | 193 |
| 352 | 3300034816 | Ga0373930_0018118 | Ga0373930_0018118_351_944 | 193 |
| 353 | 3300034957 | Ga0373938_0033522 | Ga0373938_0033522_346_939 | 193 |
| 354 | 3300035083 | Ga0373926_0015325 | Ga0373926_0015325_738_1322 | 193 |
| 355 | 3300035083 | Ga0373926_0077305 | Ga0373926_0077305_429_1022 | 193 |
| 356 | 3300035085 | Ga0373929_0007021 | Ga0373929_0007021_588_1181 | 193 |
| 357 | 3300035089 | Ga0373944_0017827 | Ga0373944_0017827_614_1195 | 193 |
| 358 | 3300035091 | Ga0373951_0101775 | Ga0373951_0101775_43_636 | 193 |
| 359 | 3300035111 | Ga0373923_0000926 | Ga0373923_0000926_3909_4493 | 193 |
| 360 | 3300035112 | Ga0373932_0045086 | Ga0373932_0045086_190_783 | 193 |
| 361 | 3300035112 | Ga0373932_0063721 | Ga0373932_0063721_395_988 | 193 |
| 362 | 3300035113 | Ga0373936_0002444 | Ga0373936_0002444_2085_2669 | 193 |
| 363 | 3300035113 | Ga0373936_0078703 | Ga0373936_0078703_772_1353 | 193 |
| 364 | 3300035114 | Ga0373939_0005192 | Ga0373939_0005192_682_1275 | 193 |
| 365 | 3300035115 | Ga0373941_0022184 | Ga0373941_0022184_859_1452 | 193 |
| 366 | 3300035116 | Ga0373945_0012501 | Ga0373945_0012501_1373_1957 | 193 |
| 367 | 3300035116 | Ga0373945_0098513 | Ga0373945_0098513_449_1030 | 193 |
| 368 | 3300035117 | Ga0373953_0000743 | Ga0373953_0000743_1651_2235 | 193 |
| 369 | 3300035118 | Ga0373954_0021148 | Ga0373954_0021148_522_1106 | 193 |
| 370 | 3300035120 | Ga0373957_0007156 | Ga0373957_0007156_2292_2876 | 193 |
| 371 | 3300035121 | Ga0373960_0036916 | Ga0373960_0036916_58_651 | 193 |
| 372 | 3300035121 | Ga0373960_0082702 | Ga0373960_0082702_36_617 | 193 |
| 373 | 3300035170 | Ga0373943_0003686 | Ga0373943_0003686_809_1393 | 193 |
| 374 | 3300035170 | Ga0373943_0032339 | Ga0373943_0032339_404_985 | 193 |
| 375 | 3300035171 | Ga0373946_0000588 | Ga0373946_0000588_9462_10046 | 193 |
| 376 | 3300035172 | Ga0373955_0000346 | Ga0373955_0000346_2934_3518 | 193 |
| 377 | 3300035241 | Ga0373961_0013177 | Ga0373961_0013177_1160_1753 | 193 |
| 378 | 3300035398 | Ga0316574_0006930 | Ga0316574_0006930_371_952 | 193 |
| 379 | 3300035410 | Ga0373924_0015064 | Ga0373924_0015064_1494_2078 | 193 |
| 380 | 3300035691 | Ga0373931_0009934 | Ga0373931_0009934_903_1496 | 193 |
| 381 | 3300035691 | Ga0373931_0015382 | Ga0373931_0015382_2185_2778 | 193 |
| 382 | 3300035691 | Ga0373931_0353752 | Ga0373931_0353752_114_695 | 193 |
| 383 | 3300035692 | Ga0373935_0000056 | Ga0373935_0000056_28122_28706 | 193 |
| 384 | 3300035692 | Ga0373935_0397388 | Ga0373935_0397388_179_760 | 193 |
| 385 | 3300035695 | Ga0373927_0005062 | Ga0373927_0005062_5097_5681 | 193 |
| 386 | 3300035695 | Ga0373927_0291200 | Ga0373927_0291200_23_604 | 193 |
| 387 | 3300035724 | Ga0373933_0028287 | Ga0373933_0028287_1576_2160 | 193 |
| 388 | 3300035724 | Ga0373933_0167144 | Ga0373933_0167144_759_1340 | 193 |
| 389 | 3300035724 | Ga0373933_0760332 | Ga0373933_0760332_31_612 | 193 |
| 390 | 3300035725 | Ga0373947_0007138 | Ga0373947_0007138_4205_4789 | 193 |
| 391 | 3300035725 | Ga0373947_0200452 | Ga0373947_0200452_694_1275 | 193 |
| 392 | 3300036401 | Ga0373937_0000075 | Ga0373937_0000075_61291_61875 | 193 |
| 393 | 3300036712 | Ga0316584_0071826 | Ga0316584_0071826_1331_1912 | 193 |
| 394 | 3300037068 | Ga0373925_0000159 | Ga0373925_0000159_27982_28566 | 193 |
| 395 | 3300037068 | Ga0373925_0037415 | Ga0373925_0037415_170_751 | 193 |
| 396 | 3300037312 | Ga0395899_0463047 | Ga0395899_0463047_149_730 | 193 |
| 397 | 3300037466 | Ga0395898_0718433 | Ga0395898_0718433_197_778 | 193 |
| 398 | 3300037466 | Ga0395898_0984529 | Ga0395898_0984529_63_677 | 193 |
| 399 | 3300037471 | Ga0395905_0037065 | Ga0395905_0037065_2935_3549 | 193 |
| 400 | 3300037853 | Ga0436364_0268901 | Ga0436364_0268901_48_629 | 193 |
| 401 | 3300037853 | Ga0436364_0880057 | Ga0436364_0880057_403_984 | 193 |
| 402 | 3300038443 | Ga0395901_0182931 | Ga0395901_0182931_1467_2081 | 193 |
| 403 | 3300039447 | Ga0436361_0109240 | Ga0436361_0109240_4118_4711 | 193 |
| 404 | 3300041494 | Ga0451837_0444460 | Ga0451837_0444460_255_836 | 193 |
| 405 | 3300046452 | Ga0495617_109768 | Ga0495617_109768_84_665 | 193 |
| 406 | 3300046453 | Ga0495627_065943 | Ga0495627_065943_458_1039 | 193 |
| 407 | 3300046454 | Ga0495592_0000102 | Ga0495592_0000102_61260_61844 | 193 |
| 408 | 3300046455 | Ga0495603_0033794 | Ga0495603_0033794_1221_1802 | 193 |
| 409 | 3300046457 | Ga0495590_0052249 | Ga0495590_0052249_389_970 | 193 |
| 410 | 3300046459 | Ga0495629_0012813 | Ga0495629_0012813_5047_5631 | 193 |
| 411 | 3300046461 | Ga0495641_0026393 | Ga0495641_0026393_165_746 | 193 |
| 412 | 3300046462 | Ga0495651_0017925 | Ga0495651_0017925_2762_3346 | 193 |
| 413 | 3300046463 | Ga0495653_0000036 | Ga0495653_0000036_45600_46184 | 193 |
| 414 | 3300046474 | Ga0495605_0159024 | Ga0495605_0159024_282_863 | 193 |
| 415 | 3300046475 | Ga0495639_0103935 | Ga0495639_0103935_15_599 | 193 |
| 416 | 3300046475 | Ga0495639_0144649 | Ga0495639_0144649_208_789 | 193 |
| 417 | 3300046476 | Ga0495662_0004822 | Ga0495662_0004822_3686_4270 | 193 |
| 418 | 3300046477 | Ga0495664_0000016 | Ga0495664_0000016_6622_7206 | 193 |
| 419 | 3300046491 | Ga0495584_0095952 | Ga0495584_0095952_265_846 | 193 |
| 420 | 3300046492 | Ga0495585_0043789 | Ga0495585_0043789_756_1337 | 193 |
| 421 | 3300046499 | Ga0495594_0281126 | Ga0495594_0281126_179_760 | 193 |
| 422 | 3300046500 | Ga0495596_0150432 | Ga0495596_0150432_106_687 | 193 |
| 423 | 3300046511 | Ga0495608_0000006 | Ga0495608_0000006_262486_263070 | 193 |
| 424 | 3300046513 | Ga0495616_0053236 | Ga0495616_0053236_551_1132 | 193 |
| 425 | 3300046514 | Ga0495618_0000057 | Ga0495618_0000057_28061_28645 | 193 |
| 426 | 3300046515 | Ga0495620_0054031 | Ga0495620_0054031_784_1365 | 193 |
| 427 | 3300046516 | Ga0495628_0000018 | Ga0495628_0000018_162711_163295 | 193 |
| 428 | 3300046517 | Ga0495630_0001707 | Ga0495630_0001707_3503_4087 | 193 |
| 429 | 3300046519 | Ga0495632_0218766 | Ga0495632_0218766_115_696 | 193 |
| 430 | 3300046523 | Ga0495644_0018613 | Ga0495644_0018613_1973_2554 | 193 |
| 431 | 3300046528 | Ga0495642_0180127 | Ga0495642_0180127_262_843 | 193 |
| 432 | 3300046529 | Ga0495652_0000005 | Ga0495652_0000005_475864_476448 | 193 |
| 433 | 3300046529 | Ga0495652_0283167 | Ga0495652_0283167_365_946 | 193 |
| 434 | 3300046529 | Ga0495652_0308637 | Ga0495652_0308637_411_992 | 193 |
| 435 | 3300046531 | Ga0495665_0079367 | Ga0495665_0079367_838_1419 | 193 |
| 436 | 3300046533 | Ga0495640_0000007 | Ga0495640_0000007_210203_210787 | 193 |
| 437 | 3300046535 | Ga0495586_0078797 | Ga0495586_0078797_157_741 | 193 |
| 438 | 3300046536 | Ga0495587_0000043 | Ga0495587_0000043_47844_48428 | 193 |
| 439 | 3300046537 | Ga0495598_0053798 | Ga0495598_0053798_379_960 | 193 |
| 440 | 3300046537 | Ga0495598_0056399 | Ga0495598_0056399_554_1135 | 193 |
| 441 | 3300046538 | Ga0495609_0202264 | Ga0495609_0202264_112_693 | 193 |
| 442 | 3300046543 | Ga0495645_0000064 | Ga0495645_0000064_6622_7206 | 193 |
| 443 | 3300046557 | Ga0495622_0166860 | Ga0495622_0166860_157_738 | 193 |
| 444 | 3300046559 | Ga0495667_0000023 | Ga0495667_0000023_29511_30095 | 193 |
| 445 | 3300046615 | Ga0495656_0270534 | Ga0495656_0270534_235_816 | 193 |
| 446 | 3300046642 | Ga0495634_0000049 | Ga0495634_0000049_43177_43761 | 193 |
| 447 | 3300046663 | Ga0495635_0000021 | Ga0495635_0000021_61270_61854 | 193 |
| 448 | 3300046664 | Ga0495659_0109287 | Ga0495659_0109287_471_1052 | 193 |
| 449 | 3300046674 | Ga0495588_0062749 | Ga0495588_0062749_234_815 | 193 |
| 450 | 3300046675 | Ga0495657_0000063 | Ga0495657_0000063_45889_46473 | 193 |
| 451 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_54454_55038 | 193 |
| 452 | 3300046679 | Ga0495623_0000056 | Ga0495623_0000056_14150_14734 | 193 |
| 453 | 3300046680 | Ga0495646_0000007 | Ga0495646_0000007_181682_182266 | 193 |
| 454 | 3300046681 | Ga0495647_0124184 | Ga0495647_0124184_179_760 | 193 |
| 455 | 3300046681 | Ga0495647_0177506 | Ga0495647_0177506_243_824 | 193 |
| 456 | 3300046683 | Ga0495658_0100945 | Ga0495658_0100945_683_1267 | 193 |
| 457 | 3300046683 | Ga0495658_0224286 | Ga0495658_0224286_232_813 | 193 |
| 458 | 3300046684 | Ga0495669_0147390 | Ga0495669_0147390_137_718 | 193 |
| 459 | 3300046689 | Ga0495613_0129409 | Ga0495613_0129409_764_1348 | 193 |
| 460 | 3300046689 | Ga0495613_0194255 | Ga0495613_0194255_284_865 | 193 |
| 461 | 3300046690 | Ga0495624_0014420 | Ga0495624_0014420_808_1392 | 193 |
| 462 | 3300046690 | Ga0495624_0290519 | Ga0495624_0290519_180_761 | 193 |
| 463 | 3300046691 | Ga0495670_0110496 | Ga0495670_0110496_76_657 | 193 |
| 464 | 3300046692 | Ga0495671_0221863 | Ga0495671_0221863_43_624 | 193 |
| 465 | 3300046794 | Ga0495589_0075458 | Ga0495589_0075458_608_1189 | 193 |
| 466 | 3300046809 | Ga0495600_0000047 | Ga0495600_0000047_56843_57427 | 193 |
| 467 | 3300047315 | Ga0495581_0096959 | Ga0495581_0096959_600_1184 | 193 |
| 468 | 3300047315 | Ga0495581_0273549 | Ga0495581_0273549_333_914 | 193 |
| 469 | 3300047317 | Ga0495604_0000014 | Ga0495604_0000014_156975_157559 | 193 |
| 470 | 3300047317 | Ga0495604_0102754 | Ga0495604_0102754_237_818 | 193 |
| 471 | 3300047319 | Ga0495674_0000014 | Ga0495674_0000014_83681_84265 | 193 |
| 472 | 3300047319 | Ga0495674_0579888 | Ga0495674_0579888_60_641 | 193 |
| 473 | 3300047321 | Ga0495676_0083050 | Ga0495676_0083050_410_991 | 193 |
| 474 | 3300047321 | Ga0495676_0274664 | Ga0495676_0274664_152_733 | 193 |
| 475 | 3300047322 | Ga0495680_0000744 | Ga0495680_0000744_19446_20030 | 193 |
| 476 | 3300047323 | Ga0495683_0225369 | Ga0495683_0225369_26_607 | 193 |
| 477 | 3300047444 | Ga0495675_0000940 | Ga0495675_0000940_2891_3475 | 193 |
| 478 | 3300047444 | Ga0495675_0325914 | Ga0495675_0325914_45_626 | 193 |
| 479 | 3300047471 | Ga0495684_0000757 | Ga0495684_0000757_18975_19559 | 193 |
| 480 | 3300047673 | Ga0495593_0001967 | Ga0495593_0001967_7032_7616 | 193 |
| 481 | 3300048088 | Ga0495602_0000017 | Ga0495602_0000017_44287_44871 | 193 |
| 482 | 3300048088 | Ga0495602_0217652 | Ga0495602_0217652_390_971 | 193 |
| 483 | 3300048091 | Ga0495626_0167106 | Ga0495626_0167106_108_689 | 193 |
| 484 | 3300048903 | Ga0496100_0055698 | Ga0496100_0055698_889_1482 | 193 |
| 485 | 3300048903 | Ga0496100_0093571 | Ga0496100_0093571_617_1198 | 193 |
| 486 | 3300048904 | Ga0496101_0037064 | Ga0496101_0037064_561_1154 | 193 |
| 487 | 3300048905 | Ga0496102_0089466 | Ga0496102_0089466_303_896 | 193 |
| 488 | 3300048905 | Ga0496102_0274114 | Ga0496102_0274114_699_1292 | 193 |
| 489 | 3300048906 | Ga0496103_0170733 | Ga0496103_0170733_722_1303 | 193 |
| 490 | 3300048908 | Ga0496105_0078111 | Ga0496105_0078111_351_944 | 193 |
| 491 | 3300048909 | Ga0496106_0037953 | Ga0496106_0037953_1978_2571 | 193 |
| 492 | 3300048909 | Ga0496106_0222812 | Ga0496106_0222812_375_956 | 193 |
| 493 | 3300048910 | Ga0496107_0022620 | Ga0496107_0022620_3550_4143 | 193 |
| 494 | 3300048911 | Ga0496108_0052444 | Ga0496108_0052444_1637_2230 | 193 |
| 495 | 3300048911 | Ga0496108_0065122 | Ga0496108_0065122_214_795 | 193 |
| 496 | 3300048911 | Ga0496108_0795001 | Ga0496108_0795001_159_752 | 193 |
| 497 | 3300048912 | Ga0496109_0114270 | Ga0496109_0114270_1065_1658 | 193 |
| 498 | 3300048913 | Ga0496110_0011995 | Ga0496110_0011995_3021_3614 | 193 |
| 499 | 3300048913 | Ga0496110_0031673 | Ga0496110_0031673_87_710 | 193 |
| 500 | 3300048913 | Ga0496110_0041867 | Ga0496110_0041867_851_1432 | 193 |
| 501 | 3300048913 | Ga0496110_0342176 | Ga0496110_0342176_406_987 | 193 |
| 502 | 3300048914 | Ga0496111_0010982 | Ga0496111_0010982_4960_5553 | 193 |
| 503 | 3300048914 | Ga0496111_0086499 | Ga0496111_0086499_876_1457 | 193 |
| 504 | 3300048915 | Ga0496112_0015138 | Ga0496112_0015138_697_1290 | 193 |
| 505 | 3300048915 | Ga0496112_0152018 | Ga0496112_0152018_1408_1989 | 193 |
| 506 | 3300048915 | Ga0496112_0500568 | Ga0496112_0500568_342_935 | 193 |
| 507 | 3300048915 | Ga0496112_0513973 | Ga0496112_0513973_195_776 | 193 |
| 508 | 3300048916 | Ga0496113_0009785 | Ga0496113_0009785_4316_4897 | 193 |
| 509 | 3300048916 | Ga0496113_0018032 | Ga0496113_0018032_2731_3324 | 193 |
| 510 | 3300048916 | Ga0496113_0179053 | Ga0496113_0179053_636_1229 | 193 |
| 511 | 3300048917 | Ga0496114_0036700 | Ga0496114_0036700_612_1205 | 193 |
| 512 | 3300048917 | Ga0496114_0250758 | Ga0496114_0250758_782_1363 | 193 |
| 513 | 3300048918 | Ga0496115_0399405 | Ga0496115_0399405_299_892 | 193 |
| 514 | 3300049584 | Ga0501068_0238380 | Ga0501068_0238380_26_607 | 193 |
| 515 | 3300049585 | Ga0501069_0222550 | Ga0501069_0222550_290_871 | 193 |
| 516 | 3300049586 | Ga0501070_0199558 | Ga0501070_0199558_1001_1582 | 193 |
| 517 | 3300049588 | Ga0501072_0090375 | Ga0501072_0090375_744_1325 | 193 |
| 518 | 3300049588 | Ga0501072_0177184 | Ga0501072_0177184_926_1507 | 193 |
| 519 | 3300049742 | Ga0501080_0310247 | Ga0501080_0310247_106_696 | 193 |
| 520 | 3300049742 | Ga0501080_0403583 | Ga0501080_0403583_261_842 | 193 |
| 521 | 3300049742 | Ga0501080_0638912 | Ga0501080_0638912_19_600 | 193 |
| 522 | 3300049744 | Ga0501083_0420506 | Ga0501083_0420506_45_635 | 193 |
| 523 | 3300049744 | Ga0501083_0476488 | Ga0501083_0476488_145_726 | 193 |
| 524 | 3300050489 | nmdc:mga03683_108253_c1 | nmdc:mga03683_108253_c1_253_834 | 193 |
| 525 | 3300050491 | nmdc:mga00v17_477922_c1 | nmdc:mga00v17_477922_c1_22_603 | 193 |
| 526 | 3300050493 | nmdc:mga0k408_18964_c1 | nmdc:mga0k408_18964_c1_2792_3388 | 193 |
| 527 | 3300050493 | nmdc:mga0k408_36595_c1 | nmdc:mga0k408_36595_c1_324_905 | 193 |
| 528 | 3300050494 | nmdc:mga06z11_453092_c1 | nmdc:mga06z11_453092_c1_143_724 | 193 |
| 529 | 3300050494 | nmdc:mga06z11_719204_c1 | nmdc:mga06z11_719204_c1_14_595 | 193 |
| 530 | 3300050496 | nmdc:mga07m45_115129_c1 | nmdc:mga07m45_115129_c1_144_740 | 193 |
| 531 | 3300050507 | nmdc:mga05p37_1046633_c1 | nmdc:mga05p37_1046633_c1_83_664 | 193 |
| 532 | 3300050507 | nmdc:mga05p37_11064_c1 | nmdc:mga05p37_11064_c1_6779_7372 | 193 |
| 533 | 3300050507 | nmdc:mga05p37_1288121_c1 | nmdc:mga05p37_1288121_c1_30_611 | 193 |
| 534 | 3300050507 | nmdc:mga05p37_141777_c1 | nmdc:mga05p37_141777_c1_82_663 | 193 |
| 535 | 3300050507 | nmdc:mga05p37_704306_c1 | nmdc:mga05p37_704306_c1_122_703 | 193 |
| 536 | 3300050507 | nmdc:mga05p37_7481_c1 | nmdc:mga05p37_7481_c1_6635_7216 | 193 |
| 537 | 3300050508 | nmdc:mga09592_1529_c1 | nmdc:mga09592_1529_c1_16375_16956 | 193 |
| 538 | 3300050508 | nmdc:mga09592_395568_c1 | nmdc:mga09592_395568_c1_356_949 | 193 |
| 539 | 3300050509 | nmdc:mga0qj67_100924_c1 | nmdc:mga0qj67_100924_c1_1003_1596 | 193 |
| 540 | 3300050509 | nmdc:mga0qj67_189388_c1 | nmdc:mga0qj67_189388_c1_946_1527 | 193 |
| 541 | 3300050509 | nmdc:mga0qj67_473074_c1 | nmdc:mga0qj67_473074_c1_189_788 | 193 |
| 542 | 3300050510 | nmdc:mga06r32_108585_c1 | nmdc:mga06r32_108585_c1_564_1157 | 193 |
| 543 | 3300050510 | nmdc:mga06r32_770_c1 | nmdc:mga06r32_770_c1_27510_28091 | 193 |
| 544 | 3300050511 | nmdc:mga08y16_72_c1 | nmdc:mga08y16_72_c1_24319_24900 | 193 |
| 545 | 3300050511 | nmdc:mga08y16_815241_c1 | nmdc:mga08y16_815241_c1_194_775 | 193 |
| 546 | 3300050513 | nmdc:mga0rr50_262881_c1 | nmdc:mga0rr50_262881_c1_166_747 | 193 |
| 547 | 3300053077 | Ga0495601_0000016 | Ga0495601_0000016_44287_44871 | 193 |
| 548 | 3300053078 | Ga0495612_0000035 | Ga0495612_0000035_14132_14716 | 193 |
| 549 | 3300053083 | Ga0495655_0045352 | Ga0495655_0045352_497_1078 | 193 |
| 550 | 3300053084 | Ga0495595_0000032 | Ga0495595_0000032_38531_39115 | 193 |
| 551 | 3300053085 | Ga0495619_0000033 | Ga0495619_0000033_54632_55216 | 193 |
| 552 | 3300053130 | Ga0500642_0083927 | Ga0500642_0083927_481_1161 | 193 |
| 553 | 3300053139 | Ga0500568_0104190 | Ga0500568_0104190_52_633 | 193 |
| 554 | 3300053153 | Ga0500616_0023558 | Ga0500616_0023558_887_1468 | 193 |
| 555 | 3300053153 | Ga0500616_0125999 | Ga0500616_0125999_490_1071 | 193 |
| 556 | 3300060353 | Ga0501082_0161513 | Ga0501082_0161513_139_720 | 193 |
| 557 | 3300060353 | Ga0501082_0275090 | Ga0501082_0275090_227_808 | 193 |
| 558 | 3300060353 | Ga0501082_0752153 | Ga0501082_0752153_149_730 | 193 |
| 559 | 3300061734 | Ga0530510_0586771 | Ga0530510_0586771_192_797 | 193 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fzv-assembly1.cif.gz_B | crystal structure of an apo form of a flavin-binding protein from shigella flexneri | 0.8982 | 3 | 192 |
| 2q62-assembly2.cif.gz_F | crystal structure of arsh from sinorhizobium meliloti | 0.8932 | 1 | 191 |
| 2q62-assembly1.cif.gz_D | crystal structure of arsh from sinorhizobium meliloti | 0.8911 | 1 | 191 |
| 7ple-assembly1.cif.gz_D | arsh of paracoccus denitrificans | 0.8866 | 1 | 192 |
| 2fzv-assembly1.cif.gz_D | crystal structure of an apo form of a flavin-binding protein from shigella flexneri | 0.885 | 4 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2q62A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.887 | 3 | 191 | 3.40.50.360 |
| 2fzvC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8763 | 4 | 192 | 3.40.50.360 |
| 3svlA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.855 | 4 | 193 | 3.40.50.360 |
| 1x77B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8525 | 5 | 185 | 3.40.50.360 |
| 3svlA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8464 | 4 | 193 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A327JJF4-F1-model_v4 | NADPH-dependent FMN reductase | 0.9833 | 1 | 193 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A2S0N8G6-F1-model_v4 | NADPH-dependent FMN reductase | 0.983 | 3 | 193 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A844T9G7-F1-model_v4 | NADPH-dependent FMN reductase | 0.9782 | 1 | 193 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A327JJF4-F1-model_v4 | NADPH-dependent FMN reductase | 0.9782 | 1 | 193 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A2S0N8G6-F1-model_v4 | NADPH-dependent FMN reductase | 0.9779 | 3 | 193 |
GO:0005829
GO:0010181 GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar