F463472

General Info

Members Datasets Scaffolds Average Seq Length
558 239 557 80

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0000082|Ga0466972_0000082_13342_13620
Length 92
Sequence MNQLKKWLGIVWMLLGPVAIYYLIKTAAGEISKSPVTNTIIQWAVFVIIFIPIAIGLIIFGYYAFKGEYDHLPESSTEIKTIAVANNILPRL

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
170 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
173 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
174 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
177 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
209 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
210 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
211 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
214 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
226 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
236 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
237 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
238 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.63
Nodule 0
Rhizoplane 1.97
Rhizosphere 87.28
Stem 0
Stem Tuber 0
Unclassified 4.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1026910 3300002738 Bacteria 519
2 rootH1_10004790 3300003316 Bacteria 9723
3 rootH2_10191969 3300003320 Bacteria 2173
4 rootL2_10064547 3300003322 Bacteria 1932
5 rootL2_10222743 3300003322 Bacteria 1104
6 rootL2_10336253 3300003322 Bacteria 1446
7 rootH1_10007189 3300003323 Bacteria 65578
8 rootH1_10113682 3300003323 Bacteria 2170
9 Ga0065714_10267444 3300005288 Bacteria 745
10 Ga0065707_10260657 3300005295 Bacteria 1098
11 Ga0070676_10072870 3300005328 Bacteria 2065
12 Ga0070676_10083441 3300005328 Unclassified 1943
13 Ga0070676_11517773 3300005328 Unclassified 516
14 Ga0070683_100007891 3300005329 Bacteria 9021
15 Ga0070683_100195210 3300005329 Unclassified 1922
16 Ga0070690_100001766 3300005330 Bacteria 11433
17 Ga0070690_100048211 3300005330 Bacteria 2712
18 Ga0070690_100490587 3300005330 Unclassified 917
19 Ga0070670_100022437 3300005331 Bacteria 5433
20 Ga0070670_101954855 3300005331 Bacteria 540
21 Ga0068869_100002336 3300005334 Bacteria 11408
22 Ga0068869_100005789 3300005334 Bacteria 7798
23 Ga0068869_100044910 3300005334 Bacteria 3179
24 Ga0068869_100096051 3300005334 Bacteria 2236
25 Ga0068869_100191287 3300005334 Bacteria 1609
26 Ga0068869_100539655 3300005334 Bacteria 978
27 Ga0070666_10019870 3300005335 Bacteria 4339
28 Ga0070666_10081458 3300005335 Bacteria 2213
29 Ga0070666_10108856 3300005335 Bacteria 1915
30 Ga0070682_100129290 3300005337 Bacteria 1707
31 Ga0070682_100352699 3300005337 Bacteria 1097
32 Ga0070682_101581465 3300005337 Bacteria 566
33 Ga0068868_100002287 3300005338 Bacteria 13245
34 Ga0068868_100097932 3300005338 Bacteria 2371
35 Ga0068868_100203548 3300005338 Bacteria 1651
36 Ga0068868_100244747 3300005338 Bacteria 1508
37 Ga0068868_100923852 3300005338 Bacteria 794
38 Ga0070660_100129445 3300005339 Unclassified 2019
39 Ga0070689_100005603 3300005340 Bacteria 8592
40 Ga0070689_100044201 3300005340 Unclassified 3426
41 Ga0070691_10473075 3300005341 Unclassified 719
42 Ga0070687_100675096 3300005343 Bacteria 719
43 Ga0070687_100743177 3300005343 Unclassified 689
44 Ga0070687_101229652 3300005343 Bacteria 553
45 Ga0070661_100001257 3300005344 Bacteria 17801
46 Ga0070661_100019477 3300005344 Bacteria 4837
47 Ga0070661_100502919 3300005344 Unclassified 970
48 Ga0070661_100656155 3300005344 Bacteria 852
49 Ga0070668_100109493 3300005347 Bacteria 2198
50 Ga0070668_100585829 3300005347 Bacteria 974
51 Ga0070668_101163564 3300005347 Bacteria 698
52 Ga0070669_100613603 3300005353 Unclassified 912
53 Ga0070669_100672187 3300005353 Bacteria 873
54 Ga0070675_100090401 3300005354 Bacteria 2564
55 Ga0070675_100172727 3300005354 Bacteria 1865
56 Ga0070675_100285171 3300005354 Bacteria 1452
57 Ga0070675_100434081 3300005354 Bacteria 1176
58 Ga0070675_100908045 3300005354 Unclassified 807
59 Ga0070675_101135708 3300005354 Unclassified 719
60 Ga0070671_100037003 3300005355 Bacteria 4047
61 Ga0070671_100039337 3300005355 Bacteria 3926
62 Ga0070671_100069585 3300005355 Bacteria 2936
63 Ga0070671_100128875 3300005355 Bacteria 2130
64 Ga0070671_101368838 3300005355 Bacteria 625
65 Ga0070674_100002720 3300005356 Bacteria 9779
66 Ga0070674_100555129 3300005356 Bacteria 964
67 Ga0070673_100060741 3300005364 Bacteria 2996
68 Ga0070673_100916474 3300005364 Bacteria 813
69 Ga0070673_102222326 3300005364 Bacteria 521
70 Ga0070688_100026655 3300005365 Bacteria 3435
71 Ga0070688_100429292 3300005365 Bacteria 984
72 Ga0070659_100040451 3300005366 Bacteria 3643
73 Ga0070659_100438491 3300005366 Unclassified 1106
74 Ga0070667_100007776 3300005367 Bacteria 8886
75 Ga0070667_100026339 3300005367 Bacteria 4836
76 Ga0070667_100733718 3300005367 Unclassified 915
77 Ga0070710_10419190 3300005437 Unclassified 901
78 Ga0070701_10024563 3300005438 Bacteria 2916
79 Ga0070700_100174624 3300005441 Bacteria 1490
80 Ga0070663_100057255 3300005455 Bacteria 2796
81 Ga0070678_100104073 3300005456 Bacteria 2207
82 Ga0070678_100158535 3300005456 Bacteria 1831
83 Ga0070678_100491114 3300005456 Bacteria 1082
84 Ga0070678_101942958 3300005456 Unclassified 556
85 Ga0070662_100007657 3300005457 Bacteria 7006
86 Ga0070662_100012826 3300005457 Bacteria 5567
87 Ga0070662_100893363 3300005457 Bacteria 758
88 Ga0068867_100011193 3300005459 Bacteria 6329
89 Ga0068867_100082703 3300005459 Bacteria 2423
90 Ga0068867_100215710 3300005459 Bacteria 1544
91 Ga0070685_10020548 3300005466 Bacteria 3574
92 Ga0070685_10716076 3300005466 Bacteria 731
93 Ga0070685_11311155 3300005466 Bacteria 553
94 Ga0070706_101101053 3300005467 Unclassified 731
95 Ga0070698_100012635 3300005471 Bacteria 8940
96 Ga0070699_100845045 3300005518 Bacteria 838
97 Ga0070679_100414079 3300005530 Bacteria 1293
98 Ga0070684_100000042 3300005535 Bacteria 89896
99 Ga0070684_100046400 3300005535 Bacteria 3764
100 Ga0068853_100005393 3300005539 Bacteria 10014
101 Ga0068853_100232242 3300005539 Bacteria 1688
102 Ga0068853_100309127 3300005539 Bacteria 1463
103 Ga0068853_100423895 3300005539 Bacteria 1248
104 Ga0068853_100719163 3300005539 Bacteria 953
105 Ga0068853_101856963 3300005539 Bacteria 584
106 Ga0068853_102050293 3300005539 Bacteria 555
107 Ga0070672_100492079 3300005543 Bacteria 1060
108 Ga0070672_100723598 3300005543 Unclassified 872
109 Ga0070672_101066334 3300005543 Bacteria 717
110 Ga0070686_100017405 3300005544 Bacteria 4199
111 Ga0070686_100026271 3300005544 Bacteria 3513
112 Ga0070686_100186827 3300005544 Unclassified 1476
113 Ga0070686_100378907 3300005544 Bacteria 1070
114 Ga0070693_100409212 3300005547 Bacteria 942
115 Ga0070693_100774278 3300005547 Unclassified 709
116 Ga0070693_101279440 3300005547 Unclassified 566
117 Ga0070665_100045456 3300005548 Bacteria 4410
118 Ga0070665_100234608 3300005548 Bacteria 1835
119 Ga0070665_101072319 3300005548 Bacteria 817
120 Ga0070664_100000266 3300005564 Bacteria 37671
121 Ga0070664_100021759 3300005564 Bacteria 5288
122 Ga0070664_100033015 3300005564 Bacteria 4331
123 Ga0070664_100129595 3300005564 Bacteria 2215
124 Ga0070664_100157727 3300005564 Bacteria 2006
125 Ga0070664_100331758 3300005564 Bacteria 1380
126 Ga0070664_100367048 3300005564 Bacteria 1312
127 Ga0070664_100621325 3300005564 Bacteria 1003
128 Ga0070664_101753215 3300005564 Bacteria 589
129 Ga0068857_100007376 3300005577 Bacteria 9467
130 Ga0068857_100052247 3300005577 Bacteria 3626
131 Ga0068857_100134633 3300005577 Bacteria 2231
132 Ga0068857_100138343 3300005577 Bacteria 2200
133 Ga0068857_102492200 3300005577 Bacteria 508
134 Ga0068854_100007085 3300005578 Bacteria 7157
135 Ga0068854_100853421 3300005578 Unclassified 797
136 Ga0068854_101251263 3300005578 Unclassified 666
137 Ga0068856_100034401 3300005614 Bacteria 4963
138 Ga0070702_100052122 3300005615 Bacteria 2346
139 Ga0070702_101525516 3300005615 Bacteria 550
140 Ga0068852_100233980 3300005616 Unclassified 1753
141 Ga0068852_100736680 3300005616 Bacteria 997
142 Ga0068852_100760054 3300005616 Bacteria 982
143 Ga0068852_101877669 3300005616 Bacteria 621
144 Ga0068852_102313738 3300005616 Unclassified 558
145 Ga0068859_100084228 3300005617 Unclassified 3224
146 Ga0068859_100245095 3300005617 Bacteria 1882
147 Ga0068859_100249471 3300005617 Bacteria 1865
148 Ga0068859_100278937 3300005617 Bacteria 1764
149 Ga0068859_101209885 3300005617 Bacteria 832
150 Ga0068859_102963295 3300005617 Bacteria 519
151 Ga0068864_100017320 3300005618 Bacteria 6006
152 Ga0068864_100076190 3300005618 Unclassified 2930
153 Ga0068864_100230396 3300005618 Bacteria 1713
154 Ga0068864_100527424 3300005618 Bacteria 1139
155 Ga0068864_100537227 3300005618 Bacteria 1129
156 Ga0068866_10071400 3300005718 Bacteria 1836
157 Ga0068861_100464698 3300005719 Bacteria 1137
158 Ga0068861_102008380 3300005719 Unclassified 577
159 Ga0068851_10127135 3300005834 Bacteria 1375
160 Ga0068851_10310076 3300005834 Unclassified 909
161 Ga0068870_10301157 3300005840 Bacteria 1012
162 Ga0068863_100029821 3300005841 Bacteria 5210
163 Ga0068863_100633534 3300005841 Bacteria 1060
164 Ga0068858_100030976 3300005842 Bacteria 4967
165 Ga0068858_100374471 3300005842 Bacteria 1366
166 Ga0068858_100458827 3300005842 Bacteria 1228
167 Ga0068858_100755513 3300005842 Bacteria 948
168 Ga0068858_101837060 3300005842 Bacteria 599
169 Ga0068860_100270533 3300005843 Bacteria 1658
170 Ga0068860_100392389 3300005843 Bacteria 1372
171 Ga0068860_101952180 3300005843 Bacteria 608
172 Ga0068860_102165952 3300005843 Bacteria 577
173 Ga0068860_102342247 3300005843 Unclassified 554
174 Ga0068862_101318237 3300005844 Bacteria 723
175 Ga0068862_101758981 3300005844 Unclassified 629
176 Ga0068862_102245473 3300005844 Bacteria 557
177 Ga0081539_10048260 3300005985 Bacteria 2423
178 Ga0070715_10354220 3300006163 Bacteria 803
179 Ga0070716_100062150 3300006173 Bacteria 2164
180 Ga0075366_10028139 3300006195 Bacteria 3298
181 Ga0075366_10103732 3300006195 Bacteria 1708
182 Ga0075366_10269462 3300006195 Bacteria 1040
183 Ga0075366_10414943 3300006195 Bacteria 829
184 Ga0075366_10638183 3300006195 Bacteria 661
185 Ga0075366_10999262 3300006195 Bacteria 522
186 Ga0097621_100008842 3300006237 Bacteria 7280
187 Ga0097621_100109540 3300006237 Bacteria 2333
188 Ga0097621_100429876 3300006237 Bacteria 1186
189 Ga0097621_101064824 3300006237 Bacteria 758
190 Ga0097621_101228420 3300006237 Bacteria 706
191 Ga0097621_101316237 3300006237 Bacteria 683
192 Ga0097621_101615024 3300006237 Unclassified 616
193 Ga0068871_100018297 3300006358 Bacteria 5322
194 Ga0068871_100153477 3300006358 Bacteria 1965
195 Ga0068871_100228048 3300006358 Bacteria 1616
196 Ga0068871_100307122 3300006358 Bacteria 1394
197 Ga0068871_100500983 3300006358 Bacteria 1094
198 Ga0068871_100838780 3300006358 Bacteria 849
199 Ga0075434_100341524 3300006871 Unclassified 1518
200 Ga0075434_100983119 3300006871 Unclassified 858
201 Ga0068865_100042863 3300006881 Bacteria 3088
202 Ga0097620_100084226 3300006931 Unclassified 3224
203 Ga0097620_100245093 3300006931 Bacteria 1882
204 Ga0097620_100249474 3300006931 Bacteria 1865
205 Ga0097620_100278968 3300006931 Bacteria 1764
206 Ga0097620_101209834 3300006931 Bacteria 832
207 Ga0097620_102963747 3300006931 Bacteria 519
208 Ga0075435_101783023 3300007076 Bacteria 540
209 Ga0105251_10357245 3300009011 Bacteria 667
210 Ga0105240_10045837 3300009093 Bacteria 5545
211 Ga0105240_10266102 3300009093 Bacteria 1976
212 Ga0105240_12759045 3300009093 Unclassified 506
213 Ga0111539_10068878 3300009094 Bacteria 4178
214 Ga0105247_10230238 3300009101 Bacteria 1258
215 Ga0105241_10100694 3300009174 Bacteria 2297
216 Ga0105241_10290915 3300009174 Bacteria 1399
217 Ga0105242_10077472 3300009176 Bacteria 2774
218 Ga0105242_10194731 3300009176 Bacteria 1797
219 Ga0105242_11285004 3300009176 Bacteria 755
220 Ga0105242_12519653 3300009176 Bacteria 563
221 Ga0105248_10203751 3300009177 Bacteria 2229
222 Ga0105237_10498908 3300009545 Bacteria 1224
223 Ga0105237_11595124 3300009545 Bacteria 659
224 Ga0105238_10087254 3300009551 Bacteria 3107
225 Ga0105249_10628113 3300009553 Unclassified 1130
226 Ga0105249_10974096 3300009553 Unclassified 916
227 Ga0105249_11646859 3300009553 Bacteria 714
228 Ga0105239_10156358 3300010375 Bacteria 2546
229 Ga0105239_13446278 3300010375 Unclassified 514
230 Ga0105246_10478524 3300011119 Bacteria 1053
231 Ga0105246_10499433 3300011119 Bacteria 1033
232 Ga0105246_11325196 3300011119 Bacteria 668
233 Ga0105246_12576037 3300011119 Bacteria 502
234 Ga0157373_10095260 3300013100 Bacteria 2095
235 Ga0157371_10304525 3300013102 Bacteria 1154
236 Ga0157371_10927237 3300013102 Bacteria 661
237 Ga0157371_11433130 3300013102 Unclassified 537
238 Ga0157371_11541248 3300013102 Unclassified 519
239 Ga0157369_11085547 3300013105 Unclassified 818
240 Ga0157374_10007250 3300013296 Bacteria 9444
241 Ga0157374_10011781 3300013296 Bacteria 7585
242 Ga0157374_10036791 3300013296 Bacteria 4487
243 Ga0157374_10050945 3300013296 Bacteria 3851
244 Ga0157374_10132137 3300013296 Bacteria 2416
245 Ga0157374_11653172 3300013296 Bacteria 665
246 Ga0157374_12293949 3300013296 Bacteria 567
247 Ga0157378_10006964 3300013297 Bacteria 9862
248 Ga0157378_10077674 3300013297 Unclassified 2993
249 Ga0157378_10117934 3300013297 Bacteria 2442
250 Ga0157378_10292239 3300013297 Unclassified 1574
251 Ga0157378_10405951 3300013297 Bacteria 1344
252 Ga0157378_11125496 3300013297 Bacteria 823
253 Ga0163162_10010595 3300013306 Bacteria 8965
254 Ga0163162_10061057 3300013306 Bacteria 3807
255 Ga0163162_10072297 3300013306 Bacteria 3504
256 Ga0163162_10074283 3300013306 Bacteria 3458
257 Ga0163162_10112642 3300013306 Bacteria 2819
258 Ga0163162_10198429 3300013306 Bacteria 2135
259 Ga0163162_10202289 3300013306 Bacteria 2115
260 Ga0163162_10209381 3300013306 Unclassified 2079
261 Ga0163162_10471819 3300013306 Bacteria 1386
262 Ga0163162_11012872 3300013306 Bacteria 939
263 Ga0163162_12288382 3300013306 Bacteria 621
264 Ga0157372_10886562 3300013307 Bacteria 1035
265 Ga0157372_11695183 3300013307 Bacteria 727
266 Ga0157372_12899695 3300013307 Bacteria 549
267 Ga0157375_10005827 3300013308 Bacteria 10719
268 Ga0157375_10019451 3300013308 Bacteria 6176
269 Ga0157375_10020351 3300013308 Bacteria 6060
270 Ga0157375_10330871 3300013308 Bacteria 1688
271 Ga0157375_10494301 3300013308 Unclassified 1388
272 Ga0157375_10608597 3300013308 Bacteria 1251
273 Ga0163163_10000079 3300014325 Bacteria 106874
274 Ga0163163_10000858 3300014325 Bacteria 25873
275 Ga0163163_10112201 3300014325 Bacteria 2755
276 Ga0163163_10130195 3300014325 Bacteria 2556
277 Ga0163163_10274385 3300014325 Unclassified 1737
278 Ga0163163_11609672 3300014325 Bacteria 710
279 Ga0157380_10625780 3300014326 Unclassified 1069
280 Ga0157377_10001057 3300014745 Bacteria 11646
281 Ga0157377_10051163 3300014745 Bacteria 2329
282 Ga0157377_11688770 3300014745 Bacteria 510
283 Ga0157379_10048092 3300014968 Bacteria 3808
284 Ga0157379_10188859 3300014968 Bacteria 1862
285 Ga0157379_10641397 3300014968 Bacteria 994
286 Ga0157379_11695832 3300014968 Bacteria 619
287 Ga0157379_11717621 3300014968 Bacteria 615
288 Ga0157376_10032451 3300014969 Bacteria 4193
289 Ga0157376_10146539 3300014969 Bacteria 2124
290 Ga0157376_10216009 3300014969 Bacteria 1773
291 Ga0163161_10038246 3300017792 Bacteria 3441
292 Ga0163161_10124226 3300017792 Bacteria 1942
293 Ga0163161_10162549 3300017792 Bacteria 1703
294 Ga0163161_10595578 3300017792 Bacteria 911
295 Ga0163161_11671018 3300017792 Bacteria 563
296 Ga0209258_130183 3300025242 Bacteria 508
297 Ga0209646_1010327 3300025246 Bacteria 1464
298 Ga0207697_10151948 3300025315 Bacteria 1008
299 Ga0207656_10131894 3300025321 Bacteria 1171
300 Ga0207656_10665437 3300025321 Bacteria 533
301 Ga0207692_10420639 3300025898 Unclassified 836
302 Ga0207642_10182853 3300025899 Bacteria 1144
303 Ga0207642_10287207 3300025899 Bacteria 948
304 Ga0207688_10100377 3300025901 Unclassified 1671
305 Ga0207680_10133692 3300025903 Unclassified 1637
306 Ga0207680_10271961 3300025903 Bacteria 1175
307 Ga0207680_10543751 3300025903 Bacteria 829
308 Ga0207647_10508386 3300025904 Bacteria 671
309 Ga0207685_10139405 3300025905 Bacteria 1086
310 Ga0207645_10005620 3300025907 Bacteria 9063
311 Ga0207645_10047614 3300025907 Unclassified 2738
312 Ga0207645_10255965 3300025907 Bacteria 1159
313 Ga0207654_10353430 3300025911 Bacteria 1012
314 Ga0207695_11544615 3300025913 Bacteria 544
315 Ga0207662_10026150 3300025918 Bacteria 3365
316 Ga0207662_11322865 3300025918 Unclassified 512
317 Ga0207657_10136994 3300025919 Bacteria 2002
318 Ga0207649_10001251 3300025920 Bacteria 15197
319 Ga0207649_10027411 3300025920 Bacteria 3342
320 Ga0207649_10440566 3300025920 Bacteria 981
321 Ga0207649_10455342 3300025920 Unclassified 966
322 Ga0207652_11410985 3300025921 Unclassified 600
323 Ga0207681_10435047 3300025923 Bacteria 1065
324 Ga0207681_10567598 3300025923 Unclassified 935
325 Ga0207681_11769105 3300025923 Unclassified 516
326 Ga0207650_10007835 3300025925 Bacteria 7276
327 Ga0207650_10299120 3300025925 Bacteria 1314
328 Ga0207650_10821854 3300025925 Unclassified 788
329 Ga0207659_10134461 3300025926 Bacteria 1913
330 Ga0207659_10156935 3300025926 Bacteria 1783
331 Ga0207659_10266696 3300025926 Bacteria 1395
332 Ga0207659_10524684 3300025926 Bacteria 1004
333 Ga0207644_10043629 3300025931 Bacteria 3184
334 Ga0207644_10171875 3300025931 Bacteria 1692
335 Ga0207644_11566943 3300025931 Unclassified 553
336 Ga0207644_11610659 3300025931 Unclassified 544
337 Ga0207690_10025700 3300025932 Bacteria 3701
338 Ga0207706_10012656 3300025933 Bacteria 7677
339 Ga0207706_10023622 3300025933 Bacteria 5520
340 Ga0207706_10075808 3300025933 Bacteria 2958
341 Ga0207706_10106753 3300025933 Unclassified 2464
342 Ga0207686_10023958 3300025934 Bacteria 3530
343 Ga0207686_10497086 3300025934 Bacteria 946
344 Ga0207670_10005077 3300025936 Bacteria 7183
345 Ga0207670_10098753 3300025936 Bacteria 2081
346 Ga0207669_10008571 3300025937 Bacteria 4809
347 Ga0207704_10167984 3300025938 Bacteria 1569
348 Ga0207704_10177058 3300025938 Bacteria 1537
349 Ga0207665_10117852 3300025939 Bacteria 1873
350 Ga0207665_10770192 3300025939 Bacteria 759
351 Ga0207691_10043521 3300025940 Bacteria 4138
352 Ga0207691_10115723 3300025940 Bacteria 2380
353 Ga0207691_10596826 3300025940 Bacteria 935
354 Ga0207691_10929169 3300025940 Bacteria 727
355 Ga0207711_10469456 3300025941 Bacteria 1172
356 Ga0207689_10010865 3300025942 Bacteria 7830
357 Ga0207689_10030074 3300025942 Bacteria 4528
358 Ga0207689_10062143 3300025942 Bacteria 3071
359 Ga0207689_10113980 3300025942 Bacteria 2222
360 Ga0207689_10679031 3300025942 Bacteria 868
361 Ga0207661_10002324 3300025944 Bacteria 13098
362 Ga0207661_10050937 3300025944 Bacteria 3301
363 Ga0207661_10135033 3300025944 Unclassified 2118
364 Ga0207661_10281295 3300025944 Bacteria 1487
365 Ga0207661_10554578 3300025944 Bacteria 1053
366 Ga0207661_11779005 3300025944 Bacteria 562
367 Ga0207661_12062460 3300025944 Unclassified 516
368 Ga0207679_10000304 3300025945 Bacteria 36952
369 Ga0207679_10021359 3300025945 Bacteria 4388
370 Ga0207679_10121864 3300025945 Bacteria 2077
371 Ga0207679_10336309 3300025945 Bacteria 1312
372 Ga0207679_10351006 3300025945 Bacteria 1286
373 Ga0207679_10810883 3300025945 Bacteria 854
374 Ga0207679_11499930 3300025945 Bacteria 618
375 Ga0207679_11523109 3300025945 Bacteria 613
376 Ga0207667_10054066 3300025949 Bacteria 4224
377 Ga0207651_10033276 3300025960 Bacteria 3323
378 Ga0207651_10126981 3300025960 Bacteria 1945
379 Ga0207651_11039066 3300025960 Unclassified 733
380 Ga0207712_10342661 3300025961 Bacteria 1240
381 Ga0207712_10494555 3300025961 Bacteria 1044
382 Ga0207668_10198152 3300025972 Bacteria 1597
383 Ga0207668_10407724 3300025972 Unclassified 1151
384 Ga0207668_11965147 3300025972 Unclassified 527
385 Ga0207640_11387054 3300025981 Bacteria 629
386 Ga0207640_11531434 3300025981 Unclassified 600
387 Ga0207640_12189909 3300025981 Bacteria 502
388 Ga0207658_10181715 3300025986 Unclassified 1741
389 Ga0207658_12102996 3300025986 Unclassified 513
390 Ga0207677_10037968 3300026023 Bacteria 3152
391 Ga0207677_10067812 3300026023 Bacteria 2501
392 Ga0207677_10075641 3300026023 Bacteria 2394
393 Ga0207677_10724821 3300026023 Bacteria 884
394 Ga0207677_11151012 3300026023 Bacteria 709
395 Ga0207703_10046568 3300026035 Bacteria 3492
396 Ga0207703_10343838 3300026035 Bacteria 1372
397 Ga0207703_10346439 3300026035 Bacteria 1367
398 Ga0207639_10020169 3300026041 Bacteria 4769
399 Ga0207639_10179961 3300026041 Bacteria 1798
400 Ga0207639_10428778 3300026041 Bacteria 1197
401 Ga0207639_11386759 3300026041 Bacteria 660
402 Ga0207639_11500381 3300026041 Bacteria 633
403 Ga0207639_11843849 3300026041 Bacteria 565
404 Ga0207678_10122620 3300026067 Unclassified 2218
405 Ga0207678_10855658 3300026067 Bacteria 804
406 Ga0207678_11085795 3300026067 Bacteria 709
407 Ga0207702_10213347 3300026078 Bacteria 1796
408 Ga0207641_10141941 3300026088 Bacteria 2168
409 Ga0207641_11050442 3300026088 Bacteria 812
410 Ga0207648_10022838 3300026089 Bacteria 5612
411 Ga0207648_10077034 3300026089 Bacteria 2907
412 Ga0207648_10351872 3300026089 Bacteria 1328
413 Ga0207648_11234472 3300026089 Bacteria 702
414 Ga0207676_10005907 3300026095 Bacteria 8647
415 Ga0207676_10144345 3300026095 Unclassified 2042
416 Ga0207676_10164183 3300026095 Bacteria 1928
417 Ga0207676_10427899 3300026095 Bacteria 1243
418 Ga0207676_10588539 3300026095 Bacteria 1067
419 Ga0207676_11282072 3300026095 Bacteria 727
420 Ga0207676_12555015 3300026095 Bacteria 507
421 Ga0207674_10004112 3300026116 Bacteria 17616
422 Ga0207674_10005133 3300026116 Bacteria 15625
423 Ga0207674_10156350 3300026116 Bacteria 2235
424 Ga0207674_10236756 3300026116 Bacteria 1773
425 Ga0207675_100256351 3300026118 Bacteria 1694
426 Ga0207675_100404952 3300026118 Bacteria 1345
427 Ga0207675_100439250 3300026118 Bacteria 1291
428 Ga0207683_10002030 3300026121 Bacteria 17898
429 Ga0207683_10989203 3300026121 Unclassified 781
430 Ga0207683_12098461 3300026121 Unclassified 513
431 Ga0207698_10029302 3300026142 Bacteria 3941
432 Ga0207698_11125676 3300026142 Bacteria 798
433 Ga0207698_11654253 3300026142 Bacteria 656
434 Ga0207428_10796533 3300027907 Bacteria 672
435 Ga0268266_10459382 3300028379 Bacteria 1211
436 Ga0268266_12380430 3300028379 Bacteria 500
437 Ga0268265_10079959 3300028380 Bacteria 2577
438 Ga0268265_11704684 3300028380 Unclassified 636
439 Ga0268264_10245929 3300028381 Bacteria 1659
440 Ga0268264_11822815 3300028381 Bacteria 618
441 Ga0307513_10165443 3300031456 Bacteria 2097
442 Ga0307513_10192765 3300031456 Bacteria 1888
443 Ga0307513_10203611 3300031456 Bacteria 1817
444 Ga0307509_10553964 3300031507 Unclassified 827
445 Ga0373923_0707963 3300035111 Bacteria 500
446 Ga0373953_0020138 3300035117 Bacteria 2491
447 Ga0373956_0207167 3300035119 Bacteria 930
448 Ga0373943_0723252 3300035170 Bacteria 590
449 Ga0373955_0061792 3300035172 Bacteria 2070
450 Ga0373933_0017889 3300035724 Bacteria 3979
451 Ga0373947_0077682 3300035725 Bacteria 2048
452 Ga0373937_0002819 3300036401 Bacteria 14528
453 Ga0373925_0946419 3300037068 Bacteria 710
454 Ga0373925_0964512 3300037068 Unclassified 702
455 Ga0439436_0005795 3300041404 Bacteria 3785
456 Ga0439439_0045901 3300041406 Bacteria 1140
457 Ga0451795_0175453 3300041456 Bacteria 1012
458 Ga0451798_0177859 3300041458 Bacteria 799
459 Ga0451798_0752934 3300041458 Bacteria 920
460 Ga0451807_0179209 3300041486 Bacteria 1557
461 Ga0451833_0771407 3300041491 Bacteria 543
462 Ga0451833_0982377 3300041491 Bacteria 711
463 Ga0451835_0373411 3300041492 Bacteria 775
464 Ga0451851_0038748 3300041507 Bacteria 1197
465 Ga0451851_1041435 3300041507 Bacteria 1172
466 Ga0451853_0104252 3300041512 Bacteria 1104
467 Ga0451853_1693258 3300041512 Unclassified 825
468 Ga0451853_2288465 3300041512 Bacteria 2561
469 Ga0451853_3502709 3300041512 Unclassified 1227
470 Ga0439449_0026721 3300042007 Bacteria 2154
471 Ga0439449_0185409 3300042007 Unclassified 778
472 Ga0439457_000285 3300042014 Bacteria 14022
473 Ga0439462_0001557 3300042015 Bacteria 5146
474 Ga0439462_0093246 3300042015 Unclassified 827
475 Ga0450891_040042 3300042129 Unclassified 502
476 Ga0451577_0976084 3300042876 Bacteria 761
477 Ga0466972_0000082 3300044658 Bacteria 88592
478 Ga0466972_0026400 3300044658 Bacteria 2879
479 Ga0466972_0604377 3300044658 Bacteria 519
480 Ga0453683_0217607 3300044673 Unclassified 1214
481 Ga0453684_0023120 3300044712 Bacteria 9177
482 Ga0466968_0623818 3300044735 Bacteria 546
483 Ga0466957_0004118 3300044842 Bacteria 8054
484 Ga0466960_0125402 3300044901 Bacteria 1349
485 Ga0451576_1061732 3300045051 Bacteria 848
486 Ga0495638_0064095 3300046460 Bacteria 2264
487 Ga0495618_0116187 3300046514 Bacteria 1713
488 Ga0495628_0105251 3300046516 Bacteria 2174
489 Ga0495630_0020077 3300046517 Bacteria 4921
490 Ga0495640_0214470 3300046533 Bacteria 1216
491 Ga0495587_0149716 3300046536 Bacteria 1330
492 Ga0495645_0343324 3300046543 Bacteria 964
493 Ga0495634_0266078 3300046642 Bacteria 1045
494 Ga0495635_0137476 3300046663 Bacteria 1665
495 Ga0495657_0332099 3300046675 Bacteria 902
496 Ga0495623_0565307 3300046679 Bacteria 594
497 Ga0495613_0425347 3300046689 Bacteria 903
498 Ga0495674_0875187 3300047319 Bacteria 695
499 Ga0495680_0086730 3300047322 Bacteria 2355
500 Ga0495684_0467119 3300047471 Bacteria 874
501 Ga0496104_0776518 3300048907 Bacteria 865
502 Ga0496104_0969496 3300048907 Bacteria 755
503 Ga0496105_1179497 3300048908 Bacteria 565
504 Ga0496109_1137734 3300048912 Bacteria 718
505 Ga0496110_0024996 3300048913 Bacteria 5099
506 Ga0496110_0239308 3300048913 Bacteria 1652
507 Ga0496114_1635964 3300048917 Bacteria 532
508 Ga0501291_095642 3300049514 Bacteria 613
509 Ga0501209_104842 3300049656 Bacteria 831
510 Ga0501257_015899 3300049686 Bacteria 1741
511 Ga0501257_022587 3300049686 Bacteria 1489
512 Ga0501257_185157 3300049686 Bacteria 591
513 Ga0501219_000531 3300049703 Bacteria 5697
514 Ga0501225_0000233 3300049705 Bacteria 17294
515 Ga0501225_0021144 3300049705 Bacteria 1797
516 Ga0501225_0247214 3300049705 Bacteria 585
517 Ga0501241_001987 3300049758 Bacteria 4010
518 Ga0501280_116674 3300049776 Bacteria 526
519 Ga0501035_0149331 3300049822 Bacteria 2029
520 Ga0501044_0273699 3300049823 Bacteria 1623
521 Ga0501044_0298286 3300049823 Bacteria 1541
522 Ga0501284_00017 3300050005 Bacteria 96362
523 nmdc:mga0k408_20911_c1 3300050493 Bacteria 3672
524 nmdc:mga0k408_219047_c1 3300050493 Bacteria 1136
525 nmdc:mga0k408_310614_c1 3300050493 Bacteria 941
526 nmdc:mga0k408_387745_c1 3300050493 Bacteria 832
527 nmdc:mga0k408_575680_c1 3300050493 Bacteria 665
528 nmdc:mga0k408_860080_c1 3300050493 Bacteria 527
529 nmdc:mga08y16_568374_c1 3300050511 Bacteria 1146
530 nmdc:mga0n895_1074222_c1 3300050512 Unclassified 783
531 nmdc:mga0n895_221009_c1 3300050512 Bacteria 1923
532 Ga0500578_0000060 3300053086 Bacteria 118274
533 Ga0500578_0463652 3300053086 Bacteria 719
534 Ga0500646_0189698 3300053090 Unclassified 700
535 Ga0500646_0318082 3300053090 Bacteria 561
536 Ga0500583_0000003 3300053092 Bacteria 229587
537 Ga0500583_0000778 3300053092 Bacteria 9253
538 Ga0500583_0483987 3300053092 Unclassified 583
539 Ga0500651_0625009 3300053093 Unclassified 582
540 Ga0500651_0713630 3300053093 Bacteria 535
541 Ga0500650_0057930 3300053098 Bacteria 1807
542 Ga0500555_099097 3300053103 Unclassified 741
543 Ga0500594_0258079 3300053118 Bacteria 581
544 Ga0500652_033073 3300053131 Bacteria 2041
545 Ga0500559_0038560 3300053136 Unclassified 2076
546 Ga0500588_0018949 3300053146 Unclassified 1822
547 Ga0500604_0287752 3300053151 Bacteria 570
548 Ga0500616_0076070 3300053153 Bacteria 1698
549 Ga0500622_0058005 3300053156 Bacteria 1979
550 Ga0500622_0121650 3300053156 Unclassified 1265
551 Ga0500636_0123112 3300053177 Bacteria 1453
552 Ga0500637_0564396 3300053178 Bacteria 548
553 Ga0500611_014284 3300053727 Bacteria 1382
554 Ga0500587_026402 3300053739 Bacteria 779
555 Ga0500661_045562 3300055283 Bacteria 780
556 Ga0466962_0192577 3300061719 Bacteria 995
557 Ga0466962_0312309 3300061719 Bacteria 779

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049686 Ga0501257_185157 Ga0501257_185157_282_497 65
2 3300049776 Ga0501280_116674 Ga0501280_116674_287_502 65
3 3300005347 Ga0070668_100109493 Ga0070668_1001094932 72
4 3300005356 Ga0070674_100555129 Ga0070674_1005551292 72
5 3300005466 Ga0070685_11311155 Ga0070685_113111551 72
6 3300006358 Ga0068871_100307122 Ga0068871_1003071221 72
7 3300025972 Ga0207668_10198152 Ga0207668_101981522 72
8 3300005843 Ga0068860_102342247 Ga0068860_1023422471 73
9 3300009093 Ga0105240_10045837 Ga0105240_100458372 73
10 3300009551 Ga0105238_10087254 Ga0105238_100872542 73
11 3300005331 Ga0070670_101954855 Ga0070670_1019548551 75
12 3300005337 Ga0070682_100352699 Ga0070682_1003526991 75
13 3300005456 Ga0070678_100158535 Ga0070678_1001585353 75
14 3300005539 Ga0068853_101856963 Ga0068853_1018569631 75
15 3300005543 Ga0070672_101066334 Ga0070672_1010663341 75
16 3300005548 Ga0070665_101072319 Ga0070665_1010723192 75
17 3300005840 Ga0068870_10301157 Ga0068870_103011572 75
18 3300006237 Ga0097621_101064824 Ga0097621_1010648241 75
19 3300013296 Ga0157374_12293949 Ga0157374_122939492 75
20 3300013306 Ga0163162_10198429 Ga0163162_101984293 75
21 3300025242 Ga0209258_130183 Ga0209258_1301831 75
22 3300025925 Ga0207650_10299120 Ga0207650_102991202 75
23 3300025940 Ga0207691_10929169 Ga0207691_109291692 75
24 3300026089 Ga0207648_11234472 Ga0207648_112344721 75
25 3300053136 Ga0500559_0038560 Ga0500559_0038560_1264_1491 75
26 iso_pu_bacteria 2738541278 2738725668 75
27 3300002738 JGI25154J39366_1026910 JGI25154J39366_10269101 79
28 3300003316 rootH1_10004790 rootH1_100047902 79
29 3300003320 rootH2_10191969 rootH2_101919692 79
30 3300003322 rootL2_10064547 rootL2_100645471 79
31 3300003322 rootL2_10222743 rootL2_102227432 79
32 3300003322 rootL2_10336253 rootL2_103362531 79
33 3300003323 rootH1_10007189 rootH1_1000718955 79
34 3300003323 rootH1_10113682 rootH1_101136822 79
35 3300005288 Ga0065714_10267444 Ga0065714_102674442 79
36 3300005295 Ga0065707_10260657 Ga0065707_102606571 79
37 3300005328 Ga0070676_10072870 Ga0070676_100728703 79
38 3300005328 Ga0070676_10083441 Ga0070676_100834411 79
39 3300005328 Ga0070676_11517773 Ga0070676_115177731 79
40 3300005329 Ga0070683_100007891 Ga0070683_1000078912 79
41 3300005329 Ga0070683_100195210 Ga0070683_1001952103 79
42 3300005330 Ga0070690_100001766 Ga0070690_1000017669 79
43 3300005330 Ga0070690_100048211 Ga0070690_1000482113 79
44 3300005330 Ga0070690_100490587 Ga0070690_1004905872 79
45 3300005331 Ga0070670_100022437 Ga0070670_1000224375 79
46 3300005334 Ga0068869_100002336 Ga0068869_1000023367 79
47 3300005334 Ga0068869_100005789 Ga0068869_1000057892 79
48 3300005334 Ga0068869_100044910 Ga0068869_1000449102 79
49 3300005334 Ga0068869_100096051 Ga0068869_1000960512 79
50 3300005334 Ga0068869_100191287 Ga0068869_1001912872 79
51 3300005334 Ga0068869_100539655 Ga0068869_1005396552 79
52 3300005335 Ga0070666_10019870 Ga0070666_100198703 79
53 3300005335 Ga0070666_10081458 Ga0070666_100814582 79
54 3300005335 Ga0070666_10108856 Ga0070666_101088561 79
55 3300005337 Ga0070682_100129290 Ga0070682_1001292902 79
56 3300005337 Ga0070682_101581465 Ga0070682_1015814652 79
57 3300005338 Ga0068868_100002287 Ga0068868_1000022876 79
58 3300005338 Ga0068868_100097932 Ga0068868_1000979322 79
59 3300005338 Ga0068868_100203548 Ga0068868_1002035482 79
60 3300005338 Ga0068868_100244747 Ga0068868_1002447472 79
61 3300005338 Ga0068868_100923852 Ga0068868_1009238522 79
62 3300005339 Ga0070660_100129445 Ga0070660_1001294452 79
63 3300005340 Ga0070689_100005603 Ga0070689_1000056032 79
64 3300005340 Ga0070689_100044201 Ga0070689_1000442012 79
65 3300005341 Ga0070691_10473075 Ga0070691_104730752 79
66 3300005343 Ga0070687_100675096 Ga0070687_1006750961 79
67 3300005343 Ga0070687_100743177 Ga0070687_1007431772 79
68 3300005343 Ga0070687_101229652 Ga0070687_1012296521 79
69 3300005344 Ga0070661_100001257 Ga0070661_1000012579 79
70 3300005344 Ga0070661_100019477 Ga0070661_1000194773 79
71 3300005344 Ga0070661_100502919 Ga0070661_1005029192 79
72 3300005344 Ga0070661_100656155 Ga0070661_1006561551 79
73 3300005347 Ga0070668_100585829 Ga0070668_1005858293 79
74 3300005347 Ga0070668_101163564 Ga0070668_1011635641 79
75 3300005353 Ga0070669_100613603 Ga0070669_1006136032 79
76 3300005353 Ga0070669_100672187 Ga0070669_1006721872 79
77 3300005354 Ga0070675_100090401 Ga0070675_1000904013 79
78 3300005354 Ga0070675_100172727 Ga0070675_1001727272 79
79 3300005354 Ga0070675_100285171 Ga0070675_1002851711 79
80 3300005354 Ga0070675_100434081 Ga0070675_1004340812 79
81 3300005354 Ga0070675_100908045 Ga0070675_1009080451 79
82 3300005354 Ga0070675_101135708 Ga0070675_1011357082 79
83 3300005355 Ga0070671_100037003 Ga0070671_1000370033 79
84 3300005355 Ga0070671_100039337 Ga0070671_1000393371 79
85 3300005355 Ga0070671_100069585 Ga0070671_1000695854 79
86 3300005355 Ga0070671_100128875 Ga0070671_1001288752 79
87 3300005355 Ga0070671_101368838 Ga0070671_1013688382 79
88 3300005356 Ga0070674_100002720 Ga0070674_1000027208 79
89 3300005364 Ga0070673_100060741 Ga0070673_1000607413 79
90 3300005364 Ga0070673_100916474 Ga0070673_1009164742 79
91 3300005364 Ga0070673_102222326 Ga0070673_1022223261 79
92 3300005365 Ga0070688_100026655 Ga0070688_1000266553 79
93 3300005365 Ga0070688_100429292 Ga0070688_1004292922 79
94 3300005366 Ga0070659_100040451 Ga0070659_1000404513 79
95 3300005366 Ga0070659_100438491 Ga0070659_1004384912 79
96 3300005367 Ga0070667_100007776 Ga0070667_1000077763 79
97 3300005367 Ga0070667_100026339 Ga0070667_1000263393 79
98 3300005367 Ga0070667_100733718 Ga0070667_1007337182 79
99 3300005437 Ga0070710_10419190 Ga0070710_104191902 79
100 3300005438 Ga0070701_10024563 Ga0070701_100245632 79
101 3300005441 Ga0070700_100174624 Ga0070700_1001746241 79
102 3300005455 Ga0070663_100057255 Ga0070663_1000572553 79
103 3300005456 Ga0070678_100104073 Ga0070678_1001040733 79
104 3300005456 Ga0070678_100491114 Ga0070678_1004911142 79
105 3300005456 Ga0070678_101942958 Ga0070678_1019429581 79
106 3300005457 Ga0070662_100007657 Ga0070662_1000076575 79
107 3300005457 Ga0070662_100012826 Ga0070662_1000128266 79
108 3300005457 Ga0070662_100893363 Ga0070662_1008933631 79
109 3300005459 Ga0068867_100011193 Ga0068867_1000111931 79
110 3300005459 Ga0068867_100082703 Ga0068867_1000827033 79
111 3300005459 Ga0068867_100215710 Ga0068867_1002157101 79
112 3300005466 Ga0070685_10020548 Ga0070685_100205484 79
113 3300005466 Ga0070685_10716076 Ga0070685_107160761 79
114 3300005467 Ga0070706_101101053 Ga0070706_1011010532 79
115 3300005471 Ga0070698_100012635 Ga0070698_1000126359 79
116 3300005518 Ga0070699_100845045 Ga0070699_1008450452 79
117 3300005530 Ga0070679_100414079 Ga0070679_1004140792 79
118 3300005535 Ga0070684_100000042 Ga0070684_10000004232 79
119 3300005535 Ga0070684_100046400 Ga0070684_1000464003 79
120 3300005539 Ga0068853_100005393 Ga0068853_1000053933 79
121 3300005539 Ga0068853_100232242 Ga0068853_1002322422 79
122 3300005539 Ga0068853_100309127 Ga0068853_1003091272 79
123 3300005539 Ga0068853_100423895 Ga0068853_1004238951 79
124 3300005539 Ga0068853_100719163 Ga0068853_1007191632 79
125 3300005539 Ga0068853_102050293 Ga0068853_1020502931 79
126 3300005543 Ga0070672_100492079 Ga0070672_1004920792 79
127 3300005543 Ga0070672_100723598 Ga0070672_1007235981 79
128 3300005544 Ga0070686_100017405 Ga0070686_1000174055 79
129 3300005544 Ga0070686_100026271 Ga0070686_1000262713 79
130 3300005544 Ga0070686_100186827 Ga0070686_1001868272 79
131 3300005544 Ga0070686_100378907 Ga0070686_1003789071 79
132 3300005547 Ga0070693_100409212 Ga0070693_1004092122 79
133 3300005547 Ga0070693_100774278 Ga0070693_1007742782 79
134 3300005547 Ga0070693_101279440 Ga0070693_1012794402 79
135 3300005548 Ga0070665_100045456 Ga0070665_1000454563 79
136 3300005548 Ga0070665_100234608 Ga0070665_1002346081 79
137 3300005564 Ga0070664_100000266 Ga0070664_10000026612 79
138 3300005564 Ga0070664_100021759 Ga0070664_1000217592 79
139 3300005564 Ga0070664_100033015 Ga0070664_1000330153 79
140 3300005564 Ga0070664_100129595 Ga0070664_1001295953 79
141 3300005564 Ga0070664_100157727 Ga0070664_1001577272 79
142 3300005564 Ga0070664_100331758 Ga0070664_1003317583 79
143 3300005564 Ga0070664_100367048 Ga0070664_1003670483 79
144 3300005564 Ga0070664_100621325 Ga0070664_1006213252 79
145 3300005564 Ga0070664_101753215 Ga0070664_1017532151 79
146 3300005577 Ga0068857_100007376 Ga0068857_1000073767 79
147 3300005577 Ga0068857_100052247 Ga0068857_1000522474 79
148 3300005577 Ga0068857_100134633 Ga0068857_1001346332 79
149 3300005577 Ga0068857_100138343 Ga0068857_1001383432 79
150 3300005577 Ga0068857_102492200 Ga0068857_1024922001 79
151 3300005578 Ga0068854_100007085 Ga0068854_1000070857 79
152 3300005578 Ga0068854_100853421 Ga0068854_1008534212 79
153 3300005578 Ga0068854_101251263 Ga0068854_1012512631 79
154 3300005614 Ga0068856_100034401 Ga0068856_1000344015 79
155 3300005615 Ga0070702_100052122 Ga0070702_1000521222 79
156 3300005615 Ga0070702_101525516 Ga0070702_1015255161 79
157 3300005616 Ga0068852_100233980 Ga0068852_1002339802 79
158 3300005616 Ga0068852_100736680 Ga0068852_1007366802 79
159 3300005616 Ga0068852_100760054 Ga0068852_1007600541 79
160 3300005616 Ga0068852_101877669 Ga0068852_1018776691 79
161 3300005616 Ga0068852_102313738 Ga0068852_1023137381 79
162 3300005617 Ga0068859_100084228 Ga0068859_1000842282 79
163 3300005617 Ga0068859_100245095 Ga0068859_1002450952 79
164 3300005617 Ga0068859_100249471 Ga0068859_1002494712 79
165 3300005617 Ga0068859_100278937 Ga0068859_1002789372 79
166 3300005617 Ga0068859_101209885 Ga0068859_1012098852 79
167 3300005617 Ga0068859_102963295 Ga0068859_1029632952 79
168 3300005618 Ga0068864_100017320 Ga0068864_1000173204 79
169 3300005618 Ga0068864_100076190 Ga0068864_1000761902 79
170 3300005618 Ga0068864_100230396 Ga0068864_1002303963 79
171 3300005618 Ga0068864_100527424 Ga0068864_1005274241 79
172 3300005618 Ga0068864_100537227 Ga0068864_1005372272 79
173 3300005718 Ga0068866_10071400 Ga0068866_100714002 79
174 3300005719 Ga0068861_100464698 Ga0068861_1004646981 79
175 3300005719 Ga0068861_102008380 Ga0068861_1020083802 79
176 3300005834 Ga0068851_10127135 Ga0068851_101271353 79
177 3300005834 Ga0068851_10310076 Ga0068851_103100762 79
178 3300005841 Ga0068863_100029821 Ga0068863_1000298212 79
179 3300005841 Ga0068863_100633534 Ga0068863_1006335341 79
180 3300005842 Ga0068858_100030976 Ga0068858_1000309764 79
181 3300005842 Ga0068858_100374471 Ga0068858_1003744712 79
182 3300005842 Ga0068858_100458827 Ga0068858_1004588272 79
183 3300005842 Ga0068858_100755513 Ga0068858_1007555132 79
184 3300005842 Ga0068858_101837060 Ga0068858_1018370602 79
185 3300005843 Ga0068860_100270533 Ga0068860_1002705332 79
186 3300005843 Ga0068860_100392389 Ga0068860_1003923892 79
187 3300005843 Ga0068860_101952180 Ga0068860_1019521801 79
188 3300005843 Ga0068860_102165952 Ga0068860_1021659522 79
189 3300005844 Ga0068862_101318237 Ga0068862_1013182372 79
190 3300005844 Ga0068862_101758981 Ga0068862_1017589812 79
191 3300005844 Ga0068862_102245473 Ga0068862_1022454732 79
192 3300005985 Ga0081539_10048260 Ga0081539_100482603 79
193 3300006163 Ga0070715_10354220 Ga0070715_103542201 79
194 3300006173 Ga0070716_100062150 Ga0070716_1000621503 79
195 3300006195 Ga0075366_10028139 Ga0075366_100281393 79
196 3300006195 Ga0075366_10103732 Ga0075366_101037324 79
197 3300006195 Ga0075366_10269462 Ga0075366_102694622 79
198 3300006195 Ga0075366_10414943 Ga0075366_104149432 79
199 3300006195 Ga0075366_10638183 Ga0075366_106381832 79
200 3300006195 Ga0075366_10999262 Ga0075366_109992621 79
201 3300006237 Ga0097621_100008842 Ga0097621_1000088426 79
202 3300006237 Ga0097621_100109540 Ga0097621_1001095401 79
203 3300006237 Ga0097621_100429876 Ga0097621_1004298762 79
204 3300006237 Ga0097621_101228420 Ga0097621_1012284202 79
205 3300006237 Ga0097621_101316237 Ga0097621_1013162371 79
206 3300006237 Ga0097621_101615024 Ga0097621_1016150242 79
207 3300006358 Ga0068871_100018297 Ga0068871_1000182974 79
208 3300006358 Ga0068871_100153477 Ga0068871_1001534772 79
209 3300006358 Ga0068871_100228048 Ga0068871_1002280481 79
210 3300006358 Ga0068871_100500983 Ga0068871_1005009832 79
211 3300006358 Ga0068871_100838780 Ga0068871_1008387801 79
212 3300006871 Ga0075434_100341524 Ga0075434_1003415242 79
213 3300006871 Ga0075434_100983119 Ga0075434_1009831191 79
214 3300006881 Ga0068865_100042863 Ga0068865_1000428634 79
215 3300006931 Ga0097620_100084226 Ga0097620_1000842262 79
216 3300006931 Ga0097620_100245093 Ga0097620_1002450932 79
217 3300006931 Ga0097620_100249474 Ga0097620_1002494742 79
218 3300006931 Ga0097620_100278968 Ga0097620_1002789682 79
219 3300006931 Ga0097620_101209834 Ga0097620_1012098342 79
220 3300006931 Ga0097620_102963747 Ga0097620_1029637472 79
221 3300007076 Ga0075435_101783023 Ga0075435_1017830231 79
222 3300009011 Ga0105251_10357245 Ga0105251_103572451 79
223 3300009093 Ga0105240_10266102 Ga0105240_102661023 79
224 3300009093 Ga0105240_12759045 Ga0105240_127590452 79
225 3300009094 Ga0111539_10068878 Ga0111539_100688782 79
226 3300009101 Ga0105247_10230238 Ga0105247_102302381 79
227 3300009174 Ga0105241_10100694 Ga0105241_101006941 79
228 3300009174 Ga0105241_10290915 Ga0105241_102909153 79
229 3300009176 Ga0105242_10077472 Ga0105242_100774722 79
230 3300009176 Ga0105242_10194731 Ga0105242_101947313 79
231 3300009176 Ga0105242_11285004 Ga0105242_112850042 79
232 3300009176 Ga0105242_12519653 Ga0105242_125196531 79
233 3300009177 Ga0105248_10203751 Ga0105248_102037512 79
234 3300009545 Ga0105237_10498908 Ga0105237_104989082 79
235 3300009545 Ga0105237_11595124 Ga0105237_115951241 79
236 3300009553 Ga0105249_10628113 Ga0105249_106281132 79
237 3300009553 Ga0105249_10974096 Ga0105249_109740961 79
238 3300009553 Ga0105249_11646859 Ga0105249_116468592 79
239 3300010375 Ga0105239_10156358 Ga0105239_101563583 79
240 3300010375 Ga0105239_13446278 Ga0105239_134462782 79
241 3300011119 Ga0105246_10478524 Ga0105246_104785241 79
242 3300011119 Ga0105246_10499433 Ga0105246_104994332 79
243 3300011119 Ga0105246_11325196 Ga0105246_113251962 79
244 3300011119 Ga0105246_12576037 Ga0105246_125760371 79
245 3300013100 Ga0157373_10095260 Ga0157373_100952603 79
246 3300013102 Ga0157371_10304525 Ga0157371_103045252 79
247 3300013102 Ga0157371_10927237 Ga0157371_109272372 79
248 3300013102 Ga0157371_11433130 Ga0157371_114331301 79
249 3300013102 Ga0157371_11541248 Ga0157371_115412481 79
250 3300013105 Ga0157369_11085547 Ga0157369_110855472 79
251 3300013296 Ga0157374_10007250 Ga0157374_100072502 79
252 3300013296 Ga0157374_10011781 Ga0157374_100117813 79
253 3300013296 Ga0157374_10036791 Ga0157374_100367912 79
254 3300013296 Ga0157374_10050945 Ga0157374_100509453 79
255 3300013296 Ga0157374_10132137 Ga0157374_101321373 79
256 3300013296 Ga0157374_11653172 Ga0157374_116531722 79
257 3300013297 Ga0157378_10006964 Ga0157378_100069645 79
258 3300013297 Ga0157378_10077674 Ga0157378_100776743 79
259 3300013297 Ga0157378_10117934 Ga0157378_101179342 79
260 3300013297 Ga0157378_10292239 Ga0157378_102922392 79
261 3300013297 Ga0157378_10405951 Ga0157378_104059512 79
262 3300013297 Ga0157378_11125496 Ga0157378_111254962 79
263 3300013306 Ga0163162_10010595 Ga0163162_100105952 79
264 3300013306 Ga0163162_10061057 Ga0163162_100610573 79
265 3300013306 Ga0163162_10072297 Ga0163162_100722974 79
266 3300013306 Ga0163162_10074283 Ga0163162_100742833 79
267 3300013306 Ga0163162_10112642 Ga0163162_101126423 79
268 3300013306 Ga0163162_10202289 Ga0163162_102022892 79
269 3300013306 Ga0163162_10209381 Ga0163162_102093812 79
270 3300013306 Ga0163162_10471819 Ga0163162_104718192 79
271 3300013306 Ga0163162_11012872 Ga0163162_110128722 79
272 3300013306 Ga0163162_12288382 Ga0163162_122883822 79
273 3300013307 Ga0157372_10886562 Ga0157372_108865622 79
274 3300013307 Ga0157372_11695183 Ga0157372_116951832 79
275 3300013307 Ga0157372_12899695 Ga0157372_128996951 79
276 3300013308 Ga0157375_10005827 Ga0157375_1000582710 79
277 3300013308 Ga0157375_10019451 Ga0157375_100194516 79
278 3300013308 Ga0157375_10020351 Ga0157375_100203513 79
279 3300013308 Ga0157375_10330871 Ga0157375_103308712 79
280 3300013308 Ga0157375_10494301 Ga0157375_104943012 79
281 3300013308 Ga0157375_10608597 Ga0157375_106085973 79
282 3300014325 Ga0163163_10000079 Ga0163163_1000007945 79
283 3300014325 Ga0163163_10000858 Ga0163163_1000085815 79
284 3300014325 Ga0163163_10112201 Ga0163163_101122012 79
285 3300014325 Ga0163163_10130195 Ga0163163_101301951 79
286 3300014325 Ga0163163_10274385 Ga0163163_102743852 79
287 3300014325 Ga0163163_11609672 Ga0163163_116096722 79
288 3300014326 Ga0157380_10625780 Ga0157380_106257802 79
289 3300014745 Ga0157377_10001057 Ga0157377_100010576 79
290 3300014745 Ga0157377_10051163 Ga0157377_100511632 79
291 3300014745 Ga0157377_11688770 Ga0157377_116887701 79
292 3300014968 Ga0157379_10048092 Ga0157379_100480922 79
293 3300014968 Ga0157379_10188859 Ga0157379_101888592 79
294 3300014968 Ga0157379_10641397 Ga0157379_106413973 79
295 3300014968 Ga0157379_11695832 Ga0157379_116958321 79
296 3300014968 Ga0157379_11717621 Ga0157379_117176211 79
297 3300014969 Ga0157376_10032451 Ga0157376_100324513 79
298 3300014969 Ga0157376_10146539 Ga0157376_101465392 79
299 3300014969 Ga0157376_10216009 Ga0157376_102160091 79
300 3300017792 Ga0163161_10038246 Ga0163161_100382463 79
301 3300017792 Ga0163161_10124226 Ga0163161_101242262 79
302 3300017792 Ga0163161_10162549 Ga0163161_101625492 79
303 3300017792 Ga0163161_10595578 Ga0163161_105955782 79
304 3300017792 Ga0163161_11671018 Ga0163161_116710182 79
305 3300025246 Ga0209646_1010327 Ga0209646_10103273 79
306 3300025315 Ga0207697_10151948 Ga0207697_101519483 79
307 3300025321 Ga0207656_10131894 Ga0207656_101318941 79
308 3300025321 Ga0207656_10665437 Ga0207656_106654372 79
309 3300025898 Ga0207692_10420639 Ga0207692_104206392 79
310 3300025899 Ga0207642_10182853 Ga0207642_101828532 79
311 3300025899 Ga0207642_10287207 Ga0207642_102872072 79
312 3300025901 Ga0207688_10100377 Ga0207688_101003772 79
313 3300025903 Ga0207680_10133692 Ga0207680_101336922 79
314 3300025903 Ga0207680_10271961 Ga0207680_102719612 79
315 3300025903 Ga0207680_10543751 Ga0207680_105437512 79
316 3300025904 Ga0207647_10508386 Ga0207647_105083862 79
317 3300025905 Ga0207685_10139405 Ga0207685_101394052 79
318 3300025907 Ga0207645_10005620 Ga0207645_100056203 79
319 3300025907 Ga0207645_10047614 Ga0207645_100476143 79
320 3300025907 Ga0207645_10255965 Ga0207645_102559651 79
321 3300025911 Ga0207654_10353430 Ga0207654_103534301 79
322 3300025913 Ga0207695_11544615 Ga0207695_115446152 79
323 3300025918 Ga0207662_10026150 Ga0207662_100261502 79
324 3300025918 Ga0207662_11322865 Ga0207662_113228651 79
325 3300025919 Ga0207657_10136994 Ga0207657_101369943 79
326 3300025920 Ga0207649_10001251 Ga0207649_100012517 79
327 3300025920 Ga0207649_10027411 Ga0207649_100274113 79
328 3300025920 Ga0207649_10440566 Ga0207649_104405662 79
329 3300025920 Ga0207649_10455342 Ga0207649_104553422 79
330 3300025921 Ga0207652_11410985 Ga0207652_114109851 79
331 3300025923 Ga0207681_10435047 Ga0207681_104350472 79
332 3300025923 Ga0207681_10567598 Ga0207681_105675982 79
333 3300025923 Ga0207681_11769105 Ga0207681_117691052 79
334 3300025925 Ga0207650_10007835 Ga0207650_100078355 79
335 3300025925 Ga0207650_10821854 Ga0207650_108218541 79
336 3300025926 Ga0207659_10134461 Ga0207659_101344612 79
337 3300025926 Ga0207659_10156935 Ga0207659_101569352 79
338 3300025926 Ga0207659_10266696 Ga0207659_102666963 79
339 3300025926 Ga0207659_10524684 Ga0207659_105246842 79
340 3300025931 Ga0207644_10043629 Ga0207644_100436292 79
341 3300025931 Ga0207644_10171875 Ga0207644_101718752 79
342 3300025931 Ga0207644_11566943 Ga0207644_115669432 79
343 3300025931 Ga0207644_11610659 Ga0207644_116106592 79
344 3300025932 Ga0207690_10025700 Ga0207690_100257003 79
345 3300025933 Ga0207706_10012656 Ga0207706_100126565 79
346 3300025933 Ga0207706_10023622 Ga0207706_100236222 79
347 3300025933 Ga0207706_10075808 Ga0207706_100758083 79
348 3300025933 Ga0207706_10106753 Ga0207706_101067533 79
349 3300025934 Ga0207686_10023958 Ga0207686_100239583 79
350 3300025934 Ga0207686_10497086 Ga0207686_104970862 79
351 3300025936 Ga0207670_10005077 Ga0207670_100050777 79
352 3300025936 Ga0207670_10098753 Ga0207670_100987532 79
353 3300025937 Ga0207669_10008571 Ga0207669_100085713 79
354 3300025938 Ga0207704_10167984 Ga0207704_101679842 79
355 3300025938 Ga0207704_10177058 Ga0207704_101770582 79
356 3300025939 Ga0207665_10117852 Ga0207665_101178523 79
357 3300025939 Ga0207665_10770192 Ga0207665_107701922 79
358 3300025940 Ga0207691_10043521 Ga0207691_100435215 79
359 3300025940 Ga0207691_10115723 Ga0207691_101157232 79
360 3300025940 Ga0207691_10596826 Ga0207691_105968262 79
361 3300025941 Ga0207711_10469456 Ga0207711_104694563 79
362 3300025942 Ga0207689_10010865 Ga0207689_100108658 79
363 3300025942 Ga0207689_10030074 Ga0207689_100300743 79
364 3300025942 Ga0207689_10062143 Ga0207689_100621433 79
365 3300025942 Ga0207689_10113980 Ga0207689_101139803 79
366 3300025942 Ga0207689_10679031 Ga0207689_106790312 79
367 3300025944 Ga0207661_10002324 Ga0207661_100023243 79
368 3300025944 Ga0207661_10050937 Ga0207661_100509372 79
369 3300025944 Ga0207661_10135033 Ga0207661_101350333 79
370 3300025944 Ga0207661_10281295 Ga0207661_102812951 79
371 3300025944 Ga0207661_10554578 Ga0207661_105545783 79
372 3300025944 Ga0207661_11779005 Ga0207661_117790052 79
373 3300025944 Ga0207661_12062460 Ga0207661_120624601 79
374 3300025945 Ga0207679_10000304 Ga0207679_1000030427 79
375 3300025945 Ga0207679_10021359 Ga0207679_100213592 79
376 3300025945 Ga0207679_10121864 Ga0207679_101218642 79
377 3300025945 Ga0207679_10336309 Ga0207679_103363093 79
378 3300025945 Ga0207679_10351006 Ga0207679_103510063 79
379 3300025945 Ga0207679_10810883 Ga0207679_108108832 79
380 3300025945 Ga0207679_11499930 Ga0207679_114999301 79
381 3300025945 Ga0207679_11523109 Ga0207679_115231092 79
382 3300025949 Ga0207667_10054066 Ga0207667_100540662 79
383 3300025960 Ga0207651_10033276 Ga0207651_100332764 79
384 3300025960 Ga0207651_10126981 Ga0207651_101269812 79
385 3300025960 Ga0207651_11039066 Ga0207651_110390662 79
386 3300025961 Ga0207712_10342661 Ga0207712_103426612 79
387 3300025961 Ga0207712_10494555 Ga0207712_104945551 79
388 3300025972 Ga0207668_10407724 Ga0207668_104077242 79
389 3300025972 Ga0207668_11965147 Ga0207668_119651471 79
390 3300025981 Ga0207640_11387054 Ga0207640_113870542 79
391 3300025981 Ga0207640_11531434 Ga0207640_115314342 79
392 3300025981 Ga0207640_12189909 Ga0207640_121899091 79
393 3300025986 Ga0207658_10181715 Ga0207658_101817152 79
394 3300025986 Ga0207658_12102996 Ga0207658_121029961 79
395 3300026023 Ga0207677_10037968 Ga0207677_100379682 79
396 3300026023 Ga0207677_10067812 Ga0207677_100678122 79
397 3300026023 Ga0207677_10075641 Ga0207677_100756412 79
398 3300026023 Ga0207677_10724821 Ga0207677_107248211 79
399 3300026023 Ga0207677_11151012 Ga0207677_111510122 79
400 3300026035 Ga0207703_10046568 Ga0207703_100465683 79
401 3300026035 Ga0207703_10343838 Ga0207703_103438382 79
402 3300026035 Ga0207703_10346439 Ga0207703_103464392 79
403 3300026041 Ga0207639_10020169 Ga0207639_100201693 79
404 3300026041 Ga0207639_10179961 Ga0207639_101799612 79
405 3300026041 Ga0207639_10428778 Ga0207639_104287782 79
406 3300026041 Ga0207639_11386759 Ga0207639_113867591 79
407 3300026041 Ga0207639_11500381 Ga0207639_115003812 79
408 3300026041 Ga0207639_11843849 Ga0207639_118438492 79
409 3300026067 Ga0207678_10122620 Ga0207678_101226201 79
410 3300026067 Ga0207678_10855658 Ga0207678_108556581 79
411 3300026067 Ga0207678_11085795 Ga0207678_110857952 79
412 3300026078 Ga0207702_10213347 Ga0207702_102133472 79
413 3300026088 Ga0207641_10141941 Ga0207641_101419412 79
414 3300026088 Ga0207641_11050442 Ga0207641_110504421 79
415 3300026089 Ga0207648_10022838 Ga0207648_100228383 79
416 3300026089 Ga0207648_10077034 Ga0207648_100770342 79
417 3300026089 Ga0207648_10351872 Ga0207648_103518722 79
418 3300026095 Ga0207676_10005907 Ga0207676_100059076 79
419 3300026095 Ga0207676_10144345 Ga0207676_101443452 79
420 3300026095 Ga0207676_10164183 Ga0207676_101641832 79
421 3300026095 Ga0207676_10427899 Ga0207676_104278992 79
422 3300026095 Ga0207676_10588539 Ga0207676_105885393 79
423 3300026095 Ga0207676_11282072 Ga0207676_112820721 79
424 3300026095 Ga0207676_12555015 Ga0207676_125550152 79
425 3300026116 Ga0207674_10004112 Ga0207674_1000411212 79
426 3300026116 Ga0207674_10005133 Ga0207674_1000513312 79
427 3300026116 Ga0207674_10156350 Ga0207674_101563502 79
428 3300026116 Ga0207674_10236756 Ga0207674_102367562 79
429 3300026118 Ga0207675_100256351 Ga0207675_1002563511 79
430 3300026118 Ga0207675_100404952 Ga0207675_1004049521 79
431 3300026118 Ga0207675_100439250 Ga0207675_1004392502 79
432 3300026121 Ga0207683_10002030 Ga0207683_1000203012 79
433 3300026121 Ga0207683_10989203 Ga0207683_109892032 79
434 3300026121 Ga0207683_12098461 Ga0207683_120984611 79
435 3300026142 Ga0207698_10029302 Ga0207698_100293023 79
436 3300026142 Ga0207698_11125676 Ga0207698_111256762 79
437 3300026142 Ga0207698_11654253 Ga0207698_116542531 79
438 3300027907 Ga0207428_10796533 Ga0207428_107965331 79
439 3300028379 Ga0268266_10459382 Ga0268266_104593823 79
440 3300028379 Ga0268266_12380430 Ga0268266_123804301 79
441 3300028380 Ga0268265_10079959 Ga0268265_100799593 79
442 3300028380 Ga0268265_11704684 Ga0268265_117046841 79
443 3300028381 Ga0268264_10245929 Ga0268264_102459291 79
444 3300028381 Ga0268264_11822815 Ga0268264_118228152 79
445 3300031456 Ga0307513_10165443 Ga0307513_101654432 79
446 3300031456 Ga0307513_10192765 Ga0307513_101927653 79
447 3300031456 Ga0307513_10203611 Ga0307513_102036112 79
448 3300031507 Ga0307509_10553964 Ga0307509_105539641 79
449 3300035111 Ga0373923_0707963 Ga0373923_0707963_189_434 79
450 3300035117 Ga0373953_0020138 Ga0373953_0020138_1989_2234 79
451 3300035119 Ga0373956_0207167 Ga0373956_0207167_567_812 79
452 3300035170 Ga0373943_0723252 Ga0373943_0723252_253_498 79
453 3300035172 Ga0373955_0061792 Ga0373955_0061792_490_735 79
454 3300035724 Ga0373933_0017889 Ga0373933_0017889_3580_3825 79
455 3300035725 Ga0373947_0077682 Ga0373947_0077682_906_1151 79
456 3300036401 Ga0373937_0002819 Ga0373937_0002819_4518_4763 79
457 3300037068 Ga0373925_0946419 Ga0373925_0946419_404_649 79
458 3300037068 Ga0373925_0964512 Ga0373925_0964512_100_345 79
459 3300041404 Ga0439436_0005795 Ga0439436_0005795_417_656 79
460 3300041406 Ga0439439_0045901 Ga0439439_0045901_648_887 79
461 3300041456 Ga0451795_0175453 Ga0451795_0175453_732_971 79
462 3300041458 Ga0451798_0177859 Ga0451798_0177859_462_701 79
463 3300041458 Ga0451798_0752934 Ga0451798_0752934_219_458 79
464 3300041486 Ga0451807_0179209 Ga0451807_0179209_1287_1532 79
465 3300041491 Ga0451833_0771407 Ga0451833_0771407_146_385 79
466 3300041491 Ga0451833_0982377 Ga0451833_0982377_129_368 79
467 3300041492 Ga0451835_0373411 Ga0451835_0373411_306_545 79
468 3300041507 Ga0451851_0038748 Ga0451851_0038748_401_640 79
469 3300041507 Ga0451851_1041435 Ga0451851_1041435_400_639 79
470 3300041512 Ga0451853_0104252 Ga0451853_0104252_817_1056 79
471 3300041512 Ga0451853_1693258 Ga0451853_1693258_353_598 79
472 3300041512 Ga0451853_2288465 Ga0451853_2288465_468_707 79
473 3300041512 Ga0451853_3502709 Ga0451853_3502709_957_1196 79
474 3300042007 Ga0439449_0026721 Ga0439449_0026721_1845_2084 79
475 3300042007 Ga0439449_0185409 Ga0439449_0185409_491_730 79
476 3300042014 Ga0439457_000285 Ga0439457_000285_5568_5807 79
477 3300042015 Ga0439462_0001557 Ga0439462_0001557_598_837 79
478 3300042015 Ga0439462_0093246 Ga0439462_0093246_521_760 79
479 3300042129 Ga0450891_040042 Ga0450891_040042_14_253 79
480 3300042876 Ga0451577_0976084 Ga0451577_0976084_66_314 79
481 3300044658 Ga0466972_0000082 Ga0466972_0000082_13342_13620 79
482 3300044658 Ga0466972_0026400 Ga0466972_0026400_231_470 79
483 3300044658 Ga0466972_0604377 Ga0466972_0604377_144_383 79
484 3300044673 Ga0453683_0217607 Ga0453683_0217607_449_697 79
485 3300044712 Ga0453684_0023120 Ga0453684_0023120_5260_5508 79
486 3300044735 Ga0466968_0623818 Ga0466968_0623818_246_485 79
487 3300044842 Ga0466957_0004118 Ga0466957_0004118_4878_5117 79
488 3300044901 Ga0466960_0125402 Ga0466960_0125402_398_637 79
489 3300045051 Ga0451576_1061732 Ga0451576_1061732_566_814 79
490 3300046460 Ga0495638_0064095 Ga0495638_0064095_578_817 79
491 3300046514 Ga0495618_0116187 Ga0495618_0116187_1196_1441 79
492 3300046516 Ga0495628_0105251 Ga0495628_0105251_1342_1587 79
493 3300046517 Ga0495630_0020077 Ga0495630_0020077_1207_1452 79
494 3300046533 Ga0495640_0214470 Ga0495640_0214470_307_552 79
495 3300046536 Ga0495587_0149716 Ga0495587_0149716_865_1110 79
496 3300046543 Ga0495645_0343324 Ga0495645_0343324_330_575 79
497 3300046642 Ga0495634_0266078 Ga0495634_0266078_567_812 79
498 3300046663 Ga0495635_0137476 Ga0495635_0137476_202_447 79
499 3300046675 Ga0495657_0332099 Ga0495657_0332099_329_574 79
500 3300046679 Ga0495623_0565307 Ga0495623_0565307_338_583 79
501 3300046689 Ga0495613_0425347 Ga0495613_0425347_175_420 79
502 3300047319 Ga0495674_0875187 Ga0495674_0875187_155_400 79
503 3300047322 Ga0495680_0086730 Ga0495680_0086730_1382_1627 79
504 3300047471 Ga0495684_0467119 Ga0495684_0467119_375_620 79
505 3300048907 Ga0496104_0776518 Ga0496104_0776518_61_306 79
506 3300048907 Ga0496104_0969496 Ga0496104_0969496_157_399 79
507 3300048908 Ga0496105_1179497 Ga0496105_1179497_156_398 79
508 3300048912 Ga0496109_1137734 Ga0496109_1137734_323_565 79
509 3300048913 Ga0496110_0024996 Ga0496110_0024996_933_1178 79
510 3300048913 Ga0496110_0239308 Ga0496110_0239308_1136_1378 79
511 3300048917 Ga0496114_1635964 Ga0496114_1635964_231_476 79
512 3300049514 Ga0501291_095642 Ga0501291_095642_71_337 79
513 3300049656 Ga0501209_104842 Ga0501209_104842_396_635 79
514 3300049686 Ga0501257_015899 Ga0501257_015899_645_884 79
515 3300049686 Ga0501257_022587 Ga0501257_022587_458_697 79
516 3300049703 Ga0501219_000531 Ga0501219_000531_1651_1890 79
517 3300049705 Ga0501225_0000233 Ga0501225_0000233_7929_8168 79
518 3300049705 Ga0501225_0021144 Ga0501225_0021144_1373_1612 79
519 3300049705 Ga0501225_0247214 Ga0501225_0247214_237_476 79
520 3300049758 Ga0501241_001987 Ga0501241_001987_427_666 79
521 3300049822 Ga0501035_0149331 Ga0501035_0149331_93_332 79
522 3300049823 Ga0501044_0273699 Ga0501044_0273699_1298_1537 79
523 3300049823 Ga0501044_0298286 Ga0501044_0298286_976_1215 79
524 3300050005 Ga0501284_00017 Ga0501284_00017_91692_91931 79
525 3300050493 nmdc:mga0k408_20911_c1 nmdc:mga0k408_20911_c1_2403_2642 79
526 3300050493 nmdc:mga0k408_219047_c1 nmdc:mga0k408_219047_c1_822_1061 79
527 3300050493 nmdc:mga0k408_310614_c1 nmdc:mga0k408_310614_c1_575_814 79
528 3300050493 nmdc:mga0k408_387745_c1 nmdc:mga0k408_387745_c1_287_526 79
529 3300050493 nmdc:mga0k408_575680_c1 nmdc:mga0k408_575680_c1_271_510 79
530 3300050493 nmdc:mga0k408_860080_c1 nmdc:mga0k408_860080_c1_230_469 79
531 3300050511 nmdc:mga08y16_568374_c1 nmdc:mga08y16_568374_c1_551_793 79
532 3300050512 nmdc:mga0n895_1074222_c1 nmdc:mga0n895_1074222_c1_63_308 79
533 3300050512 nmdc:mga0n895_221009_c1 nmdc:mga0n895_221009_c1_1096_1341 79
534 3300053086 Ga0500578_0000060 Ga0500578_0000060_8669_8908 79
535 3300053086 Ga0500578_0463652 Ga0500578_0463652_391_630 79
536 3300053090 Ga0500646_0189698 Ga0500646_0189698_401_640 79
537 3300053090 Ga0500646_0318082 Ga0500646_0318082_257_496 79
538 3300053092 Ga0500583_0000003 Ga0500583_0000003_208106_208345 79
539 3300053092 Ga0500583_0000778 Ga0500583_0000778_6115_6354 79
540 3300053092 Ga0500583_0483987 Ga0500583_0483987_239_478 79
541 3300053093 Ga0500651_0625009 Ga0500651_0625009_265_504 79
542 3300053093 Ga0500651_0713630 Ga0500651_0713630_242_481 79
543 3300053098 Ga0500650_0057930 Ga0500650_0057930_194_433 79
544 3300053103 Ga0500555_099097 Ga0500555_099097_328_567 79
545 3300053118 Ga0500594_0258079 Ga0500594_0258079_158_397 79
546 3300053131 Ga0500652_033073 Ga0500652_033073_1663_1902 79
547 3300053146 Ga0500588_0018949 Ga0500588_0018949_401_640 79
548 3300053151 Ga0500604_0287752 Ga0500604_0287752_78_317 79
549 3300053153 Ga0500616_0076070 Ga0500616_0076070_1093_1332 79
550 3300053156 Ga0500622_0058005 Ga0500622_0058005_1558_1797 79
551 3300053156 Ga0500622_0121650 Ga0500622_0121650_684_923 79
552 3300053177 Ga0500636_0123112 Ga0500636_0123112_80_319 79
553 3300053178 Ga0500637_0564396 Ga0500637_0564396_110_349 79
554 3300053727 Ga0500611_014284 Ga0500611_014284_950_1189 79
555 3300053739 Ga0500587_026402 Ga0500587_026402_368_607 79
556 3300055283 Ga0500661_045562 Ga0500661_045562_364_603 79
557 3300061719 Ga0466962_0192577 Ga0466962_0192577_589_828 79
558 3300061719 Ga0466962_0312309 Ga0466962_0312309_28_267 79

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20664

DUF6814

Family of unknown function (DUF6814)

1

71

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8apj-assembly1.cif.gz_V1 rotational state 2d of trypanosoma brucei mitochondrial atp synthase 0.7367 4 66
5izs-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.7331 3 70
5izs-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.7296 3 70
6rdn-assembly1.cif.gz_E cryo-em structure of polytomella f-atp synthase, rotary substate 1c, monomer-masked refinement 0.7205 4 66
6rdw-assembly1.cif.gz_J cryo-em structure of polytomella f-atp synthase, rotary substate 1f, composite map 0.7184 4 66
ID Description Score Start End Superfamily
af_Q54DN6_261_414_1.20.1440.340 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.8378 9 61 1.20.1440.340
af_A4I2J3_675_1015_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.7745 5 69 1.20.1560.10
af_P0A9H9_35_168_1.10.287.500 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.7443 5 66 1.10.287.500
af_O60635_1_114_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.7289 4 67 1.20.5.780
4bizE01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.7256 1 67 1.10.287.130
ID Description Score Start End GO Terms
AF-A0A0C1L5B1-F1-model_v4 Cardiolipin synthase N-terminal domain-containing protein 0.9844 1 72 GO:0016020
AF-A0A851GWJ0-F1-model_v4 Uncharacterized protein 0.9715 1 73 GO:0016020
AF-A0A0C1L5B1-F1-model_v4 Cardiolipin synthase N-terminal domain-containing protein 0.971 1 72 GO:0016020
AF-A0A851GWJ0-F1-model_v4 Uncharacterized protein 0.9586 1 73 GO:0016020
AF-A0A257HZQ6-F1-model_v4 Cardiolipin synthase N-terminal domain-containing protein 0.9509 1 77 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.43 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map