F463472
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 558 | 239 | 557 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0000082|Ga0466972_0000082_13342_13620 |
| Length | 92 |
| Sequence | MNQLKKWLGIVWMLLGPVAIYYLIKTAAGEISKSPVTNTIIQWAVFVIIFIPIAIGLIIFGYYAFKGEYDHLPESSTEIKTIAVANNILPRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 158 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 168 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 169 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 173 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 174 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 177 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 178 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 179 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 180 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 181 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 182 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 183 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 184 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 208 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 209 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 210 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 211 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 212 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 214 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 215 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 218 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 219 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 222 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 223 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 224 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 225 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 226 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 227 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 228 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 229 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 230 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 231 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 232 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 233 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 234 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 235 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 236 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 237 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 238 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 239 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.63 |
| Nodule | 0 |
| Rhizoplane | 1.97 |
| Rhizosphere | 87.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1026910 | 3300002738 | Bacteria | 519 |
| 2 | rootH1_10004790 | 3300003316 | Bacteria | 9723 |
| 3 | rootH2_10191969 | 3300003320 | Bacteria | 2173 |
| 4 | rootL2_10064547 | 3300003322 | Bacteria | 1932 |
| 5 | rootL2_10222743 | 3300003322 | Bacteria | 1104 |
| 6 | rootL2_10336253 | 3300003322 | Bacteria | 1446 |
| 7 | rootH1_10007189 | 3300003323 | Bacteria | 65578 |
| 8 | rootH1_10113682 | 3300003323 | Bacteria | 2170 |
| 9 | Ga0065714_10267444 | 3300005288 | Bacteria | 745 |
| 10 | Ga0065707_10260657 | 3300005295 | Bacteria | 1098 |
| 11 | Ga0070676_10072870 | 3300005328 | Bacteria | 2065 |
| 12 | Ga0070676_10083441 | 3300005328 | Unclassified | 1943 |
| 13 | Ga0070676_11517773 | 3300005328 | Unclassified | 516 |
| 14 | Ga0070683_100007891 | 3300005329 | Bacteria | 9021 |
| 15 | Ga0070683_100195210 | 3300005329 | Unclassified | 1922 |
| 16 | Ga0070690_100001766 | 3300005330 | Bacteria | 11433 |
| 17 | Ga0070690_100048211 | 3300005330 | Bacteria | 2712 |
| 18 | Ga0070690_100490587 | 3300005330 | Unclassified | 917 |
| 19 | Ga0070670_100022437 | 3300005331 | Bacteria | 5433 |
| 20 | Ga0070670_101954855 | 3300005331 | Bacteria | 540 |
| 21 | Ga0068869_100002336 | 3300005334 | Bacteria | 11408 |
| 22 | Ga0068869_100005789 | 3300005334 | Bacteria | 7798 |
| 23 | Ga0068869_100044910 | 3300005334 | Bacteria | 3179 |
| 24 | Ga0068869_100096051 | 3300005334 | Bacteria | 2236 |
| 25 | Ga0068869_100191287 | 3300005334 | Bacteria | 1609 |
| 26 | Ga0068869_100539655 | 3300005334 | Bacteria | 978 |
| 27 | Ga0070666_10019870 | 3300005335 | Bacteria | 4339 |
| 28 | Ga0070666_10081458 | 3300005335 | Bacteria | 2213 |
| 29 | Ga0070666_10108856 | 3300005335 | Bacteria | 1915 |
| 30 | Ga0070682_100129290 | 3300005337 | Bacteria | 1707 |
| 31 | Ga0070682_100352699 | 3300005337 | Bacteria | 1097 |
| 32 | Ga0070682_101581465 | 3300005337 | Bacteria | 566 |
| 33 | Ga0068868_100002287 | 3300005338 | Bacteria | 13245 |
| 34 | Ga0068868_100097932 | 3300005338 | Bacteria | 2371 |
| 35 | Ga0068868_100203548 | 3300005338 | Bacteria | 1651 |
| 36 | Ga0068868_100244747 | 3300005338 | Bacteria | 1508 |
| 37 | Ga0068868_100923852 | 3300005338 | Bacteria | 794 |
| 38 | Ga0070660_100129445 | 3300005339 | Unclassified | 2019 |
| 39 | Ga0070689_100005603 | 3300005340 | Bacteria | 8592 |
| 40 | Ga0070689_100044201 | 3300005340 | Unclassified | 3426 |
| 41 | Ga0070691_10473075 | 3300005341 | Unclassified | 719 |
| 42 | Ga0070687_100675096 | 3300005343 | Bacteria | 719 |
| 43 | Ga0070687_100743177 | 3300005343 | Unclassified | 689 |
| 44 | Ga0070687_101229652 | 3300005343 | Bacteria | 553 |
| 45 | Ga0070661_100001257 | 3300005344 | Bacteria | 17801 |
| 46 | Ga0070661_100019477 | 3300005344 | Bacteria | 4837 |
| 47 | Ga0070661_100502919 | 3300005344 | Unclassified | 970 |
| 48 | Ga0070661_100656155 | 3300005344 | Bacteria | 852 |
| 49 | Ga0070668_100109493 | 3300005347 | Bacteria | 2198 |
| 50 | Ga0070668_100585829 | 3300005347 | Bacteria | 974 |
| 51 | Ga0070668_101163564 | 3300005347 | Bacteria | 698 |
| 52 | Ga0070669_100613603 | 3300005353 | Unclassified | 912 |
| 53 | Ga0070669_100672187 | 3300005353 | Bacteria | 873 |
| 54 | Ga0070675_100090401 | 3300005354 | Bacteria | 2564 |
| 55 | Ga0070675_100172727 | 3300005354 | Bacteria | 1865 |
| 56 | Ga0070675_100285171 | 3300005354 | Bacteria | 1452 |
| 57 | Ga0070675_100434081 | 3300005354 | Bacteria | 1176 |
| 58 | Ga0070675_100908045 | 3300005354 | Unclassified | 807 |
| 59 | Ga0070675_101135708 | 3300005354 | Unclassified | 719 |
| 60 | Ga0070671_100037003 | 3300005355 | Bacteria | 4047 |
| 61 | Ga0070671_100039337 | 3300005355 | Bacteria | 3926 |
| 62 | Ga0070671_100069585 | 3300005355 | Bacteria | 2936 |
| 63 | Ga0070671_100128875 | 3300005355 | Bacteria | 2130 |
| 64 | Ga0070671_101368838 | 3300005355 | Bacteria | 625 |
| 65 | Ga0070674_100002720 | 3300005356 | Bacteria | 9779 |
| 66 | Ga0070674_100555129 | 3300005356 | Bacteria | 964 |
| 67 | Ga0070673_100060741 | 3300005364 | Bacteria | 2996 |
| 68 | Ga0070673_100916474 | 3300005364 | Bacteria | 813 |
| 69 | Ga0070673_102222326 | 3300005364 | Bacteria | 521 |
| 70 | Ga0070688_100026655 | 3300005365 | Bacteria | 3435 |
| 71 | Ga0070688_100429292 | 3300005365 | Bacteria | 984 |
| 72 | Ga0070659_100040451 | 3300005366 | Bacteria | 3643 |
| 73 | Ga0070659_100438491 | 3300005366 | Unclassified | 1106 |
| 74 | Ga0070667_100007776 | 3300005367 | Bacteria | 8886 |
| 75 | Ga0070667_100026339 | 3300005367 | Bacteria | 4836 |
| 76 | Ga0070667_100733718 | 3300005367 | Unclassified | 915 |
| 77 | Ga0070710_10419190 | 3300005437 | Unclassified | 901 |
| 78 | Ga0070701_10024563 | 3300005438 | Bacteria | 2916 |
| 79 | Ga0070700_100174624 | 3300005441 | Bacteria | 1490 |
| 80 | Ga0070663_100057255 | 3300005455 | Bacteria | 2796 |
| 81 | Ga0070678_100104073 | 3300005456 | Bacteria | 2207 |
| 82 | Ga0070678_100158535 | 3300005456 | Bacteria | 1831 |
| 83 | Ga0070678_100491114 | 3300005456 | Bacteria | 1082 |
| 84 | Ga0070678_101942958 | 3300005456 | Unclassified | 556 |
| 85 | Ga0070662_100007657 | 3300005457 | Bacteria | 7006 |
| 86 | Ga0070662_100012826 | 3300005457 | Bacteria | 5567 |
| 87 | Ga0070662_100893363 | 3300005457 | Bacteria | 758 |
| 88 | Ga0068867_100011193 | 3300005459 | Bacteria | 6329 |
| 89 | Ga0068867_100082703 | 3300005459 | Bacteria | 2423 |
| 90 | Ga0068867_100215710 | 3300005459 | Bacteria | 1544 |
| 91 | Ga0070685_10020548 | 3300005466 | Bacteria | 3574 |
| 92 | Ga0070685_10716076 | 3300005466 | Bacteria | 731 |
| 93 | Ga0070685_11311155 | 3300005466 | Bacteria | 553 |
| 94 | Ga0070706_101101053 | 3300005467 | Unclassified | 731 |
| 95 | Ga0070698_100012635 | 3300005471 | Bacteria | 8940 |
| 96 | Ga0070699_100845045 | 3300005518 | Bacteria | 838 |
| 97 | Ga0070679_100414079 | 3300005530 | Bacteria | 1293 |
| 98 | Ga0070684_100000042 | 3300005535 | Bacteria | 89896 |
| 99 | Ga0070684_100046400 | 3300005535 | Bacteria | 3764 |
| 100 | Ga0068853_100005393 | 3300005539 | Bacteria | 10014 |
| 101 | Ga0068853_100232242 | 3300005539 | Bacteria | 1688 |
| 102 | Ga0068853_100309127 | 3300005539 | Bacteria | 1463 |
| 103 | Ga0068853_100423895 | 3300005539 | Bacteria | 1248 |
| 104 | Ga0068853_100719163 | 3300005539 | Bacteria | 953 |
| 105 | Ga0068853_101856963 | 3300005539 | Bacteria | 584 |
| 106 | Ga0068853_102050293 | 3300005539 | Bacteria | 555 |
| 107 | Ga0070672_100492079 | 3300005543 | Bacteria | 1060 |
| 108 | Ga0070672_100723598 | 3300005543 | Unclassified | 872 |
| 109 | Ga0070672_101066334 | 3300005543 | Bacteria | 717 |
| 110 | Ga0070686_100017405 | 3300005544 | Bacteria | 4199 |
| 111 | Ga0070686_100026271 | 3300005544 | Bacteria | 3513 |
| 112 | Ga0070686_100186827 | 3300005544 | Unclassified | 1476 |
| 113 | Ga0070686_100378907 | 3300005544 | Bacteria | 1070 |
| 114 | Ga0070693_100409212 | 3300005547 | Bacteria | 942 |
| 115 | Ga0070693_100774278 | 3300005547 | Unclassified | 709 |
| 116 | Ga0070693_101279440 | 3300005547 | Unclassified | 566 |
| 117 | Ga0070665_100045456 | 3300005548 | Bacteria | 4410 |
| 118 | Ga0070665_100234608 | 3300005548 | Bacteria | 1835 |
| 119 | Ga0070665_101072319 | 3300005548 | Bacteria | 817 |
| 120 | Ga0070664_100000266 | 3300005564 | Bacteria | 37671 |
| 121 | Ga0070664_100021759 | 3300005564 | Bacteria | 5288 |
| 122 | Ga0070664_100033015 | 3300005564 | Bacteria | 4331 |
| 123 | Ga0070664_100129595 | 3300005564 | Bacteria | 2215 |
| 124 | Ga0070664_100157727 | 3300005564 | Bacteria | 2006 |
| 125 | Ga0070664_100331758 | 3300005564 | Bacteria | 1380 |
| 126 | Ga0070664_100367048 | 3300005564 | Bacteria | 1312 |
| 127 | Ga0070664_100621325 | 3300005564 | Bacteria | 1003 |
| 128 | Ga0070664_101753215 | 3300005564 | Bacteria | 589 |
| 129 | Ga0068857_100007376 | 3300005577 | Bacteria | 9467 |
| 130 | Ga0068857_100052247 | 3300005577 | Bacteria | 3626 |
| 131 | Ga0068857_100134633 | 3300005577 | Bacteria | 2231 |
| 132 | Ga0068857_100138343 | 3300005577 | Bacteria | 2200 |
| 133 | Ga0068857_102492200 | 3300005577 | Bacteria | 508 |
| 134 | Ga0068854_100007085 | 3300005578 | Bacteria | 7157 |
| 135 | Ga0068854_100853421 | 3300005578 | Unclassified | 797 |
| 136 | Ga0068854_101251263 | 3300005578 | Unclassified | 666 |
| 137 | Ga0068856_100034401 | 3300005614 | Bacteria | 4963 |
| 138 | Ga0070702_100052122 | 3300005615 | Bacteria | 2346 |
| 139 | Ga0070702_101525516 | 3300005615 | Bacteria | 550 |
| 140 | Ga0068852_100233980 | 3300005616 | Unclassified | 1753 |
| 141 | Ga0068852_100736680 | 3300005616 | Bacteria | 997 |
| 142 | Ga0068852_100760054 | 3300005616 | Bacteria | 982 |
| 143 | Ga0068852_101877669 | 3300005616 | Bacteria | 621 |
| 144 | Ga0068852_102313738 | 3300005616 | Unclassified | 558 |
| 145 | Ga0068859_100084228 | 3300005617 | Unclassified | 3224 |
| 146 | Ga0068859_100245095 | 3300005617 | Bacteria | 1882 |
| 147 | Ga0068859_100249471 | 3300005617 | Bacteria | 1865 |
| 148 | Ga0068859_100278937 | 3300005617 | Bacteria | 1764 |
| 149 | Ga0068859_101209885 | 3300005617 | Bacteria | 832 |
| 150 | Ga0068859_102963295 | 3300005617 | Bacteria | 519 |
| 151 | Ga0068864_100017320 | 3300005618 | Bacteria | 6006 |
| 152 | Ga0068864_100076190 | 3300005618 | Unclassified | 2930 |
| 153 | Ga0068864_100230396 | 3300005618 | Bacteria | 1713 |
| 154 | Ga0068864_100527424 | 3300005618 | Bacteria | 1139 |
| 155 | Ga0068864_100537227 | 3300005618 | Bacteria | 1129 |
| 156 | Ga0068866_10071400 | 3300005718 | Bacteria | 1836 |
| 157 | Ga0068861_100464698 | 3300005719 | Bacteria | 1137 |
| 158 | Ga0068861_102008380 | 3300005719 | Unclassified | 577 |
| 159 | Ga0068851_10127135 | 3300005834 | Bacteria | 1375 |
| 160 | Ga0068851_10310076 | 3300005834 | Unclassified | 909 |
| 161 | Ga0068870_10301157 | 3300005840 | Bacteria | 1012 |
| 162 | Ga0068863_100029821 | 3300005841 | Bacteria | 5210 |
| 163 | Ga0068863_100633534 | 3300005841 | Bacteria | 1060 |
| 164 | Ga0068858_100030976 | 3300005842 | Bacteria | 4967 |
| 165 | Ga0068858_100374471 | 3300005842 | Bacteria | 1366 |
| 166 | Ga0068858_100458827 | 3300005842 | Bacteria | 1228 |
| 167 | Ga0068858_100755513 | 3300005842 | Bacteria | 948 |
| 168 | Ga0068858_101837060 | 3300005842 | Bacteria | 599 |
| 169 | Ga0068860_100270533 | 3300005843 | Bacteria | 1658 |
| 170 | Ga0068860_100392389 | 3300005843 | Bacteria | 1372 |
| 171 | Ga0068860_101952180 | 3300005843 | Bacteria | 608 |
| 172 | Ga0068860_102165952 | 3300005843 | Bacteria | 577 |
| 173 | Ga0068860_102342247 | 3300005843 | Unclassified | 554 |
| 174 | Ga0068862_101318237 | 3300005844 | Bacteria | 723 |
| 175 | Ga0068862_101758981 | 3300005844 | Unclassified | 629 |
| 176 | Ga0068862_102245473 | 3300005844 | Bacteria | 557 |
| 177 | Ga0081539_10048260 | 3300005985 | Bacteria | 2423 |
| 178 | Ga0070715_10354220 | 3300006163 | Bacteria | 803 |
| 179 | Ga0070716_100062150 | 3300006173 | Bacteria | 2164 |
| 180 | Ga0075366_10028139 | 3300006195 | Bacteria | 3298 |
| 181 | Ga0075366_10103732 | 3300006195 | Bacteria | 1708 |
| 182 | Ga0075366_10269462 | 3300006195 | Bacteria | 1040 |
| 183 | Ga0075366_10414943 | 3300006195 | Bacteria | 829 |
| 184 | Ga0075366_10638183 | 3300006195 | Bacteria | 661 |
| 185 | Ga0075366_10999262 | 3300006195 | Bacteria | 522 |
| 186 | Ga0097621_100008842 | 3300006237 | Bacteria | 7280 |
| 187 | Ga0097621_100109540 | 3300006237 | Bacteria | 2333 |
| 188 | Ga0097621_100429876 | 3300006237 | Bacteria | 1186 |
| 189 | Ga0097621_101064824 | 3300006237 | Bacteria | 758 |
| 190 | Ga0097621_101228420 | 3300006237 | Bacteria | 706 |
| 191 | Ga0097621_101316237 | 3300006237 | Bacteria | 683 |
| 192 | Ga0097621_101615024 | 3300006237 | Unclassified | 616 |
| 193 | Ga0068871_100018297 | 3300006358 | Bacteria | 5322 |
| 194 | Ga0068871_100153477 | 3300006358 | Bacteria | 1965 |
| 195 | Ga0068871_100228048 | 3300006358 | Bacteria | 1616 |
| 196 | Ga0068871_100307122 | 3300006358 | Bacteria | 1394 |
| 197 | Ga0068871_100500983 | 3300006358 | Bacteria | 1094 |
| 198 | Ga0068871_100838780 | 3300006358 | Bacteria | 849 |
| 199 | Ga0075434_100341524 | 3300006871 | Unclassified | 1518 |
| 200 | Ga0075434_100983119 | 3300006871 | Unclassified | 858 |
| 201 | Ga0068865_100042863 | 3300006881 | Bacteria | 3088 |
| 202 | Ga0097620_100084226 | 3300006931 | Unclassified | 3224 |
| 203 | Ga0097620_100245093 | 3300006931 | Bacteria | 1882 |
| 204 | Ga0097620_100249474 | 3300006931 | Bacteria | 1865 |
| 205 | Ga0097620_100278968 | 3300006931 | Bacteria | 1764 |
| 206 | Ga0097620_101209834 | 3300006931 | Bacteria | 832 |
| 207 | Ga0097620_102963747 | 3300006931 | Bacteria | 519 |
| 208 | Ga0075435_101783023 | 3300007076 | Bacteria | 540 |
| 209 | Ga0105251_10357245 | 3300009011 | Bacteria | 667 |
| 210 | Ga0105240_10045837 | 3300009093 | Bacteria | 5545 |
| 211 | Ga0105240_10266102 | 3300009093 | Bacteria | 1976 |
| 212 | Ga0105240_12759045 | 3300009093 | Unclassified | 506 |
| 213 | Ga0111539_10068878 | 3300009094 | Bacteria | 4178 |
| 214 | Ga0105247_10230238 | 3300009101 | Bacteria | 1258 |
| 215 | Ga0105241_10100694 | 3300009174 | Bacteria | 2297 |
| 216 | Ga0105241_10290915 | 3300009174 | Bacteria | 1399 |
| 217 | Ga0105242_10077472 | 3300009176 | Bacteria | 2774 |
| 218 | Ga0105242_10194731 | 3300009176 | Bacteria | 1797 |
| 219 | Ga0105242_11285004 | 3300009176 | Bacteria | 755 |
| 220 | Ga0105242_12519653 | 3300009176 | Bacteria | 563 |
| 221 | Ga0105248_10203751 | 3300009177 | Bacteria | 2229 |
| 222 | Ga0105237_10498908 | 3300009545 | Bacteria | 1224 |
| 223 | Ga0105237_11595124 | 3300009545 | Bacteria | 659 |
| 224 | Ga0105238_10087254 | 3300009551 | Bacteria | 3107 |
| 225 | Ga0105249_10628113 | 3300009553 | Unclassified | 1130 |
| 226 | Ga0105249_10974096 | 3300009553 | Unclassified | 916 |
| 227 | Ga0105249_11646859 | 3300009553 | Bacteria | 714 |
| 228 | Ga0105239_10156358 | 3300010375 | Bacteria | 2546 |
| 229 | Ga0105239_13446278 | 3300010375 | Unclassified | 514 |
| 230 | Ga0105246_10478524 | 3300011119 | Bacteria | 1053 |
| 231 | Ga0105246_10499433 | 3300011119 | Bacteria | 1033 |
| 232 | Ga0105246_11325196 | 3300011119 | Bacteria | 668 |
| 233 | Ga0105246_12576037 | 3300011119 | Bacteria | 502 |
| 234 | Ga0157373_10095260 | 3300013100 | Bacteria | 2095 |
| 235 | Ga0157371_10304525 | 3300013102 | Bacteria | 1154 |
| 236 | Ga0157371_10927237 | 3300013102 | Bacteria | 661 |
| 237 | Ga0157371_11433130 | 3300013102 | Unclassified | 537 |
| 238 | Ga0157371_11541248 | 3300013102 | Unclassified | 519 |
| 239 | Ga0157369_11085547 | 3300013105 | Unclassified | 818 |
| 240 | Ga0157374_10007250 | 3300013296 | Bacteria | 9444 |
| 241 | Ga0157374_10011781 | 3300013296 | Bacteria | 7585 |
| 242 | Ga0157374_10036791 | 3300013296 | Bacteria | 4487 |
| 243 | Ga0157374_10050945 | 3300013296 | Bacteria | 3851 |
| 244 | Ga0157374_10132137 | 3300013296 | Bacteria | 2416 |
| 245 | Ga0157374_11653172 | 3300013296 | Bacteria | 665 |
| 246 | Ga0157374_12293949 | 3300013296 | Bacteria | 567 |
| 247 | Ga0157378_10006964 | 3300013297 | Bacteria | 9862 |
| 248 | Ga0157378_10077674 | 3300013297 | Unclassified | 2993 |
| 249 | Ga0157378_10117934 | 3300013297 | Bacteria | 2442 |
| 250 | Ga0157378_10292239 | 3300013297 | Unclassified | 1574 |
| 251 | Ga0157378_10405951 | 3300013297 | Bacteria | 1344 |
| 252 | Ga0157378_11125496 | 3300013297 | Bacteria | 823 |
| 253 | Ga0163162_10010595 | 3300013306 | Bacteria | 8965 |
| 254 | Ga0163162_10061057 | 3300013306 | Bacteria | 3807 |
| 255 | Ga0163162_10072297 | 3300013306 | Bacteria | 3504 |
| 256 | Ga0163162_10074283 | 3300013306 | Bacteria | 3458 |
| 257 | Ga0163162_10112642 | 3300013306 | Bacteria | 2819 |
| 258 | Ga0163162_10198429 | 3300013306 | Bacteria | 2135 |
| 259 | Ga0163162_10202289 | 3300013306 | Bacteria | 2115 |
| 260 | Ga0163162_10209381 | 3300013306 | Unclassified | 2079 |
| 261 | Ga0163162_10471819 | 3300013306 | Bacteria | 1386 |
| 262 | Ga0163162_11012872 | 3300013306 | Bacteria | 939 |
| 263 | Ga0163162_12288382 | 3300013306 | Bacteria | 621 |
| 264 | Ga0157372_10886562 | 3300013307 | Bacteria | 1035 |
| 265 | Ga0157372_11695183 | 3300013307 | Bacteria | 727 |
| 266 | Ga0157372_12899695 | 3300013307 | Bacteria | 549 |
| 267 | Ga0157375_10005827 | 3300013308 | Bacteria | 10719 |
| 268 | Ga0157375_10019451 | 3300013308 | Bacteria | 6176 |
| 269 | Ga0157375_10020351 | 3300013308 | Bacteria | 6060 |
| 270 | Ga0157375_10330871 | 3300013308 | Bacteria | 1688 |
| 271 | Ga0157375_10494301 | 3300013308 | Unclassified | 1388 |
| 272 | Ga0157375_10608597 | 3300013308 | Bacteria | 1251 |
| 273 | Ga0163163_10000079 | 3300014325 | Bacteria | 106874 |
| 274 | Ga0163163_10000858 | 3300014325 | Bacteria | 25873 |
| 275 | Ga0163163_10112201 | 3300014325 | Bacteria | 2755 |
| 276 | Ga0163163_10130195 | 3300014325 | Bacteria | 2556 |
| 277 | Ga0163163_10274385 | 3300014325 | Unclassified | 1737 |
| 278 | Ga0163163_11609672 | 3300014325 | Bacteria | 710 |
| 279 | Ga0157380_10625780 | 3300014326 | Unclassified | 1069 |
| 280 | Ga0157377_10001057 | 3300014745 | Bacteria | 11646 |
| 281 | Ga0157377_10051163 | 3300014745 | Bacteria | 2329 |
| 282 | Ga0157377_11688770 | 3300014745 | Bacteria | 510 |
| 283 | Ga0157379_10048092 | 3300014968 | Bacteria | 3808 |
| 284 | Ga0157379_10188859 | 3300014968 | Bacteria | 1862 |
| 285 | Ga0157379_10641397 | 3300014968 | Bacteria | 994 |
| 286 | Ga0157379_11695832 | 3300014968 | Bacteria | 619 |
| 287 | Ga0157379_11717621 | 3300014968 | Bacteria | 615 |
| 288 | Ga0157376_10032451 | 3300014969 | Bacteria | 4193 |
| 289 | Ga0157376_10146539 | 3300014969 | Bacteria | 2124 |
| 290 | Ga0157376_10216009 | 3300014969 | Bacteria | 1773 |
| 291 | Ga0163161_10038246 | 3300017792 | Bacteria | 3441 |
| 292 | Ga0163161_10124226 | 3300017792 | Bacteria | 1942 |
| 293 | Ga0163161_10162549 | 3300017792 | Bacteria | 1703 |
| 294 | Ga0163161_10595578 | 3300017792 | Bacteria | 911 |
| 295 | Ga0163161_11671018 | 3300017792 | Bacteria | 563 |
| 296 | Ga0209258_130183 | 3300025242 | Bacteria | 508 |
| 297 | Ga0209646_1010327 | 3300025246 | Bacteria | 1464 |
| 298 | Ga0207697_10151948 | 3300025315 | Bacteria | 1008 |
| 299 | Ga0207656_10131894 | 3300025321 | Bacteria | 1171 |
| 300 | Ga0207656_10665437 | 3300025321 | Bacteria | 533 |
| 301 | Ga0207692_10420639 | 3300025898 | Unclassified | 836 |
| 302 | Ga0207642_10182853 | 3300025899 | Bacteria | 1144 |
| 303 | Ga0207642_10287207 | 3300025899 | Bacteria | 948 |
| 304 | Ga0207688_10100377 | 3300025901 | Unclassified | 1671 |
| 305 | Ga0207680_10133692 | 3300025903 | Unclassified | 1637 |
| 306 | Ga0207680_10271961 | 3300025903 | Bacteria | 1175 |
| 307 | Ga0207680_10543751 | 3300025903 | Bacteria | 829 |
| 308 | Ga0207647_10508386 | 3300025904 | Bacteria | 671 |
| 309 | Ga0207685_10139405 | 3300025905 | Bacteria | 1086 |
| 310 | Ga0207645_10005620 | 3300025907 | Bacteria | 9063 |
| 311 | Ga0207645_10047614 | 3300025907 | Unclassified | 2738 |
| 312 | Ga0207645_10255965 | 3300025907 | Bacteria | 1159 |
| 313 | Ga0207654_10353430 | 3300025911 | Bacteria | 1012 |
| 314 | Ga0207695_11544615 | 3300025913 | Bacteria | 544 |
| 315 | Ga0207662_10026150 | 3300025918 | Bacteria | 3365 |
| 316 | Ga0207662_11322865 | 3300025918 | Unclassified | 512 |
| 317 | Ga0207657_10136994 | 3300025919 | Bacteria | 2002 |
| 318 | Ga0207649_10001251 | 3300025920 | Bacteria | 15197 |
| 319 | Ga0207649_10027411 | 3300025920 | Bacteria | 3342 |
| 320 | Ga0207649_10440566 | 3300025920 | Bacteria | 981 |
| 321 | Ga0207649_10455342 | 3300025920 | Unclassified | 966 |
| 322 | Ga0207652_11410985 | 3300025921 | Unclassified | 600 |
| 323 | Ga0207681_10435047 | 3300025923 | Bacteria | 1065 |
| 324 | Ga0207681_10567598 | 3300025923 | Unclassified | 935 |
| 325 | Ga0207681_11769105 | 3300025923 | Unclassified | 516 |
| 326 | Ga0207650_10007835 | 3300025925 | Bacteria | 7276 |
| 327 | Ga0207650_10299120 | 3300025925 | Bacteria | 1314 |
| 328 | Ga0207650_10821854 | 3300025925 | Unclassified | 788 |
| 329 | Ga0207659_10134461 | 3300025926 | Bacteria | 1913 |
| 330 | Ga0207659_10156935 | 3300025926 | Bacteria | 1783 |
| 331 | Ga0207659_10266696 | 3300025926 | Bacteria | 1395 |
| 332 | Ga0207659_10524684 | 3300025926 | Bacteria | 1004 |
| 333 | Ga0207644_10043629 | 3300025931 | Bacteria | 3184 |
| 334 | Ga0207644_10171875 | 3300025931 | Bacteria | 1692 |
| 335 | Ga0207644_11566943 | 3300025931 | Unclassified | 553 |
| 336 | Ga0207644_11610659 | 3300025931 | Unclassified | 544 |
| 337 | Ga0207690_10025700 | 3300025932 | Bacteria | 3701 |
| 338 | Ga0207706_10012656 | 3300025933 | Bacteria | 7677 |
| 339 | Ga0207706_10023622 | 3300025933 | Bacteria | 5520 |
| 340 | Ga0207706_10075808 | 3300025933 | Bacteria | 2958 |
| 341 | Ga0207706_10106753 | 3300025933 | Unclassified | 2464 |
| 342 | Ga0207686_10023958 | 3300025934 | Bacteria | 3530 |
| 343 | Ga0207686_10497086 | 3300025934 | Bacteria | 946 |
| 344 | Ga0207670_10005077 | 3300025936 | Bacteria | 7183 |
| 345 | Ga0207670_10098753 | 3300025936 | Bacteria | 2081 |
| 346 | Ga0207669_10008571 | 3300025937 | Bacteria | 4809 |
| 347 | Ga0207704_10167984 | 3300025938 | Bacteria | 1569 |
| 348 | Ga0207704_10177058 | 3300025938 | Bacteria | 1537 |
| 349 | Ga0207665_10117852 | 3300025939 | Bacteria | 1873 |
| 350 | Ga0207665_10770192 | 3300025939 | Bacteria | 759 |
| 351 | Ga0207691_10043521 | 3300025940 | Bacteria | 4138 |
| 352 | Ga0207691_10115723 | 3300025940 | Bacteria | 2380 |
| 353 | Ga0207691_10596826 | 3300025940 | Bacteria | 935 |
| 354 | Ga0207691_10929169 | 3300025940 | Bacteria | 727 |
| 355 | Ga0207711_10469456 | 3300025941 | Bacteria | 1172 |
| 356 | Ga0207689_10010865 | 3300025942 | Bacteria | 7830 |
| 357 | Ga0207689_10030074 | 3300025942 | Bacteria | 4528 |
| 358 | Ga0207689_10062143 | 3300025942 | Bacteria | 3071 |
| 359 | Ga0207689_10113980 | 3300025942 | Bacteria | 2222 |
| 360 | Ga0207689_10679031 | 3300025942 | Bacteria | 868 |
| 361 | Ga0207661_10002324 | 3300025944 | Bacteria | 13098 |
| 362 | Ga0207661_10050937 | 3300025944 | Bacteria | 3301 |
| 363 | Ga0207661_10135033 | 3300025944 | Unclassified | 2118 |
| 364 | Ga0207661_10281295 | 3300025944 | Bacteria | 1487 |
| 365 | Ga0207661_10554578 | 3300025944 | Bacteria | 1053 |
| 366 | Ga0207661_11779005 | 3300025944 | Bacteria | 562 |
| 367 | Ga0207661_12062460 | 3300025944 | Unclassified | 516 |
| 368 | Ga0207679_10000304 | 3300025945 | Bacteria | 36952 |
| 369 | Ga0207679_10021359 | 3300025945 | Bacteria | 4388 |
| 370 | Ga0207679_10121864 | 3300025945 | Bacteria | 2077 |
| 371 | Ga0207679_10336309 | 3300025945 | Bacteria | 1312 |
| 372 | Ga0207679_10351006 | 3300025945 | Bacteria | 1286 |
| 373 | Ga0207679_10810883 | 3300025945 | Bacteria | 854 |
| 374 | Ga0207679_11499930 | 3300025945 | Bacteria | 618 |
| 375 | Ga0207679_11523109 | 3300025945 | Bacteria | 613 |
| 376 | Ga0207667_10054066 | 3300025949 | Bacteria | 4224 |
| 377 | Ga0207651_10033276 | 3300025960 | Bacteria | 3323 |
| 378 | Ga0207651_10126981 | 3300025960 | Bacteria | 1945 |
| 379 | Ga0207651_11039066 | 3300025960 | Unclassified | 733 |
| 380 | Ga0207712_10342661 | 3300025961 | Bacteria | 1240 |
| 381 | Ga0207712_10494555 | 3300025961 | Bacteria | 1044 |
| 382 | Ga0207668_10198152 | 3300025972 | Bacteria | 1597 |
| 383 | Ga0207668_10407724 | 3300025972 | Unclassified | 1151 |
| 384 | Ga0207668_11965147 | 3300025972 | Unclassified | 527 |
| 385 | Ga0207640_11387054 | 3300025981 | Bacteria | 629 |
| 386 | Ga0207640_11531434 | 3300025981 | Unclassified | 600 |
| 387 | Ga0207640_12189909 | 3300025981 | Bacteria | 502 |
| 388 | Ga0207658_10181715 | 3300025986 | Unclassified | 1741 |
| 389 | Ga0207658_12102996 | 3300025986 | Unclassified | 513 |
| 390 | Ga0207677_10037968 | 3300026023 | Bacteria | 3152 |
| 391 | Ga0207677_10067812 | 3300026023 | Bacteria | 2501 |
| 392 | Ga0207677_10075641 | 3300026023 | Bacteria | 2394 |
| 393 | Ga0207677_10724821 | 3300026023 | Bacteria | 884 |
| 394 | Ga0207677_11151012 | 3300026023 | Bacteria | 709 |
| 395 | Ga0207703_10046568 | 3300026035 | Bacteria | 3492 |
| 396 | Ga0207703_10343838 | 3300026035 | Bacteria | 1372 |
| 397 | Ga0207703_10346439 | 3300026035 | Bacteria | 1367 |
| 398 | Ga0207639_10020169 | 3300026041 | Bacteria | 4769 |
| 399 | Ga0207639_10179961 | 3300026041 | Bacteria | 1798 |
| 400 | Ga0207639_10428778 | 3300026041 | Bacteria | 1197 |
| 401 | Ga0207639_11386759 | 3300026041 | Bacteria | 660 |
| 402 | Ga0207639_11500381 | 3300026041 | Bacteria | 633 |
| 403 | Ga0207639_11843849 | 3300026041 | Bacteria | 565 |
| 404 | Ga0207678_10122620 | 3300026067 | Unclassified | 2218 |
| 405 | Ga0207678_10855658 | 3300026067 | Bacteria | 804 |
| 406 | Ga0207678_11085795 | 3300026067 | Bacteria | 709 |
| 407 | Ga0207702_10213347 | 3300026078 | Bacteria | 1796 |
| 408 | Ga0207641_10141941 | 3300026088 | Bacteria | 2168 |
| 409 | Ga0207641_11050442 | 3300026088 | Bacteria | 812 |
| 410 | Ga0207648_10022838 | 3300026089 | Bacteria | 5612 |
| 411 | Ga0207648_10077034 | 3300026089 | Bacteria | 2907 |
| 412 | Ga0207648_10351872 | 3300026089 | Bacteria | 1328 |
| 413 | Ga0207648_11234472 | 3300026089 | Bacteria | 702 |
| 414 | Ga0207676_10005907 | 3300026095 | Bacteria | 8647 |
| 415 | Ga0207676_10144345 | 3300026095 | Unclassified | 2042 |
| 416 | Ga0207676_10164183 | 3300026095 | Bacteria | 1928 |
| 417 | Ga0207676_10427899 | 3300026095 | Bacteria | 1243 |
| 418 | Ga0207676_10588539 | 3300026095 | Bacteria | 1067 |
| 419 | Ga0207676_11282072 | 3300026095 | Bacteria | 727 |
| 420 | Ga0207676_12555015 | 3300026095 | Bacteria | 507 |
| 421 | Ga0207674_10004112 | 3300026116 | Bacteria | 17616 |
| 422 | Ga0207674_10005133 | 3300026116 | Bacteria | 15625 |
| 423 | Ga0207674_10156350 | 3300026116 | Bacteria | 2235 |
| 424 | Ga0207674_10236756 | 3300026116 | Bacteria | 1773 |
| 425 | Ga0207675_100256351 | 3300026118 | Bacteria | 1694 |
| 426 | Ga0207675_100404952 | 3300026118 | Bacteria | 1345 |
| 427 | Ga0207675_100439250 | 3300026118 | Bacteria | 1291 |
| 428 | Ga0207683_10002030 | 3300026121 | Bacteria | 17898 |
| 429 | Ga0207683_10989203 | 3300026121 | Unclassified | 781 |
| 430 | Ga0207683_12098461 | 3300026121 | Unclassified | 513 |
| 431 | Ga0207698_10029302 | 3300026142 | Bacteria | 3941 |
| 432 | Ga0207698_11125676 | 3300026142 | Bacteria | 798 |
| 433 | Ga0207698_11654253 | 3300026142 | Bacteria | 656 |
| 434 | Ga0207428_10796533 | 3300027907 | Bacteria | 672 |
| 435 | Ga0268266_10459382 | 3300028379 | Bacteria | 1211 |
| 436 | Ga0268266_12380430 | 3300028379 | Bacteria | 500 |
| 437 | Ga0268265_10079959 | 3300028380 | Bacteria | 2577 |
| 438 | Ga0268265_11704684 | 3300028380 | Unclassified | 636 |
| 439 | Ga0268264_10245929 | 3300028381 | Bacteria | 1659 |
| 440 | Ga0268264_11822815 | 3300028381 | Bacteria | 618 |
| 441 | Ga0307513_10165443 | 3300031456 | Bacteria | 2097 |
| 442 | Ga0307513_10192765 | 3300031456 | Bacteria | 1888 |
| 443 | Ga0307513_10203611 | 3300031456 | Bacteria | 1817 |
| 444 | Ga0307509_10553964 | 3300031507 | Unclassified | 827 |
| 445 | Ga0373923_0707963 | 3300035111 | Bacteria | 500 |
| 446 | Ga0373953_0020138 | 3300035117 | Bacteria | 2491 |
| 447 | Ga0373956_0207167 | 3300035119 | Bacteria | 930 |
| 448 | Ga0373943_0723252 | 3300035170 | Bacteria | 590 |
| 449 | Ga0373955_0061792 | 3300035172 | Bacteria | 2070 |
| 450 | Ga0373933_0017889 | 3300035724 | Bacteria | 3979 |
| 451 | Ga0373947_0077682 | 3300035725 | Bacteria | 2048 |
| 452 | Ga0373937_0002819 | 3300036401 | Bacteria | 14528 |
| 453 | Ga0373925_0946419 | 3300037068 | Bacteria | 710 |
| 454 | Ga0373925_0964512 | 3300037068 | Unclassified | 702 |
| 455 | Ga0439436_0005795 | 3300041404 | Bacteria | 3785 |
| 456 | Ga0439439_0045901 | 3300041406 | Bacteria | 1140 |
| 457 | Ga0451795_0175453 | 3300041456 | Bacteria | 1012 |
| 458 | Ga0451798_0177859 | 3300041458 | Bacteria | 799 |
| 459 | Ga0451798_0752934 | 3300041458 | Bacteria | 920 |
| 460 | Ga0451807_0179209 | 3300041486 | Bacteria | 1557 |
| 461 | Ga0451833_0771407 | 3300041491 | Bacteria | 543 |
| 462 | Ga0451833_0982377 | 3300041491 | Bacteria | 711 |
| 463 | Ga0451835_0373411 | 3300041492 | Bacteria | 775 |
| 464 | Ga0451851_0038748 | 3300041507 | Bacteria | 1197 |
| 465 | Ga0451851_1041435 | 3300041507 | Bacteria | 1172 |
| 466 | Ga0451853_0104252 | 3300041512 | Bacteria | 1104 |
| 467 | Ga0451853_1693258 | 3300041512 | Unclassified | 825 |
| 468 | Ga0451853_2288465 | 3300041512 | Bacteria | 2561 |
| 469 | Ga0451853_3502709 | 3300041512 | Unclassified | 1227 |
| 470 | Ga0439449_0026721 | 3300042007 | Bacteria | 2154 |
| 471 | Ga0439449_0185409 | 3300042007 | Unclassified | 778 |
| 472 | Ga0439457_000285 | 3300042014 | Bacteria | 14022 |
| 473 | Ga0439462_0001557 | 3300042015 | Bacteria | 5146 |
| 474 | Ga0439462_0093246 | 3300042015 | Unclassified | 827 |
| 475 | Ga0450891_040042 | 3300042129 | Unclassified | 502 |
| 476 | Ga0451577_0976084 | 3300042876 | Bacteria | 761 |
| 477 | Ga0466972_0000082 | 3300044658 | Bacteria | 88592 |
| 478 | Ga0466972_0026400 | 3300044658 | Bacteria | 2879 |
| 479 | Ga0466972_0604377 | 3300044658 | Bacteria | 519 |
| 480 | Ga0453683_0217607 | 3300044673 | Unclassified | 1214 |
| 481 | Ga0453684_0023120 | 3300044712 | Bacteria | 9177 |
| 482 | Ga0466968_0623818 | 3300044735 | Bacteria | 546 |
| 483 | Ga0466957_0004118 | 3300044842 | Bacteria | 8054 |
| 484 | Ga0466960_0125402 | 3300044901 | Bacteria | 1349 |
| 485 | Ga0451576_1061732 | 3300045051 | Bacteria | 848 |
| 486 | Ga0495638_0064095 | 3300046460 | Bacteria | 2264 |
| 487 | Ga0495618_0116187 | 3300046514 | Bacteria | 1713 |
| 488 | Ga0495628_0105251 | 3300046516 | Bacteria | 2174 |
| 489 | Ga0495630_0020077 | 3300046517 | Bacteria | 4921 |
| 490 | Ga0495640_0214470 | 3300046533 | Bacteria | 1216 |
| 491 | Ga0495587_0149716 | 3300046536 | Bacteria | 1330 |
| 492 | Ga0495645_0343324 | 3300046543 | Bacteria | 964 |
| 493 | Ga0495634_0266078 | 3300046642 | Bacteria | 1045 |
| 494 | Ga0495635_0137476 | 3300046663 | Bacteria | 1665 |
| 495 | Ga0495657_0332099 | 3300046675 | Bacteria | 902 |
| 496 | Ga0495623_0565307 | 3300046679 | Bacteria | 594 |
| 497 | Ga0495613_0425347 | 3300046689 | Bacteria | 903 |
| 498 | Ga0495674_0875187 | 3300047319 | Bacteria | 695 |
| 499 | Ga0495680_0086730 | 3300047322 | Bacteria | 2355 |
| 500 | Ga0495684_0467119 | 3300047471 | Bacteria | 874 |
| 501 | Ga0496104_0776518 | 3300048907 | Bacteria | 865 |
| 502 | Ga0496104_0969496 | 3300048907 | Bacteria | 755 |
| 503 | Ga0496105_1179497 | 3300048908 | Bacteria | 565 |
| 504 | Ga0496109_1137734 | 3300048912 | Bacteria | 718 |
| 505 | Ga0496110_0024996 | 3300048913 | Bacteria | 5099 |
| 506 | Ga0496110_0239308 | 3300048913 | Bacteria | 1652 |
| 507 | Ga0496114_1635964 | 3300048917 | Bacteria | 532 |
| 508 | Ga0501291_095642 | 3300049514 | Bacteria | 613 |
| 509 | Ga0501209_104842 | 3300049656 | Bacteria | 831 |
| 510 | Ga0501257_015899 | 3300049686 | Bacteria | 1741 |
| 511 | Ga0501257_022587 | 3300049686 | Bacteria | 1489 |
| 512 | Ga0501257_185157 | 3300049686 | Bacteria | 591 |
| 513 | Ga0501219_000531 | 3300049703 | Bacteria | 5697 |
| 514 | Ga0501225_0000233 | 3300049705 | Bacteria | 17294 |
| 515 | Ga0501225_0021144 | 3300049705 | Bacteria | 1797 |
| 516 | Ga0501225_0247214 | 3300049705 | Bacteria | 585 |
| 517 | Ga0501241_001987 | 3300049758 | Bacteria | 4010 |
| 518 | Ga0501280_116674 | 3300049776 | Bacteria | 526 |
| 519 | Ga0501035_0149331 | 3300049822 | Bacteria | 2029 |
| 520 | Ga0501044_0273699 | 3300049823 | Bacteria | 1623 |
| 521 | Ga0501044_0298286 | 3300049823 | Bacteria | 1541 |
| 522 | Ga0501284_00017 | 3300050005 | Bacteria | 96362 |
| 523 | nmdc:mga0k408_20911_c1 | 3300050493 | Bacteria | 3672 |
| 524 | nmdc:mga0k408_219047_c1 | 3300050493 | Bacteria | 1136 |
| 525 | nmdc:mga0k408_310614_c1 | 3300050493 | Bacteria | 941 |
| 526 | nmdc:mga0k408_387745_c1 | 3300050493 | Bacteria | 832 |
| 527 | nmdc:mga0k408_575680_c1 | 3300050493 | Bacteria | 665 |
| 528 | nmdc:mga0k408_860080_c1 | 3300050493 | Bacteria | 527 |
| 529 | nmdc:mga08y16_568374_c1 | 3300050511 | Bacteria | 1146 |
| 530 | nmdc:mga0n895_1074222_c1 | 3300050512 | Unclassified | 783 |
| 531 | nmdc:mga0n895_221009_c1 | 3300050512 | Bacteria | 1923 |
| 532 | Ga0500578_0000060 | 3300053086 | Bacteria | 118274 |
| 533 | Ga0500578_0463652 | 3300053086 | Bacteria | 719 |
| 534 | Ga0500646_0189698 | 3300053090 | Unclassified | 700 |
| 535 | Ga0500646_0318082 | 3300053090 | Bacteria | 561 |
| 536 | Ga0500583_0000003 | 3300053092 | Bacteria | 229587 |
| 537 | Ga0500583_0000778 | 3300053092 | Bacteria | 9253 |
| 538 | Ga0500583_0483987 | 3300053092 | Unclassified | 583 |
| 539 | Ga0500651_0625009 | 3300053093 | Unclassified | 582 |
| 540 | Ga0500651_0713630 | 3300053093 | Bacteria | 535 |
| 541 | Ga0500650_0057930 | 3300053098 | Bacteria | 1807 |
| 542 | Ga0500555_099097 | 3300053103 | Unclassified | 741 |
| 543 | Ga0500594_0258079 | 3300053118 | Bacteria | 581 |
| 544 | Ga0500652_033073 | 3300053131 | Bacteria | 2041 |
| 545 | Ga0500559_0038560 | 3300053136 | Unclassified | 2076 |
| 546 | Ga0500588_0018949 | 3300053146 | Unclassified | 1822 |
| 547 | Ga0500604_0287752 | 3300053151 | Bacteria | 570 |
| 548 | Ga0500616_0076070 | 3300053153 | Bacteria | 1698 |
| 549 | Ga0500622_0058005 | 3300053156 | Bacteria | 1979 |
| 550 | Ga0500622_0121650 | 3300053156 | Unclassified | 1265 |
| 551 | Ga0500636_0123112 | 3300053177 | Bacteria | 1453 |
| 552 | Ga0500637_0564396 | 3300053178 | Bacteria | 548 |
| 553 | Ga0500611_014284 | 3300053727 | Bacteria | 1382 |
| 554 | Ga0500587_026402 | 3300053739 | Bacteria | 779 |
| 555 | Ga0500661_045562 | 3300055283 | Bacteria | 780 |
| 556 | Ga0466962_0192577 | 3300061719 | Bacteria | 995 |
| 557 | Ga0466962_0312309 | 3300061719 | Bacteria | 779 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049686 | Ga0501257_185157 | Ga0501257_185157_282_497 | 65 |
| 2 | 3300049776 | Ga0501280_116674 | Ga0501280_116674_287_502 | 65 |
| 3 | 3300005347 | Ga0070668_100109493 | Ga0070668_1001094932 | 72 |
| 4 | 3300005356 | Ga0070674_100555129 | Ga0070674_1005551292 | 72 |
| 5 | 3300005466 | Ga0070685_11311155 | Ga0070685_113111551 | 72 |
| 6 | 3300006358 | Ga0068871_100307122 | Ga0068871_1003071221 | 72 |
| 7 | 3300025972 | Ga0207668_10198152 | Ga0207668_101981522 | 72 |
| 8 | 3300005843 | Ga0068860_102342247 | Ga0068860_1023422471 | 73 |
| 9 | 3300009093 | Ga0105240_10045837 | Ga0105240_100458372 | 73 |
| 10 | 3300009551 | Ga0105238_10087254 | Ga0105238_100872542 | 73 |
| 11 | 3300005331 | Ga0070670_101954855 | Ga0070670_1019548551 | 75 |
| 12 | 3300005337 | Ga0070682_100352699 | Ga0070682_1003526991 | 75 |
| 13 | 3300005456 | Ga0070678_100158535 | Ga0070678_1001585353 | 75 |
| 14 | 3300005539 | Ga0068853_101856963 | Ga0068853_1018569631 | 75 |
| 15 | 3300005543 | Ga0070672_101066334 | Ga0070672_1010663341 | 75 |
| 16 | 3300005548 | Ga0070665_101072319 | Ga0070665_1010723192 | 75 |
| 17 | 3300005840 | Ga0068870_10301157 | Ga0068870_103011572 | 75 |
| 18 | 3300006237 | Ga0097621_101064824 | Ga0097621_1010648241 | 75 |
| 19 | 3300013296 | Ga0157374_12293949 | Ga0157374_122939492 | 75 |
| 20 | 3300013306 | Ga0163162_10198429 | Ga0163162_101984293 | 75 |
| 21 | 3300025242 | Ga0209258_130183 | Ga0209258_1301831 | 75 |
| 22 | 3300025925 | Ga0207650_10299120 | Ga0207650_102991202 | 75 |
| 23 | 3300025940 | Ga0207691_10929169 | Ga0207691_109291692 | 75 |
| 24 | 3300026089 | Ga0207648_11234472 | Ga0207648_112344721 | 75 |
| 25 | 3300053136 | Ga0500559_0038560 | Ga0500559_0038560_1264_1491 | 75 |
| 26 | iso_pu_bacteria | 2738541278 | 2738725668 | 75 |
| 27 | 3300002738 | JGI25154J39366_1026910 | JGI25154J39366_10269101 | 79 |
| 28 | 3300003316 | rootH1_10004790 | rootH1_100047902 | 79 |
| 29 | 3300003320 | rootH2_10191969 | rootH2_101919692 | 79 |
| 30 | 3300003322 | rootL2_10064547 | rootL2_100645471 | 79 |
| 31 | 3300003322 | rootL2_10222743 | rootL2_102227432 | 79 |
| 32 | 3300003322 | rootL2_10336253 | rootL2_103362531 | 79 |
| 33 | 3300003323 | rootH1_10007189 | rootH1_1000718955 | 79 |
| 34 | 3300003323 | rootH1_10113682 | rootH1_101136822 | 79 |
| 35 | 3300005288 | Ga0065714_10267444 | Ga0065714_102674442 | 79 |
| 36 | 3300005295 | Ga0065707_10260657 | Ga0065707_102606571 | 79 |
| 37 | 3300005328 | Ga0070676_10072870 | Ga0070676_100728703 | 79 |
| 38 | 3300005328 | Ga0070676_10083441 | Ga0070676_100834411 | 79 |
| 39 | 3300005328 | Ga0070676_11517773 | Ga0070676_115177731 | 79 |
| 40 | 3300005329 | Ga0070683_100007891 | Ga0070683_1000078912 | 79 |
| 41 | 3300005329 | Ga0070683_100195210 | Ga0070683_1001952103 | 79 |
| 42 | 3300005330 | Ga0070690_100001766 | Ga0070690_1000017669 | 79 |
| 43 | 3300005330 | Ga0070690_100048211 | Ga0070690_1000482113 | 79 |
| 44 | 3300005330 | Ga0070690_100490587 | Ga0070690_1004905872 | 79 |
| 45 | 3300005331 | Ga0070670_100022437 | Ga0070670_1000224375 | 79 |
| 46 | 3300005334 | Ga0068869_100002336 | Ga0068869_1000023367 | 79 |
| 47 | 3300005334 | Ga0068869_100005789 | Ga0068869_1000057892 | 79 |
| 48 | 3300005334 | Ga0068869_100044910 | Ga0068869_1000449102 | 79 |
| 49 | 3300005334 | Ga0068869_100096051 | Ga0068869_1000960512 | 79 |
| 50 | 3300005334 | Ga0068869_100191287 | Ga0068869_1001912872 | 79 |
| 51 | 3300005334 | Ga0068869_100539655 | Ga0068869_1005396552 | 79 |
| 52 | 3300005335 | Ga0070666_10019870 | Ga0070666_100198703 | 79 |
| 53 | 3300005335 | Ga0070666_10081458 | Ga0070666_100814582 | 79 |
| 54 | 3300005335 | Ga0070666_10108856 | Ga0070666_101088561 | 79 |
| 55 | 3300005337 | Ga0070682_100129290 | Ga0070682_1001292902 | 79 |
| 56 | 3300005337 | Ga0070682_101581465 | Ga0070682_1015814652 | 79 |
| 57 | 3300005338 | Ga0068868_100002287 | Ga0068868_1000022876 | 79 |
| 58 | 3300005338 | Ga0068868_100097932 | Ga0068868_1000979322 | 79 |
| 59 | 3300005338 | Ga0068868_100203548 | Ga0068868_1002035482 | 79 |
| 60 | 3300005338 | Ga0068868_100244747 | Ga0068868_1002447472 | 79 |
| 61 | 3300005338 | Ga0068868_100923852 | Ga0068868_1009238522 | 79 |
| 62 | 3300005339 | Ga0070660_100129445 | Ga0070660_1001294452 | 79 |
| 63 | 3300005340 | Ga0070689_100005603 | Ga0070689_1000056032 | 79 |
| 64 | 3300005340 | Ga0070689_100044201 | Ga0070689_1000442012 | 79 |
| 65 | 3300005341 | Ga0070691_10473075 | Ga0070691_104730752 | 79 |
| 66 | 3300005343 | Ga0070687_100675096 | Ga0070687_1006750961 | 79 |
| 67 | 3300005343 | Ga0070687_100743177 | Ga0070687_1007431772 | 79 |
| 68 | 3300005343 | Ga0070687_101229652 | Ga0070687_1012296521 | 79 |
| 69 | 3300005344 | Ga0070661_100001257 | Ga0070661_1000012579 | 79 |
| 70 | 3300005344 | Ga0070661_100019477 | Ga0070661_1000194773 | 79 |
| 71 | 3300005344 | Ga0070661_100502919 | Ga0070661_1005029192 | 79 |
| 72 | 3300005344 | Ga0070661_100656155 | Ga0070661_1006561551 | 79 |
| 73 | 3300005347 | Ga0070668_100585829 | Ga0070668_1005858293 | 79 |
| 74 | 3300005347 | Ga0070668_101163564 | Ga0070668_1011635641 | 79 |
| 75 | 3300005353 | Ga0070669_100613603 | Ga0070669_1006136032 | 79 |
| 76 | 3300005353 | Ga0070669_100672187 | Ga0070669_1006721872 | 79 |
| 77 | 3300005354 | Ga0070675_100090401 | Ga0070675_1000904013 | 79 |
| 78 | 3300005354 | Ga0070675_100172727 | Ga0070675_1001727272 | 79 |
| 79 | 3300005354 | Ga0070675_100285171 | Ga0070675_1002851711 | 79 |
| 80 | 3300005354 | Ga0070675_100434081 | Ga0070675_1004340812 | 79 |
| 81 | 3300005354 | Ga0070675_100908045 | Ga0070675_1009080451 | 79 |
| 82 | 3300005354 | Ga0070675_101135708 | Ga0070675_1011357082 | 79 |
| 83 | 3300005355 | Ga0070671_100037003 | Ga0070671_1000370033 | 79 |
| 84 | 3300005355 | Ga0070671_100039337 | Ga0070671_1000393371 | 79 |
| 85 | 3300005355 | Ga0070671_100069585 | Ga0070671_1000695854 | 79 |
| 86 | 3300005355 | Ga0070671_100128875 | Ga0070671_1001288752 | 79 |
| 87 | 3300005355 | Ga0070671_101368838 | Ga0070671_1013688382 | 79 |
| 88 | 3300005356 | Ga0070674_100002720 | Ga0070674_1000027208 | 79 |
| 89 | 3300005364 | Ga0070673_100060741 | Ga0070673_1000607413 | 79 |
| 90 | 3300005364 | Ga0070673_100916474 | Ga0070673_1009164742 | 79 |
| 91 | 3300005364 | Ga0070673_102222326 | Ga0070673_1022223261 | 79 |
| 92 | 3300005365 | Ga0070688_100026655 | Ga0070688_1000266553 | 79 |
| 93 | 3300005365 | Ga0070688_100429292 | Ga0070688_1004292922 | 79 |
| 94 | 3300005366 | Ga0070659_100040451 | Ga0070659_1000404513 | 79 |
| 95 | 3300005366 | Ga0070659_100438491 | Ga0070659_1004384912 | 79 |
| 96 | 3300005367 | Ga0070667_100007776 | Ga0070667_1000077763 | 79 |
| 97 | 3300005367 | Ga0070667_100026339 | Ga0070667_1000263393 | 79 |
| 98 | 3300005367 | Ga0070667_100733718 | Ga0070667_1007337182 | 79 |
| 99 | 3300005437 | Ga0070710_10419190 | Ga0070710_104191902 | 79 |
| 100 | 3300005438 | Ga0070701_10024563 | Ga0070701_100245632 | 79 |
| 101 | 3300005441 | Ga0070700_100174624 | Ga0070700_1001746241 | 79 |
| 102 | 3300005455 | Ga0070663_100057255 | Ga0070663_1000572553 | 79 |
| 103 | 3300005456 | Ga0070678_100104073 | Ga0070678_1001040733 | 79 |
| 104 | 3300005456 | Ga0070678_100491114 | Ga0070678_1004911142 | 79 |
| 105 | 3300005456 | Ga0070678_101942958 | Ga0070678_1019429581 | 79 |
| 106 | 3300005457 | Ga0070662_100007657 | Ga0070662_1000076575 | 79 |
| 107 | 3300005457 | Ga0070662_100012826 | Ga0070662_1000128266 | 79 |
| 108 | 3300005457 | Ga0070662_100893363 | Ga0070662_1008933631 | 79 |
| 109 | 3300005459 | Ga0068867_100011193 | Ga0068867_1000111931 | 79 |
| 110 | 3300005459 | Ga0068867_100082703 | Ga0068867_1000827033 | 79 |
| 111 | 3300005459 | Ga0068867_100215710 | Ga0068867_1002157101 | 79 |
| 112 | 3300005466 | Ga0070685_10020548 | Ga0070685_100205484 | 79 |
| 113 | 3300005466 | Ga0070685_10716076 | Ga0070685_107160761 | 79 |
| 114 | 3300005467 | Ga0070706_101101053 | Ga0070706_1011010532 | 79 |
| 115 | 3300005471 | Ga0070698_100012635 | Ga0070698_1000126359 | 79 |
| 116 | 3300005518 | Ga0070699_100845045 | Ga0070699_1008450452 | 79 |
| 117 | 3300005530 | Ga0070679_100414079 | Ga0070679_1004140792 | 79 |
| 118 | 3300005535 | Ga0070684_100000042 | Ga0070684_10000004232 | 79 |
| 119 | 3300005535 | Ga0070684_100046400 | Ga0070684_1000464003 | 79 |
| 120 | 3300005539 | Ga0068853_100005393 | Ga0068853_1000053933 | 79 |
| 121 | 3300005539 | Ga0068853_100232242 | Ga0068853_1002322422 | 79 |
| 122 | 3300005539 | Ga0068853_100309127 | Ga0068853_1003091272 | 79 |
| 123 | 3300005539 | Ga0068853_100423895 | Ga0068853_1004238951 | 79 |
| 124 | 3300005539 | Ga0068853_100719163 | Ga0068853_1007191632 | 79 |
| 125 | 3300005539 | Ga0068853_102050293 | Ga0068853_1020502931 | 79 |
| 126 | 3300005543 | Ga0070672_100492079 | Ga0070672_1004920792 | 79 |
| 127 | 3300005543 | Ga0070672_100723598 | Ga0070672_1007235981 | 79 |
| 128 | 3300005544 | Ga0070686_100017405 | Ga0070686_1000174055 | 79 |
| 129 | 3300005544 | Ga0070686_100026271 | Ga0070686_1000262713 | 79 |
| 130 | 3300005544 | Ga0070686_100186827 | Ga0070686_1001868272 | 79 |
| 131 | 3300005544 | Ga0070686_100378907 | Ga0070686_1003789071 | 79 |
| 132 | 3300005547 | Ga0070693_100409212 | Ga0070693_1004092122 | 79 |
| 133 | 3300005547 | Ga0070693_100774278 | Ga0070693_1007742782 | 79 |
| 134 | 3300005547 | Ga0070693_101279440 | Ga0070693_1012794402 | 79 |
| 135 | 3300005548 | Ga0070665_100045456 | Ga0070665_1000454563 | 79 |
| 136 | 3300005548 | Ga0070665_100234608 | Ga0070665_1002346081 | 79 |
| 137 | 3300005564 | Ga0070664_100000266 | Ga0070664_10000026612 | 79 |
| 138 | 3300005564 | Ga0070664_100021759 | Ga0070664_1000217592 | 79 |
| 139 | 3300005564 | Ga0070664_100033015 | Ga0070664_1000330153 | 79 |
| 140 | 3300005564 | Ga0070664_100129595 | Ga0070664_1001295953 | 79 |
| 141 | 3300005564 | Ga0070664_100157727 | Ga0070664_1001577272 | 79 |
| 142 | 3300005564 | Ga0070664_100331758 | Ga0070664_1003317583 | 79 |
| 143 | 3300005564 | Ga0070664_100367048 | Ga0070664_1003670483 | 79 |
| 144 | 3300005564 | Ga0070664_100621325 | Ga0070664_1006213252 | 79 |
| 145 | 3300005564 | Ga0070664_101753215 | Ga0070664_1017532151 | 79 |
| 146 | 3300005577 | Ga0068857_100007376 | Ga0068857_1000073767 | 79 |
| 147 | 3300005577 | Ga0068857_100052247 | Ga0068857_1000522474 | 79 |
| 148 | 3300005577 | Ga0068857_100134633 | Ga0068857_1001346332 | 79 |
| 149 | 3300005577 | Ga0068857_100138343 | Ga0068857_1001383432 | 79 |
| 150 | 3300005577 | Ga0068857_102492200 | Ga0068857_1024922001 | 79 |
| 151 | 3300005578 | Ga0068854_100007085 | Ga0068854_1000070857 | 79 |
| 152 | 3300005578 | Ga0068854_100853421 | Ga0068854_1008534212 | 79 |
| 153 | 3300005578 | Ga0068854_101251263 | Ga0068854_1012512631 | 79 |
| 154 | 3300005614 | Ga0068856_100034401 | Ga0068856_1000344015 | 79 |
| 155 | 3300005615 | Ga0070702_100052122 | Ga0070702_1000521222 | 79 |
| 156 | 3300005615 | Ga0070702_101525516 | Ga0070702_1015255161 | 79 |
| 157 | 3300005616 | Ga0068852_100233980 | Ga0068852_1002339802 | 79 |
| 158 | 3300005616 | Ga0068852_100736680 | Ga0068852_1007366802 | 79 |
| 159 | 3300005616 | Ga0068852_100760054 | Ga0068852_1007600541 | 79 |
| 160 | 3300005616 | Ga0068852_101877669 | Ga0068852_1018776691 | 79 |
| 161 | 3300005616 | Ga0068852_102313738 | Ga0068852_1023137381 | 79 |
| 162 | 3300005617 | Ga0068859_100084228 | Ga0068859_1000842282 | 79 |
| 163 | 3300005617 | Ga0068859_100245095 | Ga0068859_1002450952 | 79 |
| 164 | 3300005617 | Ga0068859_100249471 | Ga0068859_1002494712 | 79 |
| 165 | 3300005617 | Ga0068859_100278937 | Ga0068859_1002789372 | 79 |
| 166 | 3300005617 | Ga0068859_101209885 | Ga0068859_1012098852 | 79 |
| 167 | 3300005617 | Ga0068859_102963295 | Ga0068859_1029632952 | 79 |
| 168 | 3300005618 | Ga0068864_100017320 | Ga0068864_1000173204 | 79 |
| 169 | 3300005618 | Ga0068864_100076190 | Ga0068864_1000761902 | 79 |
| 170 | 3300005618 | Ga0068864_100230396 | Ga0068864_1002303963 | 79 |
| 171 | 3300005618 | Ga0068864_100527424 | Ga0068864_1005274241 | 79 |
| 172 | 3300005618 | Ga0068864_100537227 | Ga0068864_1005372272 | 79 |
| 173 | 3300005718 | Ga0068866_10071400 | Ga0068866_100714002 | 79 |
| 174 | 3300005719 | Ga0068861_100464698 | Ga0068861_1004646981 | 79 |
| 175 | 3300005719 | Ga0068861_102008380 | Ga0068861_1020083802 | 79 |
| 176 | 3300005834 | Ga0068851_10127135 | Ga0068851_101271353 | 79 |
| 177 | 3300005834 | Ga0068851_10310076 | Ga0068851_103100762 | 79 |
| 178 | 3300005841 | Ga0068863_100029821 | Ga0068863_1000298212 | 79 |
| 179 | 3300005841 | Ga0068863_100633534 | Ga0068863_1006335341 | 79 |
| 180 | 3300005842 | Ga0068858_100030976 | Ga0068858_1000309764 | 79 |
| 181 | 3300005842 | Ga0068858_100374471 | Ga0068858_1003744712 | 79 |
| 182 | 3300005842 | Ga0068858_100458827 | Ga0068858_1004588272 | 79 |
| 183 | 3300005842 | Ga0068858_100755513 | Ga0068858_1007555132 | 79 |
| 184 | 3300005842 | Ga0068858_101837060 | Ga0068858_1018370602 | 79 |
| 185 | 3300005843 | Ga0068860_100270533 | Ga0068860_1002705332 | 79 |
| 186 | 3300005843 | Ga0068860_100392389 | Ga0068860_1003923892 | 79 |
| 187 | 3300005843 | Ga0068860_101952180 | Ga0068860_1019521801 | 79 |
| 188 | 3300005843 | Ga0068860_102165952 | Ga0068860_1021659522 | 79 |
| 189 | 3300005844 | Ga0068862_101318237 | Ga0068862_1013182372 | 79 |
| 190 | 3300005844 | Ga0068862_101758981 | Ga0068862_1017589812 | 79 |
| 191 | 3300005844 | Ga0068862_102245473 | Ga0068862_1022454732 | 79 |
| 192 | 3300005985 | Ga0081539_10048260 | Ga0081539_100482603 | 79 |
| 193 | 3300006163 | Ga0070715_10354220 | Ga0070715_103542201 | 79 |
| 194 | 3300006173 | Ga0070716_100062150 | Ga0070716_1000621503 | 79 |
| 195 | 3300006195 | Ga0075366_10028139 | Ga0075366_100281393 | 79 |
| 196 | 3300006195 | Ga0075366_10103732 | Ga0075366_101037324 | 79 |
| 197 | 3300006195 | Ga0075366_10269462 | Ga0075366_102694622 | 79 |
| 198 | 3300006195 | Ga0075366_10414943 | Ga0075366_104149432 | 79 |
| 199 | 3300006195 | Ga0075366_10638183 | Ga0075366_106381832 | 79 |
| 200 | 3300006195 | Ga0075366_10999262 | Ga0075366_109992621 | 79 |
| 201 | 3300006237 | Ga0097621_100008842 | Ga0097621_1000088426 | 79 |
| 202 | 3300006237 | Ga0097621_100109540 | Ga0097621_1001095401 | 79 |
| 203 | 3300006237 | Ga0097621_100429876 | Ga0097621_1004298762 | 79 |
| 204 | 3300006237 | Ga0097621_101228420 | Ga0097621_1012284202 | 79 |
| 205 | 3300006237 | Ga0097621_101316237 | Ga0097621_1013162371 | 79 |
| 206 | 3300006237 | Ga0097621_101615024 | Ga0097621_1016150242 | 79 |
| 207 | 3300006358 | Ga0068871_100018297 | Ga0068871_1000182974 | 79 |
| 208 | 3300006358 | Ga0068871_100153477 | Ga0068871_1001534772 | 79 |
| 209 | 3300006358 | Ga0068871_100228048 | Ga0068871_1002280481 | 79 |
| 210 | 3300006358 | Ga0068871_100500983 | Ga0068871_1005009832 | 79 |
| 211 | 3300006358 | Ga0068871_100838780 | Ga0068871_1008387801 | 79 |
| 212 | 3300006871 | Ga0075434_100341524 | Ga0075434_1003415242 | 79 |
| 213 | 3300006871 | Ga0075434_100983119 | Ga0075434_1009831191 | 79 |
| 214 | 3300006881 | Ga0068865_100042863 | Ga0068865_1000428634 | 79 |
| 215 | 3300006931 | Ga0097620_100084226 | Ga0097620_1000842262 | 79 |
| 216 | 3300006931 | Ga0097620_100245093 | Ga0097620_1002450932 | 79 |
| 217 | 3300006931 | Ga0097620_100249474 | Ga0097620_1002494742 | 79 |
| 218 | 3300006931 | Ga0097620_100278968 | Ga0097620_1002789682 | 79 |
| 219 | 3300006931 | Ga0097620_101209834 | Ga0097620_1012098342 | 79 |
| 220 | 3300006931 | Ga0097620_102963747 | Ga0097620_1029637472 | 79 |
| 221 | 3300007076 | Ga0075435_101783023 | Ga0075435_1017830231 | 79 |
| 222 | 3300009011 | Ga0105251_10357245 | Ga0105251_103572451 | 79 |
| 223 | 3300009093 | Ga0105240_10266102 | Ga0105240_102661023 | 79 |
| 224 | 3300009093 | Ga0105240_12759045 | Ga0105240_127590452 | 79 |
| 225 | 3300009094 | Ga0111539_10068878 | Ga0111539_100688782 | 79 |
| 226 | 3300009101 | Ga0105247_10230238 | Ga0105247_102302381 | 79 |
| 227 | 3300009174 | Ga0105241_10100694 | Ga0105241_101006941 | 79 |
| 228 | 3300009174 | Ga0105241_10290915 | Ga0105241_102909153 | 79 |
| 229 | 3300009176 | Ga0105242_10077472 | Ga0105242_100774722 | 79 |
| 230 | 3300009176 | Ga0105242_10194731 | Ga0105242_101947313 | 79 |
| 231 | 3300009176 | Ga0105242_11285004 | Ga0105242_112850042 | 79 |
| 232 | 3300009176 | Ga0105242_12519653 | Ga0105242_125196531 | 79 |
| 233 | 3300009177 | Ga0105248_10203751 | Ga0105248_102037512 | 79 |
| 234 | 3300009545 | Ga0105237_10498908 | Ga0105237_104989082 | 79 |
| 235 | 3300009545 | Ga0105237_11595124 | Ga0105237_115951241 | 79 |
| 236 | 3300009553 | Ga0105249_10628113 | Ga0105249_106281132 | 79 |
| 237 | 3300009553 | Ga0105249_10974096 | Ga0105249_109740961 | 79 |
| 238 | 3300009553 | Ga0105249_11646859 | Ga0105249_116468592 | 79 |
| 239 | 3300010375 | Ga0105239_10156358 | Ga0105239_101563583 | 79 |
| 240 | 3300010375 | Ga0105239_13446278 | Ga0105239_134462782 | 79 |
| 241 | 3300011119 | Ga0105246_10478524 | Ga0105246_104785241 | 79 |
| 242 | 3300011119 | Ga0105246_10499433 | Ga0105246_104994332 | 79 |
| 243 | 3300011119 | Ga0105246_11325196 | Ga0105246_113251962 | 79 |
| 244 | 3300011119 | Ga0105246_12576037 | Ga0105246_125760371 | 79 |
| 245 | 3300013100 | Ga0157373_10095260 | Ga0157373_100952603 | 79 |
| 246 | 3300013102 | Ga0157371_10304525 | Ga0157371_103045252 | 79 |
| 247 | 3300013102 | Ga0157371_10927237 | Ga0157371_109272372 | 79 |
| 248 | 3300013102 | Ga0157371_11433130 | Ga0157371_114331301 | 79 |
| 249 | 3300013102 | Ga0157371_11541248 | Ga0157371_115412481 | 79 |
| 250 | 3300013105 | Ga0157369_11085547 | Ga0157369_110855472 | 79 |
| 251 | 3300013296 | Ga0157374_10007250 | Ga0157374_100072502 | 79 |
| 252 | 3300013296 | Ga0157374_10011781 | Ga0157374_100117813 | 79 |
| 253 | 3300013296 | Ga0157374_10036791 | Ga0157374_100367912 | 79 |
| 254 | 3300013296 | Ga0157374_10050945 | Ga0157374_100509453 | 79 |
| 255 | 3300013296 | Ga0157374_10132137 | Ga0157374_101321373 | 79 |
| 256 | 3300013296 | Ga0157374_11653172 | Ga0157374_116531722 | 79 |
| 257 | 3300013297 | Ga0157378_10006964 | Ga0157378_100069645 | 79 |
| 258 | 3300013297 | Ga0157378_10077674 | Ga0157378_100776743 | 79 |
| 259 | 3300013297 | Ga0157378_10117934 | Ga0157378_101179342 | 79 |
| 260 | 3300013297 | Ga0157378_10292239 | Ga0157378_102922392 | 79 |
| 261 | 3300013297 | Ga0157378_10405951 | Ga0157378_104059512 | 79 |
| 262 | 3300013297 | Ga0157378_11125496 | Ga0157378_111254962 | 79 |
| 263 | 3300013306 | Ga0163162_10010595 | Ga0163162_100105952 | 79 |
| 264 | 3300013306 | Ga0163162_10061057 | Ga0163162_100610573 | 79 |
| 265 | 3300013306 | Ga0163162_10072297 | Ga0163162_100722974 | 79 |
| 266 | 3300013306 | Ga0163162_10074283 | Ga0163162_100742833 | 79 |
| 267 | 3300013306 | Ga0163162_10112642 | Ga0163162_101126423 | 79 |
| 268 | 3300013306 | Ga0163162_10202289 | Ga0163162_102022892 | 79 |
| 269 | 3300013306 | Ga0163162_10209381 | Ga0163162_102093812 | 79 |
| 270 | 3300013306 | Ga0163162_10471819 | Ga0163162_104718192 | 79 |
| 271 | 3300013306 | Ga0163162_11012872 | Ga0163162_110128722 | 79 |
| 272 | 3300013306 | Ga0163162_12288382 | Ga0163162_122883822 | 79 |
| 273 | 3300013307 | Ga0157372_10886562 | Ga0157372_108865622 | 79 |
| 274 | 3300013307 | Ga0157372_11695183 | Ga0157372_116951832 | 79 |
| 275 | 3300013307 | Ga0157372_12899695 | Ga0157372_128996951 | 79 |
| 276 | 3300013308 | Ga0157375_10005827 | Ga0157375_1000582710 | 79 |
| 277 | 3300013308 | Ga0157375_10019451 | Ga0157375_100194516 | 79 |
| 278 | 3300013308 | Ga0157375_10020351 | Ga0157375_100203513 | 79 |
| 279 | 3300013308 | Ga0157375_10330871 | Ga0157375_103308712 | 79 |
| 280 | 3300013308 | Ga0157375_10494301 | Ga0157375_104943012 | 79 |
| 281 | 3300013308 | Ga0157375_10608597 | Ga0157375_106085973 | 79 |
| 282 | 3300014325 | Ga0163163_10000079 | Ga0163163_1000007945 | 79 |
| 283 | 3300014325 | Ga0163163_10000858 | Ga0163163_1000085815 | 79 |
| 284 | 3300014325 | Ga0163163_10112201 | Ga0163163_101122012 | 79 |
| 285 | 3300014325 | Ga0163163_10130195 | Ga0163163_101301951 | 79 |
| 286 | 3300014325 | Ga0163163_10274385 | Ga0163163_102743852 | 79 |
| 287 | 3300014325 | Ga0163163_11609672 | Ga0163163_116096722 | 79 |
| 288 | 3300014326 | Ga0157380_10625780 | Ga0157380_106257802 | 79 |
| 289 | 3300014745 | Ga0157377_10001057 | Ga0157377_100010576 | 79 |
| 290 | 3300014745 | Ga0157377_10051163 | Ga0157377_100511632 | 79 |
| 291 | 3300014745 | Ga0157377_11688770 | Ga0157377_116887701 | 79 |
| 292 | 3300014968 | Ga0157379_10048092 | Ga0157379_100480922 | 79 |
| 293 | 3300014968 | Ga0157379_10188859 | Ga0157379_101888592 | 79 |
| 294 | 3300014968 | Ga0157379_10641397 | Ga0157379_106413973 | 79 |
| 295 | 3300014968 | Ga0157379_11695832 | Ga0157379_116958321 | 79 |
| 296 | 3300014968 | Ga0157379_11717621 | Ga0157379_117176211 | 79 |
| 297 | 3300014969 | Ga0157376_10032451 | Ga0157376_100324513 | 79 |
| 298 | 3300014969 | Ga0157376_10146539 | Ga0157376_101465392 | 79 |
| 299 | 3300014969 | Ga0157376_10216009 | Ga0157376_102160091 | 79 |
| 300 | 3300017792 | Ga0163161_10038246 | Ga0163161_100382463 | 79 |
| 301 | 3300017792 | Ga0163161_10124226 | Ga0163161_101242262 | 79 |
| 302 | 3300017792 | Ga0163161_10162549 | Ga0163161_101625492 | 79 |
| 303 | 3300017792 | Ga0163161_10595578 | Ga0163161_105955782 | 79 |
| 304 | 3300017792 | Ga0163161_11671018 | Ga0163161_116710182 | 79 |
| 305 | 3300025246 | Ga0209646_1010327 | Ga0209646_10103273 | 79 |
| 306 | 3300025315 | Ga0207697_10151948 | Ga0207697_101519483 | 79 |
| 307 | 3300025321 | Ga0207656_10131894 | Ga0207656_101318941 | 79 |
| 308 | 3300025321 | Ga0207656_10665437 | Ga0207656_106654372 | 79 |
| 309 | 3300025898 | Ga0207692_10420639 | Ga0207692_104206392 | 79 |
| 310 | 3300025899 | Ga0207642_10182853 | Ga0207642_101828532 | 79 |
| 311 | 3300025899 | Ga0207642_10287207 | Ga0207642_102872072 | 79 |
| 312 | 3300025901 | Ga0207688_10100377 | Ga0207688_101003772 | 79 |
| 313 | 3300025903 | Ga0207680_10133692 | Ga0207680_101336922 | 79 |
| 314 | 3300025903 | Ga0207680_10271961 | Ga0207680_102719612 | 79 |
| 315 | 3300025903 | Ga0207680_10543751 | Ga0207680_105437512 | 79 |
| 316 | 3300025904 | Ga0207647_10508386 | Ga0207647_105083862 | 79 |
| 317 | 3300025905 | Ga0207685_10139405 | Ga0207685_101394052 | 79 |
| 318 | 3300025907 | Ga0207645_10005620 | Ga0207645_100056203 | 79 |
| 319 | 3300025907 | Ga0207645_10047614 | Ga0207645_100476143 | 79 |
| 320 | 3300025907 | Ga0207645_10255965 | Ga0207645_102559651 | 79 |
| 321 | 3300025911 | Ga0207654_10353430 | Ga0207654_103534301 | 79 |
| 322 | 3300025913 | Ga0207695_11544615 | Ga0207695_115446152 | 79 |
| 323 | 3300025918 | Ga0207662_10026150 | Ga0207662_100261502 | 79 |
| 324 | 3300025918 | Ga0207662_11322865 | Ga0207662_113228651 | 79 |
| 325 | 3300025919 | Ga0207657_10136994 | Ga0207657_101369943 | 79 |
| 326 | 3300025920 | Ga0207649_10001251 | Ga0207649_100012517 | 79 |
| 327 | 3300025920 | Ga0207649_10027411 | Ga0207649_100274113 | 79 |
| 328 | 3300025920 | Ga0207649_10440566 | Ga0207649_104405662 | 79 |
| 329 | 3300025920 | Ga0207649_10455342 | Ga0207649_104553422 | 79 |
| 330 | 3300025921 | Ga0207652_11410985 | Ga0207652_114109851 | 79 |
| 331 | 3300025923 | Ga0207681_10435047 | Ga0207681_104350472 | 79 |
| 332 | 3300025923 | Ga0207681_10567598 | Ga0207681_105675982 | 79 |
| 333 | 3300025923 | Ga0207681_11769105 | Ga0207681_117691052 | 79 |
| 334 | 3300025925 | Ga0207650_10007835 | Ga0207650_100078355 | 79 |
| 335 | 3300025925 | Ga0207650_10821854 | Ga0207650_108218541 | 79 |
| 336 | 3300025926 | Ga0207659_10134461 | Ga0207659_101344612 | 79 |
| 337 | 3300025926 | Ga0207659_10156935 | Ga0207659_101569352 | 79 |
| 338 | 3300025926 | Ga0207659_10266696 | Ga0207659_102666963 | 79 |
| 339 | 3300025926 | Ga0207659_10524684 | Ga0207659_105246842 | 79 |
| 340 | 3300025931 | Ga0207644_10043629 | Ga0207644_100436292 | 79 |
| 341 | 3300025931 | Ga0207644_10171875 | Ga0207644_101718752 | 79 |
| 342 | 3300025931 | Ga0207644_11566943 | Ga0207644_115669432 | 79 |
| 343 | 3300025931 | Ga0207644_11610659 | Ga0207644_116106592 | 79 |
| 344 | 3300025932 | Ga0207690_10025700 | Ga0207690_100257003 | 79 |
| 345 | 3300025933 | Ga0207706_10012656 | Ga0207706_100126565 | 79 |
| 346 | 3300025933 | Ga0207706_10023622 | Ga0207706_100236222 | 79 |
| 347 | 3300025933 | Ga0207706_10075808 | Ga0207706_100758083 | 79 |
| 348 | 3300025933 | Ga0207706_10106753 | Ga0207706_101067533 | 79 |
| 349 | 3300025934 | Ga0207686_10023958 | Ga0207686_100239583 | 79 |
| 350 | 3300025934 | Ga0207686_10497086 | Ga0207686_104970862 | 79 |
| 351 | 3300025936 | Ga0207670_10005077 | Ga0207670_100050777 | 79 |
| 352 | 3300025936 | Ga0207670_10098753 | Ga0207670_100987532 | 79 |
| 353 | 3300025937 | Ga0207669_10008571 | Ga0207669_100085713 | 79 |
| 354 | 3300025938 | Ga0207704_10167984 | Ga0207704_101679842 | 79 |
| 355 | 3300025938 | Ga0207704_10177058 | Ga0207704_101770582 | 79 |
| 356 | 3300025939 | Ga0207665_10117852 | Ga0207665_101178523 | 79 |
| 357 | 3300025939 | Ga0207665_10770192 | Ga0207665_107701922 | 79 |
| 358 | 3300025940 | Ga0207691_10043521 | Ga0207691_100435215 | 79 |
| 359 | 3300025940 | Ga0207691_10115723 | Ga0207691_101157232 | 79 |
| 360 | 3300025940 | Ga0207691_10596826 | Ga0207691_105968262 | 79 |
| 361 | 3300025941 | Ga0207711_10469456 | Ga0207711_104694563 | 79 |
| 362 | 3300025942 | Ga0207689_10010865 | Ga0207689_100108658 | 79 |
| 363 | 3300025942 | Ga0207689_10030074 | Ga0207689_100300743 | 79 |
| 364 | 3300025942 | Ga0207689_10062143 | Ga0207689_100621433 | 79 |
| 365 | 3300025942 | Ga0207689_10113980 | Ga0207689_101139803 | 79 |
| 366 | 3300025942 | Ga0207689_10679031 | Ga0207689_106790312 | 79 |
| 367 | 3300025944 | Ga0207661_10002324 | Ga0207661_100023243 | 79 |
| 368 | 3300025944 | Ga0207661_10050937 | Ga0207661_100509372 | 79 |
| 369 | 3300025944 | Ga0207661_10135033 | Ga0207661_101350333 | 79 |
| 370 | 3300025944 | Ga0207661_10281295 | Ga0207661_102812951 | 79 |
| 371 | 3300025944 | Ga0207661_10554578 | Ga0207661_105545783 | 79 |
| 372 | 3300025944 | Ga0207661_11779005 | Ga0207661_117790052 | 79 |
| 373 | 3300025944 | Ga0207661_12062460 | Ga0207661_120624601 | 79 |
| 374 | 3300025945 | Ga0207679_10000304 | Ga0207679_1000030427 | 79 |
| 375 | 3300025945 | Ga0207679_10021359 | Ga0207679_100213592 | 79 |
| 376 | 3300025945 | Ga0207679_10121864 | Ga0207679_101218642 | 79 |
| 377 | 3300025945 | Ga0207679_10336309 | Ga0207679_103363093 | 79 |
| 378 | 3300025945 | Ga0207679_10351006 | Ga0207679_103510063 | 79 |
| 379 | 3300025945 | Ga0207679_10810883 | Ga0207679_108108832 | 79 |
| 380 | 3300025945 | Ga0207679_11499930 | Ga0207679_114999301 | 79 |
| 381 | 3300025945 | Ga0207679_11523109 | Ga0207679_115231092 | 79 |
| 382 | 3300025949 | Ga0207667_10054066 | Ga0207667_100540662 | 79 |
| 383 | 3300025960 | Ga0207651_10033276 | Ga0207651_100332764 | 79 |
| 384 | 3300025960 | Ga0207651_10126981 | Ga0207651_101269812 | 79 |
| 385 | 3300025960 | Ga0207651_11039066 | Ga0207651_110390662 | 79 |
| 386 | 3300025961 | Ga0207712_10342661 | Ga0207712_103426612 | 79 |
| 387 | 3300025961 | Ga0207712_10494555 | Ga0207712_104945551 | 79 |
| 388 | 3300025972 | Ga0207668_10407724 | Ga0207668_104077242 | 79 |
| 389 | 3300025972 | Ga0207668_11965147 | Ga0207668_119651471 | 79 |
| 390 | 3300025981 | Ga0207640_11387054 | Ga0207640_113870542 | 79 |
| 391 | 3300025981 | Ga0207640_11531434 | Ga0207640_115314342 | 79 |
| 392 | 3300025981 | Ga0207640_12189909 | Ga0207640_121899091 | 79 |
| 393 | 3300025986 | Ga0207658_10181715 | Ga0207658_101817152 | 79 |
| 394 | 3300025986 | Ga0207658_12102996 | Ga0207658_121029961 | 79 |
| 395 | 3300026023 | Ga0207677_10037968 | Ga0207677_100379682 | 79 |
| 396 | 3300026023 | Ga0207677_10067812 | Ga0207677_100678122 | 79 |
| 397 | 3300026023 | Ga0207677_10075641 | Ga0207677_100756412 | 79 |
| 398 | 3300026023 | Ga0207677_10724821 | Ga0207677_107248211 | 79 |
| 399 | 3300026023 | Ga0207677_11151012 | Ga0207677_111510122 | 79 |
| 400 | 3300026035 | Ga0207703_10046568 | Ga0207703_100465683 | 79 |
| 401 | 3300026035 | Ga0207703_10343838 | Ga0207703_103438382 | 79 |
| 402 | 3300026035 | Ga0207703_10346439 | Ga0207703_103464392 | 79 |
| 403 | 3300026041 | Ga0207639_10020169 | Ga0207639_100201693 | 79 |
| 404 | 3300026041 | Ga0207639_10179961 | Ga0207639_101799612 | 79 |
| 405 | 3300026041 | Ga0207639_10428778 | Ga0207639_104287782 | 79 |
| 406 | 3300026041 | Ga0207639_11386759 | Ga0207639_113867591 | 79 |
| 407 | 3300026041 | Ga0207639_11500381 | Ga0207639_115003812 | 79 |
| 408 | 3300026041 | Ga0207639_11843849 | Ga0207639_118438492 | 79 |
| 409 | 3300026067 | Ga0207678_10122620 | Ga0207678_101226201 | 79 |
| 410 | 3300026067 | Ga0207678_10855658 | Ga0207678_108556581 | 79 |
| 411 | 3300026067 | Ga0207678_11085795 | Ga0207678_110857952 | 79 |
| 412 | 3300026078 | Ga0207702_10213347 | Ga0207702_102133472 | 79 |
| 413 | 3300026088 | Ga0207641_10141941 | Ga0207641_101419412 | 79 |
| 414 | 3300026088 | Ga0207641_11050442 | Ga0207641_110504421 | 79 |
| 415 | 3300026089 | Ga0207648_10022838 | Ga0207648_100228383 | 79 |
| 416 | 3300026089 | Ga0207648_10077034 | Ga0207648_100770342 | 79 |
| 417 | 3300026089 | Ga0207648_10351872 | Ga0207648_103518722 | 79 |
| 418 | 3300026095 | Ga0207676_10005907 | Ga0207676_100059076 | 79 |
| 419 | 3300026095 | Ga0207676_10144345 | Ga0207676_101443452 | 79 |
| 420 | 3300026095 | Ga0207676_10164183 | Ga0207676_101641832 | 79 |
| 421 | 3300026095 | Ga0207676_10427899 | Ga0207676_104278992 | 79 |
| 422 | 3300026095 | Ga0207676_10588539 | Ga0207676_105885393 | 79 |
| 423 | 3300026095 | Ga0207676_11282072 | Ga0207676_112820721 | 79 |
| 424 | 3300026095 | Ga0207676_12555015 | Ga0207676_125550152 | 79 |
| 425 | 3300026116 | Ga0207674_10004112 | Ga0207674_1000411212 | 79 |
| 426 | 3300026116 | Ga0207674_10005133 | Ga0207674_1000513312 | 79 |
| 427 | 3300026116 | Ga0207674_10156350 | Ga0207674_101563502 | 79 |
| 428 | 3300026116 | Ga0207674_10236756 | Ga0207674_102367562 | 79 |
| 429 | 3300026118 | Ga0207675_100256351 | Ga0207675_1002563511 | 79 |
| 430 | 3300026118 | Ga0207675_100404952 | Ga0207675_1004049521 | 79 |
| 431 | 3300026118 | Ga0207675_100439250 | Ga0207675_1004392502 | 79 |
| 432 | 3300026121 | Ga0207683_10002030 | Ga0207683_1000203012 | 79 |
| 433 | 3300026121 | Ga0207683_10989203 | Ga0207683_109892032 | 79 |
| 434 | 3300026121 | Ga0207683_12098461 | Ga0207683_120984611 | 79 |
| 435 | 3300026142 | Ga0207698_10029302 | Ga0207698_100293023 | 79 |
| 436 | 3300026142 | Ga0207698_11125676 | Ga0207698_111256762 | 79 |
| 437 | 3300026142 | Ga0207698_11654253 | Ga0207698_116542531 | 79 |
| 438 | 3300027907 | Ga0207428_10796533 | Ga0207428_107965331 | 79 |
| 439 | 3300028379 | Ga0268266_10459382 | Ga0268266_104593823 | 79 |
| 440 | 3300028379 | Ga0268266_12380430 | Ga0268266_123804301 | 79 |
| 441 | 3300028380 | Ga0268265_10079959 | Ga0268265_100799593 | 79 |
| 442 | 3300028380 | Ga0268265_11704684 | Ga0268265_117046841 | 79 |
| 443 | 3300028381 | Ga0268264_10245929 | Ga0268264_102459291 | 79 |
| 444 | 3300028381 | Ga0268264_11822815 | Ga0268264_118228152 | 79 |
| 445 | 3300031456 | Ga0307513_10165443 | Ga0307513_101654432 | 79 |
| 446 | 3300031456 | Ga0307513_10192765 | Ga0307513_101927653 | 79 |
| 447 | 3300031456 | Ga0307513_10203611 | Ga0307513_102036112 | 79 |
| 448 | 3300031507 | Ga0307509_10553964 | Ga0307509_105539641 | 79 |
| 449 | 3300035111 | Ga0373923_0707963 | Ga0373923_0707963_189_434 | 79 |
| 450 | 3300035117 | Ga0373953_0020138 | Ga0373953_0020138_1989_2234 | 79 |
| 451 | 3300035119 | Ga0373956_0207167 | Ga0373956_0207167_567_812 | 79 |
| 452 | 3300035170 | Ga0373943_0723252 | Ga0373943_0723252_253_498 | 79 |
| 453 | 3300035172 | Ga0373955_0061792 | Ga0373955_0061792_490_735 | 79 |
| 454 | 3300035724 | Ga0373933_0017889 | Ga0373933_0017889_3580_3825 | 79 |
| 455 | 3300035725 | Ga0373947_0077682 | Ga0373947_0077682_906_1151 | 79 |
| 456 | 3300036401 | Ga0373937_0002819 | Ga0373937_0002819_4518_4763 | 79 |
| 457 | 3300037068 | Ga0373925_0946419 | Ga0373925_0946419_404_649 | 79 |
| 458 | 3300037068 | Ga0373925_0964512 | Ga0373925_0964512_100_345 | 79 |
| 459 | 3300041404 | Ga0439436_0005795 | Ga0439436_0005795_417_656 | 79 |
| 460 | 3300041406 | Ga0439439_0045901 | Ga0439439_0045901_648_887 | 79 |
| 461 | 3300041456 | Ga0451795_0175453 | Ga0451795_0175453_732_971 | 79 |
| 462 | 3300041458 | Ga0451798_0177859 | Ga0451798_0177859_462_701 | 79 |
| 463 | 3300041458 | Ga0451798_0752934 | Ga0451798_0752934_219_458 | 79 |
| 464 | 3300041486 | Ga0451807_0179209 | Ga0451807_0179209_1287_1532 | 79 |
| 465 | 3300041491 | Ga0451833_0771407 | Ga0451833_0771407_146_385 | 79 |
| 466 | 3300041491 | Ga0451833_0982377 | Ga0451833_0982377_129_368 | 79 |
| 467 | 3300041492 | Ga0451835_0373411 | Ga0451835_0373411_306_545 | 79 |
| 468 | 3300041507 | Ga0451851_0038748 | Ga0451851_0038748_401_640 | 79 |
| 469 | 3300041507 | Ga0451851_1041435 | Ga0451851_1041435_400_639 | 79 |
| 470 | 3300041512 | Ga0451853_0104252 | Ga0451853_0104252_817_1056 | 79 |
| 471 | 3300041512 | Ga0451853_1693258 | Ga0451853_1693258_353_598 | 79 |
| 472 | 3300041512 | Ga0451853_2288465 | Ga0451853_2288465_468_707 | 79 |
| 473 | 3300041512 | Ga0451853_3502709 | Ga0451853_3502709_957_1196 | 79 |
| 474 | 3300042007 | Ga0439449_0026721 | Ga0439449_0026721_1845_2084 | 79 |
| 475 | 3300042007 | Ga0439449_0185409 | Ga0439449_0185409_491_730 | 79 |
| 476 | 3300042014 | Ga0439457_000285 | Ga0439457_000285_5568_5807 | 79 |
| 477 | 3300042015 | Ga0439462_0001557 | Ga0439462_0001557_598_837 | 79 |
| 478 | 3300042015 | Ga0439462_0093246 | Ga0439462_0093246_521_760 | 79 |
| 479 | 3300042129 | Ga0450891_040042 | Ga0450891_040042_14_253 | 79 |
| 480 | 3300042876 | Ga0451577_0976084 | Ga0451577_0976084_66_314 | 79 |
| 481 | 3300044658 | Ga0466972_0000082 | Ga0466972_0000082_13342_13620 | 79 |
| 482 | 3300044658 | Ga0466972_0026400 | Ga0466972_0026400_231_470 | 79 |
| 483 | 3300044658 | Ga0466972_0604377 | Ga0466972_0604377_144_383 | 79 |
| 484 | 3300044673 | Ga0453683_0217607 | Ga0453683_0217607_449_697 | 79 |
| 485 | 3300044712 | Ga0453684_0023120 | Ga0453684_0023120_5260_5508 | 79 |
| 486 | 3300044735 | Ga0466968_0623818 | Ga0466968_0623818_246_485 | 79 |
| 487 | 3300044842 | Ga0466957_0004118 | Ga0466957_0004118_4878_5117 | 79 |
| 488 | 3300044901 | Ga0466960_0125402 | Ga0466960_0125402_398_637 | 79 |
| 489 | 3300045051 | Ga0451576_1061732 | Ga0451576_1061732_566_814 | 79 |
| 490 | 3300046460 | Ga0495638_0064095 | Ga0495638_0064095_578_817 | 79 |
| 491 | 3300046514 | Ga0495618_0116187 | Ga0495618_0116187_1196_1441 | 79 |
| 492 | 3300046516 | Ga0495628_0105251 | Ga0495628_0105251_1342_1587 | 79 |
| 493 | 3300046517 | Ga0495630_0020077 | Ga0495630_0020077_1207_1452 | 79 |
| 494 | 3300046533 | Ga0495640_0214470 | Ga0495640_0214470_307_552 | 79 |
| 495 | 3300046536 | Ga0495587_0149716 | Ga0495587_0149716_865_1110 | 79 |
| 496 | 3300046543 | Ga0495645_0343324 | Ga0495645_0343324_330_575 | 79 |
| 497 | 3300046642 | Ga0495634_0266078 | Ga0495634_0266078_567_812 | 79 |
| 498 | 3300046663 | Ga0495635_0137476 | Ga0495635_0137476_202_447 | 79 |
| 499 | 3300046675 | Ga0495657_0332099 | Ga0495657_0332099_329_574 | 79 |
| 500 | 3300046679 | Ga0495623_0565307 | Ga0495623_0565307_338_583 | 79 |
| 501 | 3300046689 | Ga0495613_0425347 | Ga0495613_0425347_175_420 | 79 |
| 502 | 3300047319 | Ga0495674_0875187 | Ga0495674_0875187_155_400 | 79 |
| 503 | 3300047322 | Ga0495680_0086730 | Ga0495680_0086730_1382_1627 | 79 |
| 504 | 3300047471 | Ga0495684_0467119 | Ga0495684_0467119_375_620 | 79 |
| 505 | 3300048907 | Ga0496104_0776518 | Ga0496104_0776518_61_306 | 79 |
| 506 | 3300048907 | Ga0496104_0969496 | Ga0496104_0969496_157_399 | 79 |
| 507 | 3300048908 | Ga0496105_1179497 | Ga0496105_1179497_156_398 | 79 |
| 508 | 3300048912 | Ga0496109_1137734 | Ga0496109_1137734_323_565 | 79 |
| 509 | 3300048913 | Ga0496110_0024996 | Ga0496110_0024996_933_1178 | 79 |
| 510 | 3300048913 | Ga0496110_0239308 | Ga0496110_0239308_1136_1378 | 79 |
| 511 | 3300048917 | Ga0496114_1635964 | Ga0496114_1635964_231_476 | 79 |
| 512 | 3300049514 | Ga0501291_095642 | Ga0501291_095642_71_337 | 79 |
| 513 | 3300049656 | Ga0501209_104842 | Ga0501209_104842_396_635 | 79 |
| 514 | 3300049686 | Ga0501257_015899 | Ga0501257_015899_645_884 | 79 |
| 515 | 3300049686 | Ga0501257_022587 | Ga0501257_022587_458_697 | 79 |
| 516 | 3300049703 | Ga0501219_000531 | Ga0501219_000531_1651_1890 | 79 |
| 517 | 3300049705 | Ga0501225_0000233 | Ga0501225_0000233_7929_8168 | 79 |
| 518 | 3300049705 | Ga0501225_0021144 | Ga0501225_0021144_1373_1612 | 79 |
| 519 | 3300049705 | Ga0501225_0247214 | Ga0501225_0247214_237_476 | 79 |
| 520 | 3300049758 | Ga0501241_001987 | Ga0501241_001987_427_666 | 79 |
| 521 | 3300049822 | Ga0501035_0149331 | Ga0501035_0149331_93_332 | 79 |
| 522 | 3300049823 | Ga0501044_0273699 | Ga0501044_0273699_1298_1537 | 79 |
| 523 | 3300049823 | Ga0501044_0298286 | Ga0501044_0298286_976_1215 | 79 |
| 524 | 3300050005 | Ga0501284_00017 | Ga0501284_00017_91692_91931 | 79 |
| 525 | 3300050493 | nmdc:mga0k408_20911_c1 | nmdc:mga0k408_20911_c1_2403_2642 | 79 |
| 526 | 3300050493 | nmdc:mga0k408_219047_c1 | nmdc:mga0k408_219047_c1_822_1061 | 79 |
| 527 | 3300050493 | nmdc:mga0k408_310614_c1 | nmdc:mga0k408_310614_c1_575_814 | 79 |
| 528 | 3300050493 | nmdc:mga0k408_387745_c1 | nmdc:mga0k408_387745_c1_287_526 | 79 |
| 529 | 3300050493 | nmdc:mga0k408_575680_c1 | nmdc:mga0k408_575680_c1_271_510 | 79 |
| 530 | 3300050493 | nmdc:mga0k408_860080_c1 | nmdc:mga0k408_860080_c1_230_469 | 79 |
| 531 | 3300050511 | nmdc:mga08y16_568374_c1 | nmdc:mga08y16_568374_c1_551_793 | 79 |
| 532 | 3300050512 | nmdc:mga0n895_1074222_c1 | nmdc:mga0n895_1074222_c1_63_308 | 79 |
| 533 | 3300050512 | nmdc:mga0n895_221009_c1 | nmdc:mga0n895_221009_c1_1096_1341 | 79 |
| 534 | 3300053086 | Ga0500578_0000060 | Ga0500578_0000060_8669_8908 | 79 |
| 535 | 3300053086 | Ga0500578_0463652 | Ga0500578_0463652_391_630 | 79 |
| 536 | 3300053090 | Ga0500646_0189698 | Ga0500646_0189698_401_640 | 79 |
| 537 | 3300053090 | Ga0500646_0318082 | Ga0500646_0318082_257_496 | 79 |
| 538 | 3300053092 | Ga0500583_0000003 | Ga0500583_0000003_208106_208345 | 79 |
| 539 | 3300053092 | Ga0500583_0000778 | Ga0500583_0000778_6115_6354 | 79 |
| 540 | 3300053092 | Ga0500583_0483987 | Ga0500583_0483987_239_478 | 79 |
| 541 | 3300053093 | Ga0500651_0625009 | Ga0500651_0625009_265_504 | 79 |
| 542 | 3300053093 | Ga0500651_0713630 | Ga0500651_0713630_242_481 | 79 |
| 543 | 3300053098 | Ga0500650_0057930 | Ga0500650_0057930_194_433 | 79 |
| 544 | 3300053103 | Ga0500555_099097 | Ga0500555_099097_328_567 | 79 |
| 545 | 3300053118 | Ga0500594_0258079 | Ga0500594_0258079_158_397 | 79 |
| 546 | 3300053131 | Ga0500652_033073 | Ga0500652_033073_1663_1902 | 79 |
| 547 | 3300053146 | Ga0500588_0018949 | Ga0500588_0018949_401_640 | 79 |
| 548 | 3300053151 | Ga0500604_0287752 | Ga0500604_0287752_78_317 | 79 |
| 549 | 3300053153 | Ga0500616_0076070 | Ga0500616_0076070_1093_1332 | 79 |
| 550 | 3300053156 | Ga0500622_0058005 | Ga0500622_0058005_1558_1797 | 79 |
| 551 | 3300053156 | Ga0500622_0121650 | Ga0500622_0121650_684_923 | 79 |
| 552 | 3300053177 | Ga0500636_0123112 | Ga0500636_0123112_80_319 | 79 |
| 553 | 3300053178 | Ga0500637_0564396 | Ga0500637_0564396_110_349 | 79 |
| 554 | 3300053727 | Ga0500611_014284 | Ga0500611_014284_950_1189 | 79 |
| 555 | 3300053739 | Ga0500587_026402 | Ga0500587_026402_368_607 | 79 |
| 556 | 3300055283 | Ga0500661_045562 | Ga0500661_045562_364_603 | 79 |
| 557 | 3300061719 | Ga0466962_0192577 | Ga0466962_0192577_589_828 | 79 |
| 558 | 3300061719 | Ga0466962_0312309 | Ga0466962_0312309_28_267 | 79 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8apj-assembly1.cif.gz_V1 | rotational state 2d of trypanosoma brucei mitochondrial atp synthase | 0.7367 | 4 | 66 |
| 5izs-assembly1.cif.gz_A | de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity | 0.7331 | 3 | 70 |
| 5izs-assembly1.cif.gz_B | de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity | 0.7296 | 3 | 70 |
| 6rdn-assembly1.cif.gz_E | cryo-em structure of polytomella f-atp synthase, rotary substate 1c, monomer-masked refinement | 0.7205 | 4 | 66 |
| 6rdw-assembly1.cif.gz_J | cryo-em structure of polytomella f-atp synthase, rotary substate 1f, composite map | 0.7184 | 4 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54DN6_261_414_1.20.1440.340 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); | 0.8378 | 9 | 61 | 1.20.1440.340 |
| af_A4I2J3_675_1015_1.20.1560.10 | Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain | 0.7745 | 5 | 69 | 1.20.1560.10 |
| af_P0A9H9_35_168_1.10.287.500 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.7443 | 5 | 66 | 1.10.287.500 |
| af_O60635_1_114_1.20.5.780 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin | 0.7289 | 4 | 67 | 1.20.5.780 |
| 4bizE01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain | 0.7256 | 1 | 67 | 1.10.287.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0C1L5B1-F1-model_v4 | Cardiolipin synthase N-terminal domain-containing protein | 0.9844 | 1 | 72 |
GO:0016020
|
| AF-A0A851GWJ0-F1-model_v4 | Uncharacterized protein | 0.9715 | 1 | 73 |
GO:0016020
|
| AF-A0A0C1L5B1-F1-model_v4 | Cardiolipin synthase N-terminal domain-containing protein | 0.971 | 1 | 72 |
GO:0016020
|
| AF-A0A851GWJ0-F1-model_v4 | Uncharacterized protein | 0.9586 | 1 | 73 |
GO:0016020
|
| AF-A0A257HZQ6-F1-model_v4 | Cardiolipin synthase N-terminal domain-containing protein | 0.9509 | 1 | 77 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar