F463521

General Info

Members Datasets Scaffolds Average Seq Length
559 364 556 193

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10003511|JGI25153J46596_100035111
Length 234
Sequence MKARPAPDQHPGPMNHAWRLNPATMTEDGAYVSGHEALSSPMSVPKILVFAGSIRTGSFNARLAALAAKELATAGAEVTRLSLEDYPLPLYDGDEEQNNGAPAHAQNLKSMMAAHQGVFIASPEYNASVTPLLKNAIDWISRVRARDEAPLAAFKHRVFAIGGASNSPYGALRSLMALRQILELGCGALVLPEQITVFHASEAFDEMDNLKDERAAATLKRIALRLIETAQEFA

Samples

Sample ID Description Type Environment
1 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
2 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
3 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
191 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
192 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
193 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
194 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
231 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
283 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
357 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
358 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
359 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
360 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
361 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.16
Nodule 0.36
Rhizoplane 5.55
Rhizosphere 86.23
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10009031 3300001991 Bacteria 1760
2 JGI24750J21931_1026476 3300002070 Bacteria 836
3 JGI24748J21848_1014063 3300002074 Bacteria 949
4 JGI24738J21930_10008382 3300002075 Bacteria 2353
5 JGI24034J26672_10023034 3300002239 Bacteria 987
6 JGI24742J22300_10016360 3300002244 Bacteria 1251
7 JGI25153J46596_10003511 3300003215 Bacteria 8751
8 rootH1_10340175 3300003323 Bacteria 1404
9 JGI25404J52841_10005112 3300003659 Bacteria 2701
10 Ga0070658_10472526 3300005327 Bacteria 1082
11 Ga0070676_10024134 3300005328 Bacteria 3423
12 Ga0070676_10048465 3300005328 Bacteria 2484
13 Ga0070676_10270999 3300005328 Bacteria 1140
14 Ga0070690_100012963 3300005330 Bacteria 4915
15 Ga0070690_100075279 3300005330 Bacteria 2201
16 Ga0070670_100039720 3300005331 Bacteria 4046
17 Ga0070670_100273600 3300005331 Bacteria 1474
18 Ga0068869_100136162 3300005334 Bacteria 1892
19 Ga0068869_100304002 3300005334 Bacteria 1289
20 Ga0070666_10063657 3300005335 Bacteria 2500
21 Ga0070680_100003095 3300005336 Bacteria 12348
22 Ga0070680_100015789 3300005336 Bacteria 5928
23 Ga0070682_100000325 3300005337 Bacteria 32746
24 Ga0070660_100347140 3300005339 Bacteria 1222
25 Ga0070689_100002497 3300005340 Bacteria 12027
26 Ga0070689_100274023 3300005340 Bacteria 1398
27 Ga0070689_100364617 3300005340 Bacteria 1214
28 Ga0070687_100013158 3300005343 Bacteria 3677
29 Ga0070687_100092060 3300005343 Bacteria 1679
30 Ga0070661_100182304 3300005344 Bacteria 1598
31 Ga0070692_10090012 3300005345 Bacteria 1667
32 Ga0070668_100137517 3300005347 Bacteria 1966
33 Ga0070668_100319694 3300005347 Bacteria 1306
34 Ga0070669_100032417 3300005353 Bacteria 3774
35 Ga0070675_100012297 3300005354 Bacteria 6708
36 Ga0070675_100118895 3300005354 Bacteria 2244
37 Ga0070671_100050205 3300005355 Bacteria 3470
38 Ga0070671_100772848 3300005355 Bacteria 835
39 Ga0070674_100067283 3300005356 Bacteria 2519
40 Ga0070688_100030935 3300005365 Bacteria 3216
41 Ga0070688_100110863 3300005365 Bacteria 1824
42 Ga0070659_100069353 3300005366 Bacteria 2798
43 Ga0070659_100124101 3300005366 Bacteria 2094
44 Ga0070667_100338176 3300005367 Bacteria 1361
45 Ga0070709_10094443 3300005434 Bacteria 1979
46 Ga0070714_100468338 3300005435 Bacteria 1198
47 Ga0070714_101231419 3300005435 Unclassified 730
48 Ga0070713_100258687 3300005436 Unclassified 1590
49 Ga0070701_10019160 3300005438 Bacteria 3230
50 Ga0070711_100092376 3300005439 Bacteria 2184
51 Ga0070705_100045847 3300005440 Bacteria 2518
52 Ga0070705_100261519 3300005440 Bacteria 1221
53 Ga0070700_100068127 3300005441 Bacteria 2262
54 Ga0070700_100159793 3300005441 Bacteria 1550
55 Ga0070694_100158349 3300005444 Bacteria 1659
56 Ga0070694_100871311 3300005444 Bacteria 742
57 Ga0070708_100055171 3300005445 Bacteria 3533
58 Ga0070708_100499177 3300005445 Bacteria 1148
59 Ga0070663_100064406 3300005455 Bacteria 2649
60 Ga0070663_100827547 3300005455 Bacteria 795
61 Ga0070678_100096593 3300005456 Bacteria 2280
62 Ga0070678_100293832 3300005456 Bacteria 1378
63 Ga0070681_10035240 3300005458 Bacteria 5027
64 Ga0070681_11233289 3300005458 Bacteria 670
65 Ga0068867_100174763 3300005459 Bacteria 1703
66 Ga0070685_10017184 3300005466 Bacteria 3869
67 Ga0070685_10693474 3300005466 Bacteria 742
68 Ga0070706_101246556 3300005467 Bacteria 683
69 Ga0070707_100310223 3300005468 Bacteria 1533
70 Ga0070698_101200642 3300005471 Bacteria 708
71 Ga0070699_100002955 3300005518 Bacteria 15110
72 Ga0070699_100032876 3300005518 Bacteria 4481
73 Ga0070679_100012384 3300005530 Bacteria 8149
74 Ga0070679_100060942 3300005530 Bacteria 3761
75 Ga0070679_100254907 3300005530 Bacteria 1710
76 Ga0070679_100256870 3300005530 Bacteria 1703
77 Ga0070684_101096479 3300005535 Bacteria 748
78 Ga0070697_100000575 3300005536 Bacteria 27699
79 Ga0070697_101184663 3300005536 Bacteria 681
80 Ga0070697_101208577 3300005536 Bacteria 674
81 Ga0068853_100000927 3300005539 Bacteria 20513
82 Ga0068853_100128934 3300005539 Bacteria 2262
83 Ga0070686_100043848 3300005544 Bacteria 2808
84 Ga0070695_100001268 3300005545 Bacteria 13912
85 Ga0070696_100002501 3300005546 Bacteria 12179
86 Ga0070693_100052489 3300005547 Bacteria 2338
87 Ga0070693_100514913 3300005547 Bacteria 851
88 Ga0070665_100100164 3300005548 Bacteria 2901
89 Ga0068855_100048834 3300005563 Bacteria 4994
90 Ga0070664_100108885 3300005564 Bacteria 2416
91 Ga0068857_100206619 3300005577 Bacteria 1791
92 Ga0068857_100494729 3300005577 Bacteria 1147
93 Ga0068854_100058866 3300005578 Bacteria 2775
94 Ga0068854_100091106 3300005578 Bacteria 2268
95 Ga0068856_100123319 3300005614 Bacteria 2594
96 Ga0068852_100078655 3300005616 Bacteria 2918
97 Ga0068859_100223071 3300005617 Bacteria 1972
98 Ga0068859_100467607 3300005617 Bacteria 1357
99 Ga0068864_100069183 3300005618 Bacteria 3069
100 Ga0068864_100282826 3300005618 Bacteria 1549
101 Ga0068866_10074830 3300005718 Bacteria 1801
102 Ga0068861_100352443 3300005719 Bacteria 1291
103 Ga0068851_10069123 3300005834 Bacteria 1824
104 Ga0068870_10218076 3300005840 Bacteria 1166
105 Ga0068870_10373898 3300005840 Bacteria 920
106 Ga0068863_100202577 3300005841 Bacteria 1909
107 Ga0068858_100370867 3300005842 Bacteria 1373
108 Ga0068860_100160483 3300005843 Bacteria 2168
109 Ga0068862_100366781 3300005844 Bacteria 1339
110 Ga0081455_10033713 3300005937 Bacteria 4597
111 Ga0081540_1000055 3300005983 Bacteria 122642
112 Ga0070717_10223604 3300006028 Bacteria 1655
113 Ga0070717_10288046 3300006028 Bacteria 1458
114 Ga0075365_10023018 3300006038 Bacteria 3913
115 Ga0075365_10073525 3300006038 Bacteria 2304
116 Ga0075368_10030936 3300006042 Bacteria 2074
117 Ga0075368_10047079 3300006042 Bacteria 1707
118 Ga0075368_10069330 3300006042 Bacteria 1422
119 Ga0075363_100050314 3300006048 Bacteria 2220
120 Ga0075363_100107026 3300006048 Bacteria 1551
121 Ga0070715_10016951 3300006163 Bacteria 2748
122 Ga0070716_100072370 3300006173 Bacteria 2030
123 Ga0070716_100526540 3300006173 Bacteria 877
124 Ga0070712_100347611 3300006175 Bacteria 1213
125 Ga0070712_100368640 3300006175 Bacteria 1180
126 Ga0075362_10171586 3300006177 Bacteria 1048
127 Ga0075362_10236541 3300006177 Bacteria 896
128 Ga0075367_10034925 3300006178 Bacteria 2907
129 Ga0075367_10092774 3300006178 Bacteria 1838
130 Ga0075367_10230677 3300006178 Bacteria 1159
131 Ga0075369_10043986 3300006186 Bacteria 1918
132 Ga0075366_10010892 3300006195 Bacteria 5116
133 Ga0075366_10055659 3300006195 Bacteria 2349
134 Ga0075366_10093845 3300006195 Bacteria 1798
135 Ga0097621_100015369 3300006237 Bacteria 5757
136 Ga0075370_10056904 3300006353 Bacteria 2222
137 Ga0075370_10272941 3300006353 Bacteria 1004
138 Ga0068871_100049571 3300006358 Bacteria 3394
139 Ga0075428_101123297 3300006844 Bacteria 830
140 Ga0075430_100051434 3300006846 Bacteria 3472
141 Ga0075430_100081665 3300006846 Bacteria 2708
142 Ga0075431_100004553 3300006847 Bacteria 13616
143 Ga0075431_100009653 3300006847 Bacteria 9694
144 Ga0075434_100102227 3300006871 Bacteria 2874
145 Ga0075434_100222783 3300006871 Bacteria 1906
146 Ga0075429_100002407 3300006880 Bacteria 15758
147 Ga0068865_100290688 3300006881 Bacteria 1304
148 Ga0075436_100001283 3300006914 Bacteria 17053
149 Ga0097620_100223062 3300006931 Bacteria 1972
150 Ga0097620_100467637 3300006931 Bacteria 1357
151 Ga0075435_100021345 3300007076 Bacteria 4979
152 Ga0075435_100038099 3300007076 Bacteria 3832
153 Ga0075435_100181102 3300007076 Bacteria 1781
154 Ga0075435_100213776 3300007076 Bacteria 1636
155 Ga0075435_100493941 3300007076 Bacteria 1058
156 Ga0099794_10008881 3300007265 Bacteria 4189
157 Ga0111539_10000115 3300009094 Bacteria 88645
158 Ga0111539_11186865 3300009094 Unclassified 887
159 Ga0105245_10251526 3300009098 Bacteria 1717
160 Ga0105247_10042175 3300009101 Bacteria 2793
161 Ga0114129_10001209 3300009147 Bacteria 34278
162 Ga0114129_12383619 3300009147 Bacteria 634
163 Ga0105241_10020240 3300009174 Bacteria 4915
164 Ga0105241_10376914 3300009174 Bacteria 1239
165 Ga0105241_10501671 3300009174 Bacteria 1082
166 Ga0105242_10123745 3300009176 Bacteria 2223
167 Ga0105242_10143987 3300009176 Bacteria 2071
168 Ga0105248_10001877 3300009177 Bacteria 23303
169 Ga0105248_10153813 3300009177 Bacteria 2595
170 Ga0105248_10629027 3300009177 Bacteria 1211
171 Ga0105237_10649263 3300009545 Bacteria 1062
172 Ga0105238_10256873 3300009551 Bacteria 1726
173 Ga0105249_10011613 3300009553 Bacteria 7741
174 Ga0105249_10116782 3300009553 Bacteria 2530
175 Ga0105239_11371755 3300010375 Bacteria 816
176 Ga0105246_10440191 3300011119 Bacteria 1093
177 Ga0157373_10004101 3300013100 Bacteria 10980
178 Ga0157370_10083016 3300013104 Bacteria 3013
179 Ga0157378_10737990 3300013297 Bacteria 1007
180 Ga0163162_10946030 3300013306 Bacteria 973
181 Ga0163162_10967588 3300013306 Bacteria 962
182 Ga0157372_10002662 3300013307 Bacteria 19349
183 Ga0157375_10524371 3300013308 Bacteria 1348
184 Ga0157375_10796739 3300013308 Bacteria 1094
185 Ga0163163_10129437 3300014325 Bacteria 2564
186 Ga0163163_10405805 3300014325 Bacteria 1421
187 Ga0157380_10039978 3300014326 Bacteria 3650
188 Ga0157380_10107014 3300014326 Bacteria 2341
189 Ga0157380_10212543 3300014326 Bacteria 1725
190 Ga0157380_10321492 3300014326 Bacteria 1435
191 Ga0182008_10049039 3300014497 Bacteria 2096
192 Ga0157377_10176041 3300014745 Bacteria 1341
193 Ga0157377_10984796 3300014745 Bacteria 637
194 Ga0157379_10364366 3300014968 Bacteria 1325
195 Ga0157376_10739060 3300014969 Bacteria 992
196 Ga0163161_10184409 3300017792 Bacteria 1602
197 Ga0209758_1005755 3300025297 Bacteria 9322
198 Ga0209758_1017976 3300025297 Bacteria 3490
199 Ga0207426_1061834 3300025302 Bacteria 1074
200 Ga0207697_10085266 3300025315 Bacteria 1334
201 Ga0207653_10010065 3300025885 Bacteria 2950
202 Ga0207692_10059981 3300025898 Bacteria 1966
203 Ga0207692_10081593 3300025898 Bacteria 1731
204 Ga0207642_10697826 3300025899 Bacteria 639
205 Ga0207710_10015124 3300025900 Bacteria 3259
206 Ga0207688_10010751 3300025901 Bacteria 4980
207 Ga0207647_10038007 3300025904 Bacteria 3047
208 Ga0207699_10052946 3300025906 Bacteria 2405
209 Ga0207699_10144393 3300025906 Bacteria 1567
210 Ga0207645_10005075 3300025907 Bacteria 9643
211 Ga0207645_10055111 3300025907 Bacteria 2539
212 Ga0207643_10000750 3300025908 Bacteria 19910
213 Ga0207705_10371453 3300025909 Bacteria 1104
214 Ga0207684_10008184 3300025910 Bacteria 9315
215 Ga0207684_10224057 3300025910 Bacteria 1623
216 Ga0207671_10154088 3300025914 Bacteria 1777
217 Ga0207693_10075172 3300025915 Bacteria 2646
218 Ga0207693_10217124 3300025915 Bacteria 1503
219 Ga0207693_10326141 3300025915 Bacteria 1202
220 Ga0207693_10662213 3300025915 Bacteria 810
221 Ga0207663_10039076 3300025916 Bacteria 2873
222 Ga0207660_10522352 3300025917 Bacteria 964
223 Ga0207662_10104128 3300025918 Bacteria 1762
224 Ga0207662_10249088 3300025918 Bacteria 1165
225 Ga0207657_10027857 3300025919 Bacteria 5167
226 Ga0207657_10083020 3300025919 Bacteria 2688
227 Ga0207649_10097941 3300025920 Bacteria 1935
228 Ga0207652_10022341 3300025921 Bacteria 5232
229 Ga0207652_10115663 3300025921 Bacteria 2382
230 Ga0207652_10427474 3300025921 Bacteria 1194
231 Ga0207681_10084609 3300025923 Bacteria 2249
232 Ga0207681_10232934 3300025923 Bacteria 1430
233 Ga0207681_10235750 3300025923 Bacteria 1422
234 Ga0207650_10034322 3300025925 Bacteria 3679
235 Ga0207650_10153059 3300025925 Bacteria 1821
236 Ga0207687_10138128 3300025927 Bacteria 1846
237 Ga0207687_10710358 3300025927 Bacteria 854
238 Ga0207700_10091514 3300025928 Bacteria 2403
239 Ga0207664_10019573 3300025929 Bacteria 5005
240 Ga0207664_10282955 3300025929 Bacteria 1455
241 Ga0207664_10993684 3300025929 Bacteria 752
242 Ga0207644_10044390 3300025931 Bacteria 3158
243 Ga0207690_10087436 3300025932 Bacteria 2193
244 Ga0207690_10427980 3300025932 Bacteria 1060
245 Ga0207706_10001078 3300025933 Bacteria 27712
246 Ga0207670_10041282 3300025936 Bacteria 3033
247 Ga0207665_10240500 3300025939 Bacteria 1333
248 Ga0207665_10635228 3300025939 Bacteria 836
249 Ga0207691_10048712 3300025940 Bacteria 3883
250 Ga0207711_10039770 3300025941 Bacteria 4000
251 Ga0207711_10335528 3300025941 Bacteria 1399
252 Ga0207711_10687679 3300025941 Bacteria 954
253 Ga0207689_10024160 3300025942 Bacteria 5098
254 Ga0207679_10965816 3300025945 Bacteria 780
255 Ga0207667_10058679 3300025949 Bacteria 4035
256 Ga0207712_10010202 3300025961 Bacteria 5957
257 Ga0207712_10086384 3300025961 Bacteria 2298
258 Ga0207668_10066897 3300025972 Bacteria 2549
259 Ga0207668_10082714 3300025972 Bacteria 2333
260 Ga0207668_10222492 3300025972 Bacteria 1517
261 Ga0207668_10268786 3300025972 Bacteria 1393
262 Ga0207640_10050921 3300025981 Bacteria 2689
263 Ga0207640_10714930 3300025981 Bacteria 860
264 Ga0207658_10055253 3300025986 Bacteria 2942
265 Ga0207677_10317562 3300026023 Bacteria 1293
266 Ga0207703_10152965 3300026035 Bacteria 2013
267 Ga0207639_10003746 3300026041 Bacteria 10232
268 Ga0207678_10015782 3300026067 Bacteria 6639
269 Ga0207678_10132268 3300026067 Bacteria 2129
270 Ga0207708_10001622 3300026075 Bacteria 16749
271 Ga0207708_10095246 3300026075 Bacteria 2299
272 Ga0207702_10578073 3300026078 Bacteria 1101
273 Ga0207648_10050674 3300026089 Bacteria 3630
274 Ga0207676_10169336 3300026095 Bacteria 1901
275 Ga0207674_10050397 3300026116 Bacteria 4253
276 Ga0207675_100001067 3300026118 Bacteria 27209
277 Ga0207683_10005165 3300026121 Bacteria 11207
278 Ga0207683_10022355 3300026121 Bacteria 5428
279 Ga0209588_1014647 3300027671 Bacteria 2403
280 Ga0207428_10002405 3300027907 Bacteria 18695
281 Ga0268266_10397313 3300028379 Bacteria 1303
282 Ga0268266_10552514 3300028379 Bacteria 1103
283 Ga0268265_10033539 3300028380 Bacteria 3734
284 Ga0268265_10871062 3300028380 Bacteria 882
285 Ga0268264_10369646 3300028381 Bacteria 1370
286 Ga0316575_10149685 3300031665 Bacteria 963
287 Ga0265314_10039578 3300031711 Bacteria 3394
288 Ga0316578_10096671 3300031728 Bacteria 1768
289 Ga0307413_10193624 3300031824 Bacteria 1462
290 Ga0307409_101447066 3300031995 Bacteria 714
291 Ga0316585_10052198 3300032137 Bacteria 1314
292 Ga0373930_0018118 3300034816 Bacteria 1350
293 Ga0373938_0033522 3300034957 Bacteria 1111
294 Ga0373926_0015325 3300035083 Bacteria 2613
295 Ga0373926_0077305 3300035083 Bacteria 1228
296 Ga0373929_0007021 3300035085 Bacteria 2048
297 Ga0373944_0017827 3300035089 Bacteria 2020
298 Ga0373951_0101775 3300035091 Bacteria 764
299 Ga0373923_0000926 3300035111 Bacteria 7838
300 Ga0373932_0045086 3300035112 Bacteria 1288
301 Ga0373932_0063721 3300035112 Bacteria 1127
302 Ga0373936_0002444 3300035113 Bacteria 6950
303 Ga0373936_0078703 3300035113 Bacteria 1369
304 Ga0373939_0005192 3300035114 Bacteria 3094
305 Ga0373941_0022184 3300035115 Bacteria 1799
306 Ga0373945_0012501 3300035116 Bacteria 2821
307 Ga0373945_0098513 3300035116 Bacteria 1141
308 Ga0373953_0000743 3300035117 Bacteria 9035
309 Ga0373954_0021148 3300035118 Bacteria 2944
310 Ga0373957_0007156 3300035120 Bacteria 3558
311 Ga0373960_0036916 3300035121 Bacteria 1394
312 Ga0373960_0082702 3300035121 Bacteria 1014
313 Ga0373943_0003686 3300035170 Bacteria 6965
314 Ga0373943_0032339 3300035170 Bacteria 2486
315 Ga0373946_0000588 3300035171 Bacteria 12009
316 Ga0373955_0000346 3300035172 Bacteria 19457
317 Ga0373961_0013177 3300035241 Bacteria 2080
318 Ga0316574_0006930 3300035398 Bacteria 6170
319 Ga0316574_0175133 3300035398 Bacteria 1381
320 Ga0373924_0015064 3300035410 Bacteria 2931
321 Ga0373931_0009934 3300035691 Bacteria 4560
322 Ga0373931_0015382 3300035691 Bacteria 3752
323 Ga0373931_0353752 3300035691 Bacteria 920
324 Ga0373935_0000056 3300035692 Bacteria 46025
325 Ga0373935_0397388 3300035692 Bacteria 989
326 Ga0373927_0005062 3300035695 Bacteria 9123
327 Ga0373927_0291200 3300035695 Bacteria 1074
328 Ga0373933_0028287 3300035724 Bacteria 3233
329 Ga0373933_0167144 3300035724 Bacteria 1399
330 Ga0373933_0760332 3300035724 Bacteria 638
331 Ga0373947_0007138 3300035725 Bacteria 6478
332 Ga0373947_0200452 3300035725 Bacteria 1305
333 Ga0373937_0000075 3300036401 Bacteria 89727
334 Ga0316584_0071826 3300036712 Bacteria 2593
335 Ga0373925_0000159 3300037068 Bacteria 72851
336 Ga0373925_0037415 3300037068 Bacteria 3583
337 Ga0395899_0463047 3300037312 Unclassified 828
338 Ga0395898_0718433 3300037466 Bacteria 941
339 Ga0395898_0984529 3300037466 Bacteria 779
340 Ga0395905_0037065 3300037471 Bacteria 4580
341 Ga0436364_0268901 3300037853 Bacteria 819
342 Ga0436364_0880057 3300037853 Bacteria 1577
343 Ga0395901_0182931 3300038443 Bacteria 2198
344 Ga0436361_0109240 3300039447 Bacteria 8125
345 Ga0451807_1895779 3300041486 Bacteria 1357
346 Ga0451837_0444460 3300041494 Bacteria 856
347 Ga0451576_0014115 3300045051 Bacteria 8903
348 Ga0495617_109768 3300046452 Bacteria 893
349 Ga0495627_065943 3300046453 Bacteria 1064
350 Ga0495592_0000102 3300046454 Bacteria 75767
351 Ga0495603_0033794 3300046455 Bacteria 3076
352 Ga0495590_0052249 3300046457 Bacteria 1428
353 Ga0495629_0012813 3300046459 Bacteria 6068
354 Ga0495641_0026393 3300046461 Bacteria 2834
355 Ga0495651_0017925 3300046462 Bacteria 5483
356 Ga0495653_0000036 3300046463 Bacteria 129776
357 Ga0495605_0159024 3300046474 Bacteria 1004
358 Ga0495639_0103935 3300046475 Bacteria 1343
359 Ga0495639_0144649 3300046475 Bacteria 1144
360 Ga0495662_0004822 3300046476 Bacteria 6761
361 Ga0495664_0000016 3300046477 Bacteria 175933
362 Ga0495584_0095952 3300046491 Bacteria 1497
363 Ga0495585_0043789 3300046492 Bacteria 2502
364 Ga0495594_0281126 3300046499 Bacteria 948
365 Ga0495596_0150432 3300046500 Bacteria 904
366 Ga0495608_0000006 3300046511 Bacteria 324334
367 Ga0495616_0053236 3300046513 Bacteria 2012
368 Ga0495618_0000057 3300046514 Bacteria 80298
369 Ga0495620_0054031 3300046515 Bacteria 1699
370 Ga0495628_0000018 3300046516 Bacteria 169916
371 Ga0495630_0001707 3300046517 Bacteria 15337
372 Ga0495632_0218766 3300046519 Bacteria 862
373 Ga0495644_0018613 3300046523 Bacteria 2653
374 Ga0495642_0180127 3300046528 Bacteria 920
375 Ga0495652_0000005 3300046529 Bacteria 524368
376 Ga0495652_0283167 3300046529 Bacteria 1213
377 Ga0495652_0308637 3300046529 Bacteria 1147
378 Ga0495665_0079367 3300046531 Bacteria 1727
379 Ga0495640_0000007 3300046533 Bacteria 265481
380 Ga0495586_0078797 3300046535 Bacteria 1808
381 Ga0495587_0000043 3300046536 Bacteria 109717
382 Ga0495598_0053798 3300046537 Bacteria 1220
383 Ga0495598_0056399 3300046537 Bacteria 1199
384 Ga0495609_0202264 3300046538 Bacteria 830
385 Ga0495645_0000064 3300046543 Bacteria 74490
386 Ga0495622_0166860 3300046557 Bacteria 991
387 Ga0495667_0000023 3300046559 Bacteria 169343
388 Ga0495656_0270534 3300046615 Bacteria 863
389 Ga0495634_0000049 3300046642 Bacteria 95428
390 Ga0495625_0426327 3300046660 Unclassified 824
391 Ga0495635_0000021 3300046663 Bacteria 164643
392 Ga0495659_0109287 3300046664 Bacteria 1078
393 Ga0495588_0062749 3300046674 Bacteria 1926
394 Ga0495657_0000063 3300046675 Bacteria 94380
395 Ga0495599_0000001 3300046678 Bacteria 537563
396 Ga0495623_0000056 3300046679 Bacteria 69307
397 Ga0495646_0000007 3300046680 Bacteria 236764
398 Ga0495647_0124184 3300046681 Bacteria 1088
399 Ga0495647_0177506 3300046681 Bacteria 925
400 Ga0495658_0100945 3300046683 Bacteria 1722
401 Ga0495658_0224286 3300046683 Bacteria 1177
402 Ga0495669_0147390 3300046684 Bacteria 1113
403 Ga0495613_0129409 3300046689 Bacteria 1808
404 Ga0495613_0194255 3300046689 Bacteria 1433
405 Ga0495624_0014420 3300046690 Bacteria 5363
406 Ga0495624_0290519 3300046690 Bacteria 986
407 Ga0495670_0110496 3300046691 Bacteria 1422
408 Ga0495671_0221863 3300046692 Bacteria 915
409 Ga0495589_0075458 3300046794 Bacteria 1644
410 Ga0495600_0000047 3300046809 Bacteria 71546
411 Ga0495581_0096959 3300047315 Bacteria 1712
412 Ga0495581_0273549 3300047315 Bacteria 987
413 Ga0495604_0000014 3300047317 Bacteria 205481
414 Ga0495604_0102754 3300047317 Bacteria 2098
415 Ga0495674_0000014 3300047319 Bacteria 241211
416 Ga0495674_0579888 3300047319 Bacteria 890
417 Ga0495676_0083050 3300047321 Bacteria 2422
418 Ga0495676_0274664 3300047321 Bacteria 1142
419 Ga0495680_0000744 3300047322 Bacteria 36481
420 Ga0495683_0225369 3300047323 Bacteria 834
421 Ga0495675_0000940 3300047444 Bacteria 17639
422 Ga0495675_0325914 3300047444 Bacteria 908
423 Ga0495684_0000757 3300047471 Bacteria 26052
424 Ga0495593_0001967 3300047673 Bacteria 12237
425 Ga0495602_0000017 3300048088 Bacteria 184180
426 Ga0495602_0217652 3300048088 Bacteria 1444
427 Ga0495626_0167106 3300048091 Bacteria 919
428 Ga0496100_0055698 3300048903 Bacteria 2584
429 Ga0496100_0093571 3300048903 Bacteria 2056
430 Ga0496101_0037064 3300048904 Bacteria 3457
431 Ga0496102_0089466 3300048905 Bacteria 2848
432 Ga0496102_0274114 3300048905 Bacteria 1590
433 Ga0496103_0170733 3300048906 Bacteria 1396
434 Ga0496105_0078111 3300048908 Bacteria 2733
435 Ga0496106_0037953 3300048909 Bacteria 3604
436 Ga0496106_0222812 3300048909 Bacteria 1504
437 Ga0496107_0022620 3300048910 Bacteria 4442
438 Ga0496108_0052444 3300048911 Bacteria 3418
439 Ga0496108_0065122 3300048911 Bacteria 3071
440 Ga0496108_0795001 3300048911 Bacteria 816
441 Ga0496109_0114270 3300048912 Bacteria 2511
442 Ga0496110_0011995 3300048913 Bacteria 7119
443 Ga0496110_0031673 3300048913 Bacteria 4563
444 Ga0496110_0041867 3300048913 Bacteria 3998
445 Ga0496110_0342176 3300048913 Bacteria 1362
446 Ga0496111_0010982 3300048914 Bacteria 6093
447 Ga0496111_0086499 3300048914 Bacteria 2293
448 Ga0496112_0015138 3300048915 Bacteria 7187
449 Ga0496112_0152018 3300048915 Bacteria 2282
450 Ga0496112_0500568 3300048915 Bacteria 1150
451 Ga0496112_0513973 3300048915 Bacteria 1132
452 Ga0496113_0009785 3300048916 Bacteria 6304
453 Ga0496113_0018032 3300048916 Bacteria 4911
454 Ga0496113_0179053 3300048916 Bacteria 1680
455 Ga0496114_0036700 3300048917 Bacteria 4052
456 Ga0496114_0250758 3300048917 Bacteria 1557
457 Ga0496115_0399405 3300048918 Bacteria 1115
458 Ga0501033_0030449 3300049570 Bacteria 4055
459 Ga0501033_0065141 3300049570 Bacteria 2681
460 Ga0501034_0082307 3300049571 Bacteria 3220
461 Ga0501034_0165013 3300049571 Bacteria 2184
462 Ga0501034_0206618 3300049571 Bacteria 1920
463 Ga0501034_0208283 3300049571 Bacteria 1911
464 Ga0501036_0010028 3300049572 Bacteria 7802
465 Ga0501037_0001321 3300049573 Bacteria 18192
466 Ga0501038_0038701 3300049574 Bacteria 4174
467 Ga0501039_0001190 3300049575 Bacteria 19064
468 Ga0501039_0565878 3300049575 Bacteria 892
469 Ga0501041_0382146 3300049577 Bacteria 891
470 Ga0501042_0051482 3300049578 Bacteria 2937
471 Ga0501042_0487882 3300049578 Bacteria 894
472 Ga0501043_0053079 3300049579 Bacteria 3183
473 Ga0501046_0001578 3300049580 Bacteria 21792
474 Ga0501047_0095548 3300049581 Bacteria 2851
475 Ga0501047_0542765 3300049581 Bacteria 987
476 Ga0501048_0004769 3300049582 Bacteria 10329
477 Ga0501067_0026419 3300049583 Bacteria 3216
478 Ga0501067_0030473 3300049583 Bacteria 2991
479 Ga0501068_0158125 3300049584 Bacteria 1427
480 Ga0501068_0238380 3300049584 Bacteria 1157
481 Ga0501069_0003295 3300049585 Bacteria 8283
482 Ga0501069_0222550 3300049585 Bacteria 1097
483 Ga0501070_0199558 3300049586 Bacteria 1643
484 Ga0501071_0191374 3300049587 Bacteria 1534
485 Ga0501072_0090375 3300049588 Bacteria 2431
486 Ga0501072_0154996 3300049588 Bacteria 1827
487 Ga0501072_0177184 3300049588 Bacteria 1700
488 Ga0501072_0556304 3300049588 Bacteria 906
489 Ga0501074_0001331 3300049590 Bacteria 16408
490 Ga0501074_0070396 3300049590 Bacteria 2515
491 Ga0501075_0020600 3300049591 Bacteria 4799
492 Ga0501075_0390627 3300049591 Bacteria 1061
493 Ga0501076_0020819 3300049592 Bacteria 5023
494 Ga0501077_0005773 3300049593 Bacteria 7540
495 Ga0501079_0010726 3300049741 Bacteria 6978
496 Ga0501079_0152864 3300049741 Bacteria 1799
497 Ga0501080_0310247 3300049742 Bacteria 1430
498 Ga0501080_0403583 3300049742 Bacteria 1229
499 Ga0501080_0638912 3300049742 Bacteria 942
500 Ga0501081_0006524 3300049743 Bacteria 7578
501 Ga0501081_0105874 3300049743 Bacteria 1993
502 Ga0501083_0038410 3300049744 Bacteria 3255
503 Ga0501083_0420506 3300049744 Bacteria 870
504 Ga0501083_0476488 3300049744 Bacteria 812
505 Ga0501044_0000122 3300049823 Bacteria 93246
506 nmdc:mga03683_108253_c1 3300050489 Bacteria 1226
507 nmdc:mga00v17_477922_c1 3300050491 Bacteria 808
508 nmdc:mga0k408_18964_c1 3300050493 Bacteria 3841
509 nmdc:mga0k408_36595_c1 3300050493 Bacteria 2817
510 nmdc:mga06z11_140292_c1 3300050494 Bacteria 1366
511 nmdc:mga06z11_453092_c1 3300050494 Bacteria 775
512 nmdc:mga06z11_719204_c1 3300050494 Bacteria 608
513 nmdc:mga06z11_99859_c1 3300050494 Bacteria 1591
514 nmdc:mga07m45_115129_c1 3300050496 Bacteria 1550
515 nmdc:mga05p37_1046633_c1 3300050507 Bacteria 861
516 nmdc:mga05p37_11064_c1 3300050507 Bacteria 10720
517 nmdc:mga05p37_1288121_c1 3300050507 Bacteria 746
518 nmdc:mga05p37_141777_c1 3300050507 Bacteria 2944
519 nmdc:mga05p37_704306_c1 3300050507 Bacteria 1121
520 nmdc:mga05p37_7481_c1 3300050507 Bacteria 12877
521 nmdc:mga09592_1529_c1 3300050508 Bacteria 18637
522 nmdc:mga09592_395568_c1 3300050508 Bacteria 1194
523 nmdc:mga0qj67_100924_c1 3300050509 Bacteria 2326
524 nmdc:mga0qj67_189388_c1 3300050509 Bacteria 1672
525 nmdc:mga0qj67_473074_c1 3300050509 Bacteria 1008
526 nmdc:mga06r32_108585_c1 3300050510 Bacteria 2728
527 nmdc:mga06r32_770_c1 3300050510 Bacteria 28278
528 nmdc:mga08y16_72_c1 3300050511 Bacteria 84439
529 nmdc:mga08y16_815241_c1 3300050511 Bacteria 925
530 nmdc:mga0rr50_200424_c1 3300050513 Bacteria 1640
531 nmdc:mga0rr50_262881_c1 3300050513 Bacteria 1436
532 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
533 nmdc:mga0sz30_29998_c2 3300050516 Bacteria 1814
534 Ga0495601_0000016 3300053077 Bacteria 207486
535 Ga0495612_0000035 3300053078 Bacteria 69194
536 Ga0495655_0045352 3300053083 Bacteria 1141
537 Ga0495595_0000032 3300053084 Bacteria 87066
538 Ga0495619_0000033 3300053085 Bacteria 138925
539 Ga0500641_0177792 3300053096 Bacteria 914
540 Ga0500593_000006 3300053117 Bacteria 88644
541 Ga0500642_0083927 3300053130 Bacteria 1466
542 Ga0500568_0000005 3300053139 Bacteria 614296
543 Ga0500568_0104190 3300053139 Bacteria 1063
544 Ga0500616_0023558 3300053153 Bacteria 3428
545 Ga0500616_0125999 3300053153 Bacteria 1216
546 Ga0500645_030509 3300053730 Unclassified 1622
547 Ga0501084_0022961 3300054114 Bacteria 5207
548 Ga0501084_0148907 3300054114 Bacteria 1972
549 Ga0501084_0378977 3300054114 Bacteria 1196
550 Ga0501082_0011858 3300060353 Bacteria 7492
551 Ga0501082_0086774 3300060353 Bacteria 2699
552 Ga0501082_0161513 3300060353 Bacteria 1947
553 Ga0501082_0275090 3300060353 Bacteria 1466
554 Ga0501082_0752153 3300060353 Bacteria 853
555 Ga0530510_0346805 3300061734 Bacteria 1115
556 Ga0530510_0586771 3300061734 Bacteria 847

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_101200642 Ga0070698_1012006421 166
2 3300049578 Ga0501042_0487882 Ga0501042_0487882_187_759 176
3 3300049590 Ga0501074_0070396 Ga0501074_0070396_1829_2401 176
4 3300049591 Ga0501075_0020600 Ga0501075_0020600_2889_3461 176
5 3300049592 Ga0501076_0020819 Ga0501076_0020819_17_589 176
6 3300049593 Ga0501077_0005773 Ga0501077_0005773_2520_3092 176
7 3300049743 Ga0501081_0006524 Ga0501081_0006524_2584_3156 176
8 3300054114 Ga0501084_0148907 Ga0501084_0148907_786_1358 176
9 3300060353 Ga0501082_0011858 Ga0501082_0011858_2304_2876 176
10 3300061734 Ga0530510_0346805 Ga0530510_0346805_328_900 176
11 3300049743 Ga0501081_0105874 Ga0501081_0105874_1379_1933 184
12 3300053117 Ga0500593_000006 Ga0500593_000006_20880_21446 187
13 3300053139 Ga0500568_0000005 Ga0500568_0000005_319068_319634 187
14 3300031665 Ga0316575_10149685 Ga0316575_101496851 189
15 3300045051 Ga0451576_0014115 Ga0451576_0014115_3525_4097 189
16 iso_pu_bacteria 2885312484 2885314087 189
17 iso_pu_bacteria 2917554339 2917558211 189
18 3300003323 rootH1_10340175 rootH1_103401752 190
19 3300005336 Ga0070680_100015789 Ga0070680_1000157897 190
20 3300005337 Ga0070682_100000325 Ga0070682_10000032510 190
21 3300005366 Ga0070659_100124101 Ga0070659_1001241012 190
22 3300005435 Ga0070714_101231419 Ga0070714_1012314191 190
23 3300005436 Ga0070713_100258687 Ga0070713_1002586873 190
24 3300005440 Ga0070705_100261519 Ga0070705_1002615192 190
25 3300005444 Ga0070694_100158349 Ga0070694_1001583492 190
26 3300005444 Ga0070694_100871311 Ga0070694_1008713111 190
27 3300005455 Ga0070663_100827547 Ga0070663_1008275472 190
28 3300005458 Ga0070681_10035240 Ga0070681_100352404 190
29 3300005530 Ga0070679_100012384 Ga0070679_1000123847 190
30 3300005536 Ga0070697_100000575 Ga0070697_10000057511 190
31 3300005539 Ga0068853_100000927 Ga0068853_10000092714 190
32 3300005545 Ga0070695_100001268 Ga0070695_10000126814 190
33 3300005546 Ga0070696_100002501 Ga0070696_1000025015 190
34 3300005547 Ga0070693_100052489 Ga0070693_1000524894 190
35 3300005563 Ga0068855_100048834 Ga0068855_1000488344 190
36 3300005577 Ga0068857_100206619 Ga0068857_1002066193 190
37 3300005578 Ga0068854_100058866 Ga0068854_1000588663 190
38 3300006914 Ga0075436_100001283 Ga0075436_10000128317 190
39 3300007076 Ga0075435_100038099 Ga0075435_1000380994 190
40 3300009174 Ga0105241_10020240 Ga0105241_100202403 190
41 3300009553 Ga0105249_10011613 Ga0105249_100116134 190
42 3300013100 Ga0157373_10004101 Ga0157373_100041019 190
43 3300013104 Ga0157370_10083016 Ga0157370_100830164 190
44 3300013307 Ga0157372_10002662 Ga0157372_1000266216 190
45 3300025921 Ga0207652_10022341 Ga0207652_100223414 190
46 3300025932 Ga0207690_10087436 Ga0207690_100874362 190
47 3300025939 Ga0207665_10635228 Ga0207665_106352282 190
48 3300025949 Ga0207667_10058679 Ga0207667_100586792 190
49 3300025961 Ga0207712_10010202 Ga0207712_100102024 190
50 3300025981 Ga0207640_10050921 Ga0207640_100509213 190
51 3300026041 Ga0207639_10003746 Ga0207639_1000374610 190
52 3300026067 Ga0207678_10132268 Ga0207678_101322682 190
53 3300026116 Ga0207674_10050397 Ga0207674_100503972 190
54 3300031711 Ga0265314_10039578 Ga0265314_100395785 190
55 3300041486 Ga0451807_1895779 Ga0451807_1895779_41_616 190
56 3300046660 Ga0495625_0426327 Ga0495625_0426327_27_602 190
57 3300049571 Ga0501034_0208283 Ga0501034_0208283_783_1382 190
58 3300049583 Ga0501067_0026419 Ga0501067_0026419_1450_2049 190
59 3300050513 nmdc:mga0rr50_200424_c1 nmdc:mga0rr50_200424_c1_330_902 190
60 3300050514 nmdc:mga08x19_18_c1 nmdc:mga08x19_18_c1_220935_221507 190
61 3300053730 Ga0500645_030509 Ga0500645_030509_398_973 190
62 3300005466 Ga0070685_10693474 Ga0070685_106934741 191
63 3300049575 Ga0501039_0565878 Ga0501039_0565878_67_642 191
64 3300049577 Ga0501041_0382146 Ga0501041_0382146_35_610 191
65 3300049588 Ga0501072_0556304 Ga0501072_0556304_286_861 191
66 3300049591 Ga0501075_0390627 Ga0501075_0390627_333_908 191
67 3300049741 Ga0501079_0152864 Ga0501079_0152864_610_1185 191
68 3300054114 Ga0501084_0378977 Ga0501084_0378977_554_1129 191
69 3300005327 Ga0070658_10472526 Ga0070658_104725262 192
70 3300005336 Ga0070680_100003095 Ga0070680_1000030956 192
71 3300005530 Ga0070679_100060942 Ga0070679_1000609423 192
72 3300006042 Ga0075368_10069330 Ga0075368_100693302 192
73 3300006048 Ga0075363_100107026 Ga0075363_1001070262 192
74 3300006178 Ga0075367_10230677 Ga0075367_102306772 192
75 3300006353 Ga0075370_10272941 Ga0075370_102729411 192
76 3300025909 Ga0207705_10371453 Ga0207705_103714532 192
77 3300025919 Ga0207657_10027857 Ga0207657_100278574 192
78 3300025921 Ga0207652_10115663 Ga0207652_101156632 192
79 3300031824 Ga0307413_10193624 Ga0307413_101936242 192
80 3300031995 Ga0307409_101447066 Ga0307409_1014470662 192
81 3300035398 Ga0316574_0175133 Ga0316574_0175133_40_621 192
82 3300049570 Ga0501033_0030449 Ga0501033_0030449_2808_3386 192
83 3300049570 Ga0501033_0065141 Ga0501033_0065141_647_1258 192
84 3300049571 Ga0501034_0082307 Ga0501034_0082307_2282_2860 192
85 3300049571 Ga0501034_0165013 Ga0501034_0165013_564_1175 192
86 3300049571 Ga0501034_0206618 Ga0501034_0206618_726_1304 192
87 3300049572 Ga0501036_0010028 Ga0501036_0010028_6908_7486 192
88 3300049573 Ga0501037_0001321 Ga0501037_0001321_16410_16988 192
89 3300049574 Ga0501038_0038701 Ga0501038_0038701_1206_1784 192
90 3300049575 Ga0501039_0001190 Ga0501039_0001190_1092_1670 192
91 3300049578 Ga0501042_0051482 Ga0501042_0051482_904_1482 192
92 3300049579 Ga0501043_0053079 Ga0501043_0053079_2049_2627 192
93 3300049580 Ga0501046_0001578 Ga0501046_0001578_10872_11450 192
94 3300049581 Ga0501047_0095548 Ga0501047_0095548_2019_2597 192
95 3300049581 Ga0501047_0542765 Ga0501047_0542765_33_644 192
96 3300049582 Ga0501048_0004769 Ga0501048_0004769_7865_8443 192
97 3300049583 Ga0501067_0030473 Ga0501067_0030473_2173_2751 192
98 3300049584 Ga0501068_0158125 Ga0501068_0158125_570_1148 192
99 3300049585 Ga0501069_0003295 Ga0501069_0003295_2678_3256 192
100 3300049587 Ga0501071_0191374 Ga0501071_0191374_653_1231 192
101 3300049588 Ga0501072_0154996 Ga0501072_0154996_294_872 192
102 3300049590 Ga0501074_0001331 Ga0501074_0001331_1632_2210 192
103 3300049741 Ga0501079_0010726 Ga0501079_0010726_5852_6430 192
104 3300049744 Ga0501083_0038410 Ga0501083_0038410_2411_2989 192
105 3300049823 Ga0501044_0000122 Ga0501044_0000122_33307_33918 192
106 3300050494 nmdc:mga06z11_140292_c1 nmdc:mga06z11_140292_c1_238_816 192
107 3300050494 nmdc:mga06z11_99859_c1 nmdc:mga06z11_99859_c1_25_603 192
108 3300050516 nmdc:mga0sz30_29998_c2 nmdc:mga0sz30_29998_c2_1166_1747 192
109 3300053096 Ga0500641_0177792 Ga0500641_0177792_104_682 192
110 3300054114 Ga0501084_0022961 Ga0501084_0022961_1977_2555 192
111 3300060353 Ga0501082_0086774 Ga0501082_0086774_1924_2502 192
112 iso_pu_bacteria 2874123672 2874128389 192
113 3300001991 JGI24743J22301_10009031 JGI24743J22301_100090312 193
114 3300002070 JGI24750J21931_1026476 JGI24750J21931_10264761 193
115 3300002074 JGI24748J21848_1014063 JGI24748J21848_10140632 193
116 3300002075 JGI24738J21930_10008382 JGI24738J21930_100083821 193
117 3300002239 JGI24034J26672_10023034 JGI24034J26672_100230342 193
118 3300002244 JGI24742J22300_10016360 JGI24742J22300_100163602 193
119 3300003215 JGI25153J46596_10003511 JGI25153J46596_100035111 193
120 3300003659 JGI25404J52841_10005112 JGI25404J52841_100051123 193
121 3300005328 Ga0070676_10024134 Ga0070676_100241344 193
122 3300005328 Ga0070676_10048465 Ga0070676_100484652 193
123 3300005328 Ga0070676_10270999 Ga0070676_102709992 193
124 3300005330 Ga0070690_100012963 Ga0070690_1000129632 193
125 3300005330 Ga0070690_100075279 Ga0070690_1000752793 193
126 3300005331 Ga0070670_100039720 Ga0070670_1000397204 193
127 3300005331 Ga0070670_100273600 Ga0070670_1002736002 193
128 3300005334 Ga0068869_100136162 Ga0068869_1001361622 193
129 3300005334 Ga0068869_100304002 Ga0068869_1003040022 193
130 3300005335 Ga0070666_10063657 Ga0070666_100636573 193
131 3300005339 Ga0070660_100347140 Ga0070660_1003471402 193
132 3300005340 Ga0070689_100002497 Ga0070689_1000024972 193
133 3300005340 Ga0070689_100274023 Ga0070689_1002740232 193
134 3300005340 Ga0070689_100364617 Ga0070689_1003646172 193
135 3300005343 Ga0070687_100013158 Ga0070687_1000131583 193
136 3300005343 Ga0070687_100092060 Ga0070687_1000920602 193
137 3300005344 Ga0070661_100182304 Ga0070661_1001823041 193
138 3300005345 Ga0070692_10090012 Ga0070692_100900122 193
139 3300005347 Ga0070668_100137517 Ga0070668_1001375171 193
140 3300005347 Ga0070668_100319694 Ga0070668_1003196942 193
141 3300005353 Ga0070669_100032417 Ga0070669_1000324173 193
142 3300005354 Ga0070675_100012297 Ga0070675_1000122976 193
143 3300005354 Ga0070675_100118895 Ga0070675_1001188952 193
144 3300005355 Ga0070671_100050205 Ga0070671_1000502056 193
145 3300005355 Ga0070671_100772848 Ga0070671_1007728481 193
146 3300005356 Ga0070674_100067283 Ga0070674_1000672833 193
147 3300005365 Ga0070688_100030935 Ga0070688_1000309353 193
148 3300005365 Ga0070688_100110863 Ga0070688_1001108631 193
149 3300005366 Ga0070659_100069353 Ga0070659_1000693532 193
150 3300005367 Ga0070667_100338176 Ga0070667_1003381762 193
151 3300005434 Ga0070709_10094443 Ga0070709_100944433 193
152 3300005435 Ga0070714_100468338 Ga0070714_1004683382 193
153 3300005438 Ga0070701_10019160 Ga0070701_100191601 193
154 3300005439 Ga0070711_100092376 Ga0070711_1000923762 193
155 3300005440 Ga0070705_100045847 Ga0070705_1000458473 193
156 3300005441 Ga0070700_100068127 Ga0070700_1000681272 193
157 3300005441 Ga0070700_100159793 Ga0070700_1001597932 193
158 3300005445 Ga0070708_100055171 Ga0070708_1000551714 193
159 3300005445 Ga0070708_100499177 Ga0070708_1004991771 193
160 3300005455 Ga0070663_100064406 Ga0070663_1000644062 193
161 3300005456 Ga0070678_100096593 Ga0070678_1000965932 193
162 3300005456 Ga0070678_100293832 Ga0070678_1002938322 193
163 3300005458 Ga0070681_11233289 Ga0070681_112332891 193
164 3300005459 Ga0068867_100174763 Ga0068867_1001747632 193
165 3300005466 Ga0070685_10017184 Ga0070685_100171842 193
166 3300005467 Ga0070706_101246556 Ga0070706_1012465561 193
167 3300005468 Ga0070707_100310223 Ga0070707_1003102232 193
168 3300005518 Ga0070699_100002955 Ga0070699_10000295515 193
169 3300005518 Ga0070699_100032876 Ga0070699_1000328763 193
170 3300005530 Ga0070679_100254907 Ga0070679_1002549071 193
171 3300005530 Ga0070679_100256870 Ga0070679_1002568702 193
172 3300005535 Ga0070684_101096479 Ga0070684_1010964791 193
173 3300005536 Ga0070697_101184663 Ga0070697_1011846631 193
174 3300005536 Ga0070697_101208577 Ga0070697_1012085771 193
175 3300005539 Ga0068853_100128934 Ga0068853_1001289342 193
176 3300005544 Ga0070686_100043848 Ga0070686_1000438481 193
177 3300005547 Ga0070693_100514913 Ga0070693_1005149132 193
178 3300005548 Ga0070665_100100164 Ga0070665_1001001643 193
179 3300005564 Ga0070664_100108885 Ga0070664_1001088852 193
180 3300005577 Ga0068857_100494729 Ga0068857_1004947292 193
181 3300005578 Ga0068854_100091106 Ga0068854_1000911062 193
182 3300005614 Ga0068856_100123319 Ga0068856_1001233193 193
183 3300005616 Ga0068852_100078655 Ga0068852_1000786552 193
184 3300005617 Ga0068859_100223071 Ga0068859_1002230712 193
185 3300005617 Ga0068859_100467607 Ga0068859_1004676072 193
186 3300005618 Ga0068864_100069183 Ga0068864_1000691832 193
187 3300005618 Ga0068864_100282826 Ga0068864_1002828262 193
188 3300005718 Ga0068866_10074830 Ga0068866_100748302 193
189 3300005719 Ga0068861_100352443 Ga0068861_1003524432 193
190 3300005834 Ga0068851_10069123 Ga0068851_100691232 193
191 3300005840 Ga0068870_10218076 Ga0068870_102180762 193
192 3300005840 Ga0068870_10373898 Ga0068870_103738981 193
193 3300005841 Ga0068863_100202577 Ga0068863_1002025772 193
194 3300005842 Ga0068858_100370867 Ga0068858_1003708671 193
195 3300005843 Ga0068860_100160483 Ga0068860_1001604832 193
196 3300005844 Ga0068862_100366781 Ga0068862_1003667811 193
197 3300005937 Ga0081455_10033713 Ga0081455_100337134 193
198 3300005983 Ga0081540_1000055 Ga0081540_100005536 193
199 3300006028 Ga0070717_10223604 Ga0070717_102236042 193
200 3300006028 Ga0070717_10288046 Ga0070717_102880462 193
201 3300006038 Ga0075365_10023018 Ga0075365_100230183 193
202 3300006038 Ga0075365_10073525 Ga0075365_100735252 193
203 3300006042 Ga0075368_10030936 Ga0075368_100309363 193
204 3300006042 Ga0075368_10047079 Ga0075368_100470792 193
205 3300006048 Ga0075363_100050314 Ga0075363_1000503142 193
206 3300006163 Ga0070715_10016951 Ga0070715_100169512 193
207 3300006173 Ga0070716_100072370 Ga0070716_1000723701 193
208 3300006173 Ga0070716_100526540 Ga0070716_1005265402 193
209 3300006175 Ga0070712_100347611 Ga0070712_1003476112 193
210 3300006175 Ga0070712_100368640 Ga0070712_1003686402 193
211 3300006177 Ga0075362_10171586 Ga0075362_101715862 193
212 3300006177 Ga0075362_10236541 Ga0075362_102365412 193
213 3300006178 Ga0075367_10034925 Ga0075367_100349252 193
214 3300006178 Ga0075367_10092774 Ga0075367_100927742 193
215 3300006186 Ga0075369_10043986 Ga0075369_100439862 193
216 3300006195 Ga0075366_10010892 Ga0075366_100108924 193
217 3300006195 Ga0075366_10055659 Ga0075366_100556591 193
218 3300006195 Ga0075366_10093845 Ga0075366_100938453 193
219 3300006237 Ga0097621_100015369 Ga0097621_1000153695 193
220 3300006353 Ga0075370_10056904 Ga0075370_100569042 193
221 3300006358 Ga0068871_100049571 Ga0068871_1000495713 193
222 3300006844 Ga0075428_101123297 Ga0075428_1011232972 193
223 3300006846 Ga0075430_100051434 Ga0075430_1000514344 193
224 3300006846 Ga0075430_100081665 Ga0075430_1000816653 193
225 3300006847 Ga0075431_100004553 Ga0075431_10000455312 193
226 3300006847 Ga0075431_100009653 Ga0075431_1000096532 193
227 3300006871 Ga0075434_100102227 Ga0075434_1001022273 193
228 3300006871 Ga0075434_100222783 Ga0075434_1002227833 193
229 3300006880 Ga0075429_100002407 Ga0075429_10000240722 193
230 3300006881 Ga0068865_100290688 Ga0068865_1002906882 193
231 3300006931 Ga0097620_100223062 Ga0097620_1002230622 193
232 3300006931 Ga0097620_100467637 Ga0097620_1004676372 193
233 3300007076 Ga0075435_100021345 Ga0075435_1000213455 193
234 3300007076 Ga0075435_100181102 Ga0075435_1001811022 193
235 3300007076 Ga0075435_100213776 Ga0075435_1002137762 193
236 3300007076 Ga0075435_100493941 Ga0075435_1004939412 193
237 3300007265 Ga0099794_10008881 Ga0099794_100088814 193
238 3300009094 Ga0111539_10000115 Ga0111539_1000011570 193
239 3300009094 Ga0111539_11186865 Ga0111539_111868652 193
240 3300009098 Ga0105245_10251526 Ga0105245_102515262 193
241 3300009101 Ga0105247_10042175 Ga0105247_100421753 193
242 3300009147 Ga0114129_10001209 Ga0114129_1000120913 193
243 3300009147 Ga0114129_12383619 Ga0114129_123836191 193
244 3300009174 Ga0105241_10376914 Ga0105241_103769142 193
245 3300009174 Ga0105241_10501671 Ga0105241_105016712 193
246 3300009176 Ga0105242_10123745 Ga0105242_101237452 193
247 3300009176 Ga0105242_10143987 Ga0105242_101439873 193
248 3300009177 Ga0105248_10001877 Ga0105248_100018774 193
249 3300009177 Ga0105248_10153813 Ga0105248_101538133 193
250 3300009177 Ga0105248_10629027 Ga0105248_106290272 193
251 3300009545 Ga0105237_10649263 Ga0105237_106492632 193
252 3300009551 Ga0105238_10256873 Ga0105238_102568732 193
253 3300009553 Ga0105249_10116782 Ga0105249_101167823 193
254 3300010375 Ga0105239_11371755 Ga0105239_113717552 193
255 3300011119 Ga0105246_10440191 Ga0105246_104401912 193
256 3300013297 Ga0157378_10737990 Ga0157378_107379902 193
257 3300013306 Ga0163162_10946030 Ga0163162_109460302 193
258 3300013306 Ga0163162_10967588 Ga0163162_109675882 193
259 3300013308 Ga0157375_10524371 Ga0157375_105243712 193
260 3300013308 Ga0157375_10796739 Ga0157375_107967392 193
261 3300014325 Ga0163163_10129437 Ga0163163_101294374 193
262 3300014325 Ga0163163_10405805 Ga0163163_104058052 193
263 3300014326 Ga0157380_10039978 Ga0157380_100399783 193
264 3300014326 Ga0157380_10107014 Ga0157380_101070143 193
265 3300014326 Ga0157380_10212543 Ga0157380_102125432 193
266 3300014326 Ga0157380_10321492 Ga0157380_103214921 193
267 3300014497 Ga0182008_10049039 Ga0182008_100490393 193
268 3300014745 Ga0157377_10176041 Ga0157377_101760412 193
269 3300014745 Ga0157377_10984796 Ga0157377_109847961 193
270 3300014968 Ga0157379_10364366 Ga0157379_103643662 193
271 3300014969 Ga0157376_10739060 Ga0157376_107390601 193
272 3300017792 Ga0163161_10184409 Ga0163161_101844092 193
273 3300025297 Ga0209758_1005755 Ga0209758_10057551 193
274 3300025297 Ga0209758_1017976 Ga0209758_10179766 193
275 3300025302 Ga0207426_1061834 Ga0207426_10618341 193
276 3300025315 Ga0207697_10085266 Ga0207697_100852662 193
277 3300025885 Ga0207653_10010065 Ga0207653_100100652 193
278 3300025898 Ga0207692_10059981 Ga0207692_100599813 193
279 3300025898 Ga0207692_10081593 Ga0207692_100815932 193
280 3300025899 Ga0207642_10697826 Ga0207642_106978261 193
281 3300025900 Ga0207710_10015124 Ga0207710_100151243 193
282 3300025901 Ga0207688_10010751 Ga0207688_100107515 193
283 3300025904 Ga0207647_10038007 Ga0207647_100380074 193
284 3300025906 Ga0207699_10052946 Ga0207699_100529462 193
285 3300025906 Ga0207699_10144393 Ga0207699_101443933 193
286 3300025907 Ga0207645_10005075 Ga0207645_100050759 193
287 3300025907 Ga0207645_10055111 Ga0207645_100551113 193
288 3300025908 Ga0207643_10000750 Ga0207643_100007504 193
289 3300025910 Ga0207684_10008184 Ga0207684_100081842 193
290 3300025910 Ga0207684_10224057 Ga0207684_102240572 193
291 3300025914 Ga0207671_10154088 Ga0207671_101540882 193
292 3300025915 Ga0207693_10075172 Ga0207693_100751723 193
293 3300025915 Ga0207693_10217124 Ga0207693_102171242 193
294 3300025915 Ga0207693_10326141 Ga0207693_103261412 193
295 3300025915 Ga0207693_10662213 Ga0207693_106622132 193
296 3300025916 Ga0207663_10039076 Ga0207663_100390763 193
297 3300025917 Ga0207660_10522352 Ga0207660_105223521 193
298 3300025918 Ga0207662_10104128 Ga0207662_101041282 193
299 3300025918 Ga0207662_10249088 Ga0207662_102490881 193
300 3300025919 Ga0207657_10083020 Ga0207657_100830203 193
301 3300025920 Ga0207649_10097941 Ga0207649_100979413 193
302 3300025921 Ga0207652_10427474 Ga0207652_104274742 193
303 3300025923 Ga0207681_10084609 Ga0207681_100846092 193
304 3300025923 Ga0207681_10232934 Ga0207681_102329342 193
305 3300025923 Ga0207681_10235750 Ga0207681_102357502 193
306 3300025925 Ga0207650_10034322 Ga0207650_100343221 193
307 3300025925 Ga0207650_10153059 Ga0207650_101530592 193
308 3300025927 Ga0207687_10138128 Ga0207687_101381282 193
309 3300025927 Ga0207687_10710358 Ga0207687_107103582 193
310 3300025928 Ga0207700_10091514 Ga0207700_100915142 193
311 3300025929 Ga0207664_10019573 Ga0207664_100195732 193
312 3300025929 Ga0207664_10282955 Ga0207664_102829552 193
313 3300025929 Ga0207664_10993684 Ga0207664_109936841 193
314 3300025931 Ga0207644_10044390 Ga0207644_100443902 193
315 3300025932 Ga0207690_10427980 Ga0207690_104279802 193
316 3300025933 Ga0207706_10001078 Ga0207706_1000107819 193
317 3300025936 Ga0207670_10041282 Ga0207670_100412822 193
318 3300025939 Ga0207665_10240500 Ga0207665_102405002 193
319 3300025940 Ga0207691_10048712 Ga0207691_100487123 193
320 3300025941 Ga0207711_10039770 Ga0207711_100397703 193
321 3300025941 Ga0207711_10335528 Ga0207711_103355282 193
322 3300025941 Ga0207711_10687679 Ga0207711_106876791 193
323 3300025942 Ga0207689_10024160 Ga0207689_100241603 193
324 3300025945 Ga0207679_10965816 Ga0207679_109658161 193
325 3300025961 Ga0207712_10086384 Ga0207712_100863842 193
326 3300025972 Ga0207668_10066897 Ga0207668_100668972 193
327 3300025972 Ga0207668_10082714 Ga0207668_100827142 193
328 3300025972 Ga0207668_10222492 Ga0207668_102224922 193
329 3300025972 Ga0207668_10268786 Ga0207668_102687862 193
330 3300025981 Ga0207640_10714930 Ga0207640_107149301 193
331 3300025986 Ga0207658_10055253 Ga0207658_100552533 193
332 3300026023 Ga0207677_10317562 Ga0207677_103175622 193
333 3300026035 Ga0207703_10152965 Ga0207703_101529652 193
334 3300026067 Ga0207678_10015782 Ga0207678_100157826 193
335 3300026075 Ga0207708_10001622 Ga0207708_100016223 193
336 3300026075 Ga0207708_10095246 Ga0207708_100952462 193
337 3300026078 Ga0207702_10578073 Ga0207702_105780731 193
338 3300026089 Ga0207648_10050674 Ga0207648_100506742 193
339 3300026095 Ga0207676_10169336 Ga0207676_101693362 193
340 3300026118 Ga0207675_100001067 Ga0207675_1000010679 193
341 3300026121 Ga0207683_10005165 Ga0207683_100051654 193
342 3300026121 Ga0207683_10022355 Ga0207683_100223556 193
343 3300027671 Ga0209588_1014647 Ga0209588_10146473 193
344 3300027907 Ga0207428_10002405 Ga0207428_100024056 193
345 3300028379 Ga0268266_10397313 Ga0268266_103973131 193
346 3300028379 Ga0268266_10552514 Ga0268266_105525142 193
347 3300028380 Ga0268265_10033539 Ga0268265_100335395 193
348 3300028380 Ga0268265_10871062 Ga0268265_108710621 193
349 3300028381 Ga0268264_10369646 Ga0268264_103696462 193
350 3300031728 Ga0316578_10096671 Ga0316578_100966712 193
351 3300032137 Ga0316585_10052198 Ga0316585_100521982 193
352 3300034816 Ga0373930_0018118 Ga0373930_0018118_351_944 193
353 3300034957 Ga0373938_0033522 Ga0373938_0033522_346_939 193
354 3300035083 Ga0373926_0015325 Ga0373926_0015325_738_1322 193
355 3300035083 Ga0373926_0077305 Ga0373926_0077305_429_1022 193
356 3300035085 Ga0373929_0007021 Ga0373929_0007021_588_1181 193
357 3300035089 Ga0373944_0017827 Ga0373944_0017827_614_1195 193
358 3300035091 Ga0373951_0101775 Ga0373951_0101775_43_636 193
359 3300035111 Ga0373923_0000926 Ga0373923_0000926_3909_4493 193
360 3300035112 Ga0373932_0045086 Ga0373932_0045086_190_783 193
361 3300035112 Ga0373932_0063721 Ga0373932_0063721_395_988 193
362 3300035113 Ga0373936_0002444 Ga0373936_0002444_2085_2669 193
363 3300035113 Ga0373936_0078703 Ga0373936_0078703_772_1353 193
364 3300035114 Ga0373939_0005192 Ga0373939_0005192_682_1275 193
365 3300035115 Ga0373941_0022184 Ga0373941_0022184_859_1452 193
366 3300035116 Ga0373945_0012501 Ga0373945_0012501_1373_1957 193
367 3300035116 Ga0373945_0098513 Ga0373945_0098513_449_1030 193
368 3300035117 Ga0373953_0000743 Ga0373953_0000743_1651_2235 193
369 3300035118 Ga0373954_0021148 Ga0373954_0021148_522_1106 193
370 3300035120 Ga0373957_0007156 Ga0373957_0007156_2292_2876 193
371 3300035121 Ga0373960_0036916 Ga0373960_0036916_58_651 193
372 3300035121 Ga0373960_0082702 Ga0373960_0082702_36_617 193
373 3300035170 Ga0373943_0003686 Ga0373943_0003686_809_1393 193
374 3300035170 Ga0373943_0032339 Ga0373943_0032339_404_985 193
375 3300035171 Ga0373946_0000588 Ga0373946_0000588_9462_10046 193
376 3300035172 Ga0373955_0000346 Ga0373955_0000346_2934_3518 193
377 3300035241 Ga0373961_0013177 Ga0373961_0013177_1160_1753 193
378 3300035398 Ga0316574_0006930 Ga0316574_0006930_371_952 193
379 3300035410 Ga0373924_0015064 Ga0373924_0015064_1494_2078 193
380 3300035691 Ga0373931_0009934 Ga0373931_0009934_903_1496 193
381 3300035691 Ga0373931_0015382 Ga0373931_0015382_2185_2778 193
382 3300035691 Ga0373931_0353752 Ga0373931_0353752_114_695 193
383 3300035692 Ga0373935_0000056 Ga0373935_0000056_28122_28706 193
384 3300035692 Ga0373935_0397388 Ga0373935_0397388_179_760 193
385 3300035695 Ga0373927_0005062 Ga0373927_0005062_5097_5681 193
386 3300035695 Ga0373927_0291200 Ga0373927_0291200_23_604 193
387 3300035724 Ga0373933_0028287 Ga0373933_0028287_1576_2160 193
388 3300035724 Ga0373933_0167144 Ga0373933_0167144_759_1340 193
389 3300035724 Ga0373933_0760332 Ga0373933_0760332_31_612 193
390 3300035725 Ga0373947_0007138 Ga0373947_0007138_4205_4789 193
391 3300035725 Ga0373947_0200452 Ga0373947_0200452_694_1275 193
392 3300036401 Ga0373937_0000075 Ga0373937_0000075_61291_61875 193
393 3300036712 Ga0316584_0071826 Ga0316584_0071826_1331_1912 193
394 3300037068 Ga0373925_0000159 Ga0373925_0000159_27982_28566 193
395 3300037068 Ga0373925_0037415 Ga0373925_0037415_170_751 193
396 3300037312 Ga0395899_0463047 Ga0395899_0463047_149_730 193
397 3300037466 Ga0395898_0718433 Ga0395898_0718433_197_778 193
398 3300037466 Ga0395898_0984529 Ga0395898_0984529_63_677 193
399 3300037471 Ga0395905_0037065 Ga0395905_0037065_2935_3549 193
400 3300037853 Ga0436364_0268901 Ga0436364_0268901_48_629 193
401 3300037853 Ga0436364_0880057 Ga0436364_0880057_403_984 193
402 3300038443 Ga0395901_0182931 Ga0395901_0182931_1467_2081 193
403 3300039447 Ga0436361_0109240 Ga0436361_0109240_4118_4711 193
404 3300041494 Ga0451837_0444460 Ga0451837_0444460_255_836 193
405 3300046452 Ga0495617_109768 Ga0495617_109768_84_665 193
406 3300046453 Ga0495627_065943 Ga0495627_065943_458_1039 193
407 3300046454 Ga0495592_0000102 Ga0495592_0000102_61260_61844 193
408 3300046455 Ga0495603_0033794 Ga0495603_0033794_1221_1802 193
409 3300046457 Ga0495590_0052249 Ga0495590_0052249_389_970 193
410 3300046459 Ga0495629_0012813 Ga0495629_0012813_5047_5631 193
411 3300046461 Ga0495641_0026393 Ga0495641_0026393_165_746 193
412 3300046462 Ga0495651_0017925 Ga0495651_0017925_2762_3346 193
413 3300046463 Ga0495653_0000036 Ga0495653_0000036_45600_46184 193
414 3300046474 Ga0495605_0159024 Ga0495605_0159024_282_863 193
415 3300046475 Ga0495639_0103935 Ga0495639_0103935_15_599 193
416 3300046475 Ga0495639_0144649 Ga0495639_0144649_208_789 193
417 3300046476 Ga0495662_0004822 Ga0495662_0004822_3686_4270 193
418 3300046477 Ga0495664_0000016 Ga0495664_0000016_6622_7206 193
419 3300046491 Ga0495584_0095952 Ga0495584_0095952_265_846 193
420 3300046492 Ga0495585_0043789 Ga0495585_0043789_756_1337 193
421 3300046499 Ga0495594_0281126 Ga0495594_0281126_179_760 193
422 3300046500 Ga0495596_0150432 Ga0495596_0150432_106_687 193
423 3300046511 Ga0495608_0000006 Ga0495608_0000006_262486_263070 193
424 3300046513 Ga0495616_0053236 Ga0495616_0053236_551_1132 193
425 3300046514 Ga0495618_0000057 Ga0495618_0000057_28061_28645 193
426 3300046515 Ga0495620_0054031 Ga0495620_0054031_784_1365 193
427 3300046516 Ga0495628_0000018 Ga0495628_0000018_162711_163295 193
428 3300046517 Ga0495630_0001707 Ga0495630_0001707_3503_4087 193
429 3300046519 Ga0495632_0218766 Ga0495632_0218766_115_696 193
430 3300046523 Ga0495644_0018613 Ga0495644_0018613_1973_2554 193
431 3300046528 Ga0495642_0180127 Ga0495642_0180127_262_843 193
432 3300046529 Ga0495652_0000005 Ga0495652_0000005_475864_476448 193
433 3300046529 Ga0495652_0283167 Ga0495652_0283167_365_946 193
434 3300046529 Ga0495652_0308637 Ga0495652_0308637_411_992 193
435 3300046531 Ga0495665_0079367 Ga0495665_0079367_838_1419 193
436 3300046533 Ga0495640_0000007 Ga0495640_0000007_210203_210787 193
437 3300046535 Ga0495586_0078797 Ga0495586_0078797_157_741 193
438 3300046536 Ga0495587_0000043 Ga0495587_0000043_47844_48428 193
439 3300046537 Ga0495598_0053798 Ga0495598_0053798_379_960 193
440 3300046537 Ga0495598_0056399 Ga0495598_0056399_554_1135 193
441 3300046538 Ga0495609_0202264 Ga0495609_0202264_112_693 193
442 3300046543 Ga0495645_0000064 Ga0495645_0000064_6622_7206 193
443 3300046557 Ga0495622_0166860 Ga0495622_0166860_157_738 193
444 3300046559 Ga0495667_0000023 Ga0495667_0000023_29511_30095 193
445 3300046615 Ga0495656_0270534 Ga0495656_0270534_235_816 193
446 3300046642 Ga0495634_0000049 Ga0495634_0000049_43177_43761 193
447 3300046663 Ga0495635_0000021 Ga0495635_0000021_61270_61854 193
448 3300046664 Ga0495659_0109287 Ga0495659_0109287_471_1052 193
449 3300046674 Ga0495588_0062749 Ga0495588_0062749_234_815 193
450 3300046675 Ga0495657_0000063 Ga0495657_0000063_45889_46473 193
451 3300046678 Ga0495599_0000001 Ga0495599_0000001_54454_55038 193
452 3300046679 Ga0495623_0000056 Ga0495623_0000056_14150_14734 193
453 3300046680 Ga0495646_0000007 Ga0495646_0000007_181682_182266 193
454 3300046681 Ga0495647_0124184 Ga0495647_0124184_179_760 193
455 3300046681 Ga0495647_0177506 Ga0495647_0177506_243_824 193
456 3300046683 Ga0495658_0100945 Ga0495658_0100945_683_1267 193
457 3300046683 Ga0495658_0224286 Ga0495658_0224286_232_813 193
458 3300046684 Ga0495669_0147390 Ga0495669_0147390_137_718 193
459 3300046689 Ga0495613_0129409 Ga0495613_0129409_764_1348 193
460 3300046689 Ga0495613_0194255 Ga0495613_0194255_284_865 193
461 3300046690 Ga0495624_0014420 Ga0495624_0014420_808_1392 193
462 3300046690 Ga0495624_0290519 Ga0495624_0290519_180_761 193
463 3300046691 Ga0495670_0110496 Ga0495670_0110496_76_657 193
464 3300046692 Ga0495671_0221863 Ga0495671_0221863_43_624 193
465 3300046794 Ga0495589_0075458 Ga0495589_0075458_608_1189 193
466 3300046809 Ga0495600_0000047 Ga0495600_0000047_56843_57427 193
467 3300047315 Ga0495581_0096959 Ga0495581_0096959_600_1184 193
468 3300047315 Ga0495581_0273549 Ga0495581_0273549_333_914 193
469 3300047317 Ga0495604_0000014 Ga0495604_0000014_156975_157559 193
470 3300047317 Ga0495604_0102754 Ga0495604_0102754_237_818 193
471 3300047319 Ga0495674_0000014 Ga0495674_0000014_83681_84265 193
472 3300047319 Ga0495674_0579888 Ga0495674_0579888_60_641 193
473 3300047321 Ga0495676_0083050 Ga0495676_0083050_410_991 193
474 3300047321 Ga0495676_0274664 Ga0495676_0274664_152_733 193
475 3300047322 Ga0495680_0000744 Ga0495680_0000744_19446_20030 193
476 3300047323 Ga0495683_0225369 Ga0495683_0225369_26_607 193
477 3300047444 Ga0495675_0000940 Ga0495675_0000940_2891_3475 193
478 3300047444 Ga0495675_0325914 Ga0495675_0325914_45_626 193
479 3300047471 Ga0495684_0000757 Ga0495684_0000757_18975_19559 193
480 3300047673 Ga0495593_0001967 Ga0495593_0001967_7032_7616 193
481 3300048088 Ga0495602_0000017 Ga0495602_0000017_44287_44871 193
482 3300048088 Ga0495602_0217652 Ga0495602_0217652_390_971 193
483 3300048091 Ga0495626_0167106 Ga0495626_0167106_108_689 193
484 3300048903 Ga0496100_0055698 Ga0496100_0055698_889_1482 193
485 3300048903 Ga0496100_0093571 Ga0496100_0093571_617_1198 193
486 3300048904 Ga0496101_0037064 Ga0496101_0037064_561_1154 193
487 3300048905 Ga0496102_0089466 Ga0496102_0089466_303_896 193
488 3300048905 Ga0496102_0274114 Ga0496102_0274114_699_1292 193
489 3300048906 Ga0496103_0170733 Ga0496103_0170733_722_1303 193
490 3300048908 Ga0496105_0078111 Ga0496105_0078111_351_944 193
491 3300048909 Ga0496106_0037953 Ga0496106_0037953_1978_2571 193
492 3300048909 Ga0496106_0222812 Ga0496106_0222812_375_956 193
493 3300048910 Ga0496107_0022620 Ga0496107_0022620_3550_4143 193
494 3300048911 Ga0496108_0052444 Ga0496108_0052444_1637_2230 193
495 3300048911 Ga0496108_0065122 Ga0496108_0065122_214_795 193
496 3300048911 Ga0496108_0795001 Ga0496108_0795001_159_752 193
497 3300048912 Ga0496109_0114270 Ga0496109_0114270_1065_1658 193
498 3300048913 Ga0496110_0011995 Ga0496110_0011995_3021_3614 193
499 3300048913 Ga0496110_0031673 Ga0496110_0031673_87_710 193
500 3300048913 Ga0496110_0041867 Ga0496110_0041867_851_1432 193
501 3300048913 Ga0496110_0342176 Ga0496110_0342176_406_987 193
502 3300048914 Ga0496111_0010982 Ga0496111_0010982_4960_5553 193
503 3300048914 Ga0496111_0086499 Ga0496111_0086499_876_1457 193
504 3300048915 Ga0496112_0015138 Ga0496112_0015138_697_1290 193
505 3300048915 Ga0496112_0152018 Ga0496112_0152018_1408_1989 193
506 3300048915 Ga0496112_0500568 Ga0496112_0500568_342_935 193
507 3300048915 Ga0496112_0513973 Ga0496112_0513973_195_776 193
508 3300048916 Ga0496113_0009785 Ga0496113_0009785_4316_4897 193
509 3300048916 Ga0496113_0018032 Ga0496113_0018032_2731_3324 193
510 3300048916 Ga0496113_0179053 Ga0496113_0179053_636_1229 193
511 3300048917 Ga0496114_0036700 Ga0496114_0036700_612_1205 193
512 3300048917 Ga0496114_0250758 Ga0496114_0250758_782_1363 193
513 3300048918 Ga0496115_0399405 Ga0496115_0399405_299_892 193
514 3300049584 Ga0501068_0238380 Ga0501068_0238380_26_607 193
515 3300049585 Ga0501069_0222550 Ga0501069_0222550_290_871 193
516 3300049586 Ga0501070_0199558 Ga0501070_0199558_1001_1582 193
517 3300049588 Ga0501072_0090375 Ga0501072_0090375_744_1325 193
518 3300049588 Ga0501072_0177184 Ga0501072_0177184_926_1507 193
519 3300049742 Ga0501080_0310247 Ga0501080_0310247_106_696 193
520 3300049742 Ga0501080_0403583 Ga0501080_0403583_261_842 193
521 3300049742 Ga0501080_0638912 Ga0501080_0638912_19_600 193
522 3300049744 Ga0501083_0420506 Ga0501083_0420506_45_635 193
523 3300049744 Ga0501083_0476488 Ga0501083_0476488_145_726 193
524 3300050489 nmdc:mga03683_108253_c1 nmdc:mga03683_108253_c1_253_834 193
525 3300050491 nmdc:mga00v17_477922_c1 nmdc:mga00v17_477922_c1_22_603 193
526 3300050493 nmdc:mga0k408_18964_c1 nmdc:mga0k408_18964_c1_2792_3388 193
527 3300050493 nmdc:mga0k408_36595_c1 nmdc:mga0k408_36595_c1_324_905 193
528 3300050494 nmdc:mga06z11_453092_c1 nmdc:mga06z11_453092_c1_143_724 193
529 3300050494 nmdc:mga06z11_719204_c1 nmdc:mga06z11_719204_c1_14_595 193
530 3300050496 nmdc:mga07m45_115129_c1 nmdc:mga07m45_115129_c1_144_740 193
531 3300050507 nmdc:mga05p37_1046633_c1 nmdc:mga05p37_1046633_c1_83_664 193
532 3300050507 nmdc:mga05p37_11064_c1 nmdc:mga05p37_11064_c1_6779_7372 193
533 3300050507 nmdc:mga05p37_1288121_c1 nmdc:mga05p37_1288121_c1_30_611 193
534 3300050507 nmdc:mga05p37_141777_c1 nmdc:mga05p37_141777_c1_82_663 193
535 3300050507 nmdc:mga05p37_704306_c1 nmdc:mga05p37_704306_c1_122_703 193
536 3300050507 nmdc:mga05p37_7481_c1 nmdc:mga05p37_7481_c1_6635_7216 193
537 3300050508 nmdc:mga09592_1529_c1 nmdc:mga09592_1529_c1_16375_16956 193
538 3300050508 nmdc:mga09592_395568_c1 nmdc:mga09592_395568_c1_356_949 193
539 3300050509 nmdc:mga0qj67_100924_c1 nmdc:mga0qj67_100924_c1_1003_1596 193
540 3300050509 nmdc:mga0qj67_189388_c1 nmdc:mga0qj67_189388_c1_946_1527 193
541 3300050509 nmdc:mga0qj67_473074_c1 nmdc:mga0qj67_473074_c1_189_788 193
542 3300050510 nmdc:mga06r32_108585_c1 nmdc:mga06r32_108585_c1_564_1157 193
543 3300050510 nmdc:mga06r32_770_c1 nmdc:mga06r32_770_c1_27510_28091 193
544 3300050511 nmdc:mga08y16_72_c1 nmdc:mga08y16_72_c1_24319_24900 193
545 3300050511 nmdc:mga08y16_815241_c1 nmdc:mga08y16_815241_c1_194_775 193
546 3300050513 nmdc:mga0rr50_262881_c1 nmdc:mga0rr50_262881_c1_166_747 193
547 3300053077 Ga0495601_0000016 Ga0495601_0000016_44287_44871 193
548 3300053078 Ga0495612_0000035 Ga0495612_0000035_14132_14716 193
549 3300053083 Ga0495655_0045352 Ga0495655_0045352_497_1078 193
550 3300053084 Ga0495595_0000032 Ga0495595_0000032_38531_39115 193
551 3300053085 Ga0495619_0000033 Ga0495619_0000033_54632_55216 193
552 3300053130 Ga0500642_0083927 Ga0500642_0083927_481_1161 193
553 3300053139 Ga0500568_0104190 Ga0500568_0104190_52_633 193
554 3300053153 Ga0500616_0023558 Ga0500616_0023558_887_1468 193
555 3300053153 Ga0500616_0125999 Ga0500616_0125999_490_1071 193
556 3300060353 Ga0501082_0161513 Ga0501082_0161513_139_720 193
557 3300060353 Ga0501082_0275090 Ga0501082_0275090_227_808 193
558 3300060353 Ga0501082_0752153 Ga0501082_0752153_149_730 193
559 3300061734 Ga0530510_0586771 Ga0530510_0586771_192_797 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

45

202

0.96

PF02525

Flavodoxin_2

Flavodoxin-like fold

45

221

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fzv-assembly1.cif.gz_B crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.8982 3 192
2q62-assembly2.cif.gz_F crystal structure of arsh from sinorhizobium meliloti 0.8932 1 191
2q62-assembly1.cif.gz_D crystal structure of arsh from sinorhizobium meliloti 0.8911 1 191
7ple-assembly1.cif.gz_D arsh of paracoccus denitrificans 0.8866 1 192
2fzv-assembly1.cif.gz_D crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.885 4 189
ID Description Score Start End Superfamily
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.887 3 191 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8763 4 192 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.855 4 193 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8525 5 185 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8464 4 193 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A327JJF4-F1-model_v4 NADPH-dependent FMN reductase 0.9833 1 193 GO:0005829
GO:0010181
GO:0016491
AF-A0A2S0N8G6-F1-model_v4 NADPH-dependent FMN reductase 0.983 3 193 GO:0005829
GO:0010181
GO:0016491
AF-A0A844T9G7-F1-model_v4 NADPH-dependent FMN reductase 0.9782 1 193 GO:0005829
GO:0010181
GO:0016491
AF-A0A327JJF4-F1-model_v4 NADPH-dependent FMN reductase 0.9782 1 193 GO:0005829
GO:0010181
GO:0016491
AF-A0A2S0N8G6-F1-model_v4 NADPH-dependent FMN reductase 0.9779 3 193 GO:0005829
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.13 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map