F463458

General Info

Members Datasets Scaffolds Average Seq Length
558 182 557 381

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10030660|Ga0307412_100306605
Length 366
Sequence MLLAAASPDYSNGSNWLCLPGRADICSIPLKTTALNPNGYGSTGQSTVAKNSGIDCFYVYPTVSRDQGVNSDLSPAEEKAAVEVQFARFAGTCRTFAPIYRSMTVGLIAAVAAGADYKGPMATAYGDVRAAWKEYLTKYNRGRPFVLIGHSQGSWMLQMLIAQEIEGKPIAKQMKLAIIPGFNVLVPQGKLVGGTFKSTPVCSRPGQTGCIMTWTSYREKNAPPPGAVFGYAEAPGMTIACTNPARPGATGWVNLDSYWYARSAQPVPGGPIQWSTEGPPPSPFLRTEGLVSARCVNDGPRGYLSIRTNADPKDKRTDRIGGEVGILGMFIPGWGMHLADMSAPMGDLIRQVSALNGAKSGSGQPR

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.36
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 4.84
Rhizosphere 94.44
Stem 0
Stem Tuber 0.18
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1003557 3300001976 Bacteria 2052
2 JGI24740J21852_10004203 3300001979 Bacteria 6220
3 JGI24740J21852_10028613 3300001979 Bacteria 1840
4 JGI24739J22299_10007408 3300001989 Bacteria 4119
5 JGI24737J22298_10041272 3300001990 Bacteria 1415
6 JGI24735J21928_10025053 3300002067 Bacteria 1802
7 rootH1_10196665 3300003323 Bacteria 1334
8 Ga0070658_10000945 3300005327 Bacteria 24835
9 Ga0070658_10092437 3300005327 Bacteria 2494
10 Ga0070658_10192127 3300005327 Bacteria 1721
11 Ga0070658_10195742 3300005327 Bacteria 1704
12 Ga0070683_100004824 3300005329 Bacteria 11168
13 Ga0070683_100007042 3300005329 Bacteria 9467
14 Ga0070683_100060909 3300005329 Bacteria 3508
15 Ga0070670_100005424 3300005331 Bacteria 10761
16 Ga0070670_100005656 3300005331 Bacteria 10548
17 Ga0070670_100010639 3300005331 Bacteria 7859
18 Ga0070670_100016978 3300005331 Bacteria 6249
19 Ga0070670_100021956 3300005331 Bacteria 5492
20 Ga0070670_100032625 3300005331 Bacteria 4486
21 Ga0070670_100108324 3300005331 Bacteria 2394
22 Ga0070670_100137586 3300005331 Bacteria 2111
23 Ga0070666_10001573 3300005335 Bacteria 13866
24 Ga0070680_100002845 3300005336 Bacteria 12866
25 Ga0070680_100142605 3300005336 Bacteria 2009
26 Ga0070682_100004719 3300005337 Bacteria 7571
27 Ga0070682_100094887 3300005337 Bacteria 1958
28 Ga0070660_100001061 3300005339 Bacteria 18495
29 Ga0070660_100004190 3300005339 Bacteria 9956
30 Ga0070660_100004959 3300005339 Bacteria 9204
31 Ga0070660_100009593 3300005339 Bacteria 6816
32 Ga0070660_100010278 3300005339 Bacteria 6606
33 Ga0070660_100012973 3300005339 Bacteria 5963
34 Ga0070660_100056520 3300005339 Bacteria 3036
35 Ga0070660_100096020 3300005339 Bacteria 2343
36 Ga0070660_100317432 3300005339 Unclassified 1279
37 Ga0070661_100000198 3300005344 Bacteria 49932
38 Ga0070661_100009309 3300005344 Bacteria 6795
39 Ga0070661_100011430 3300005344 Bacteria 6184
40 Ga0070661_100029761 3300005344 Bacteria 3943
41 Ga0070661_100038565 3300005344 Bacteria 3478
42 Ga0070661_100042178 3300005344 Bacteria 3330
43 Ga0070661_100285901 3300005344 Unclassified 1280
44 Ga0070668_100122418 3300005347 Bacteria 2081
45 Ga0070669_100047193 3300005353 Bacteria 3142
46 Ga0070669_100082037 3300005353 Bacteria 2403
47 Ga0070675_100015241 3300005354 Bacteria 6072
48 Ga0070671_100003631 3300005355 Bacteria 12078
49 Ga0070671_100004347 3300005355 Bacteria 11205
50 Ga0070671_100039172 3300005355 Bacteria 3934
51 Ga0070674_100157500 3300005356 Bacteria 1720
52 Ga0070673_100066892 3300005364 Bacteria 2872
53 Ga0070659_100000381 3300005366 Bacteria 33609
54 Ga0070659_100007699 3300005366 Bacteria 7834
55 Ga0070659_100012198 3300005366 Bacteria 6370
56 Ga0070659_100043981 3300005366 Bacteria 3495
57 Ga0070659_100181872 3300005366 Bacteria 1726
58 Ga0070659_100219832 3300005366 Bacteria 1567
59 Ga0070659_100315748 3300005366 Bacteria 1305
60 Ga0070667_100010989 3300005367 Bacteria 7485
61 Ga0070667_100037919 3300005367 Bacteria 4041
62 Ga0070667_100152322 3300005367 Bacteria 2032
63 Ga0070667_100199538 3300005367 Bacteria 1775
64 Ga0070667_100201129 3300005367 Bacteria 1768
65 Ga0070667_100268369 3300005367 Bacteria 1529
66 Ga0070714_100022207 3300005435 Bacteria 5202
67 Ga0070714_100028449 3300005435 Bacteria 4638
68 Ga0070663_100000636 3300005455 Bacteria 18851
69 Ga0070663_100006176 3300005455 Bacteria 7176
70 Ga0070663_100082928 3300005455 Bacteria 2360
71 Ga0070663_100135224 3300005455 Bacteria 1876
72 Ga0070662_100000012 3300005457 Bacteria 129380
73 Ga0070662_100062855 3300005457 Bacteria 2714
74 Ga0070662_100092545 3300005457 Bacteria 2273
75 Ga0070662_100113147 3300005457 Bacteria 2070
76 Ga0070662_100236689 3300005457 Bacteria 1463
77 Ga0070681_10010289 3300005458 Bacteria 9233
78 Ga0070681_10063288 3300005458 Bacteria 3671
79 Ga0070681_10173977 3300005458 Bacteria 2074
80 Ga0070679_100026734 3300005530 Bacteria 5674
81 Ga0070679_100028567 3300005530 Bacteria 5500
82 Ga0070679_100349075 3300005530 Bacteria 1427
83 Ga0070679_100352352 3300005530 Bacteria 1419
84 Ga0070684_100003373 3300005535 Bacteria 11965
85 Ga0070684_100006550 3300005535 Bacteria 9017
86 Ga0070684_100086596 3300005535 Bacteria 2780
87 Ga0068853_100000032 3300005539 Bacteria 114306
88 Ga0068853_100010276 3300005539 Bacteria 7572
89 Ga0068853_100021524 3300005539 Bacteria 5378
90 Ga0068853_100032899 3300005539 Bacteria 4395
91 Ga0068853_100065209 3300005539 Bacteria 3160
92 Ga0068853_100101908 3300005539 Bacteria 2540
93 Ga0070672_100028048 3300005543 Bacteria 4207
94 Ga0070672_100053366 3300005543 Bacteria 3160
95 Ga0070693_100065748 3300005547 Bacteria 2120
96 Ga0070665_100003142 3300005548 Bacteria 17765
97 Ga0068855_100001355 3300005563 Bacteria 30354
98 Ga0068855_100061554 3300005563 Bacteria 4385
99 Ga0068855_100159704 3300005563 Bacteria 2559
100 Ga0068855_100204355 3300005563 Bacteria 2223
101 Ga0068855_100327103 3300005563 Bacteria 1693
102 Ga0068855_100468006 3300005563 Bacteria 1373
103 Ga0070664_100000133 3300005564 Bacteria 49630
104 Ga0070664_100011944 3300005564 Bacteria 7050
105 Ga0070664_100015505 3300005564 Bacteria 6235
106 Ga0070664_100042127 3300005564 Bacteria 3854
107 Ga0070664_100118419 3300005564 Bacteria 2317
108 Ga0070664_100175917 3300005564 Bacteria 1900
109 Ga0070664_100215493 3300005564 Bacteria 1716
110 Ga0070664_100344272 3300005564 Bacteria 1355
111 Ga0068857_100017687 3300005577 Bacteria 6251
112 Ga0068857_100038562 3300005577 Bacteria 4231
113 Ga0068857_100046023 3300005577 Bacteria 3871
114 Ga0068857_100123218 3300005577 Bacteria 2335
115 Ga0068857_100357485 3300005577 Bacteria 1353
116 Ga0068854_100031767 3300005578 Bacteria 3671
117 Ga0068854_100070324 3300005578 Bacteria 2558
118 Ga0068854_100146445 3300005578 Bacteria 1817
119 Ga0068854_100186487 3300005578 Bacteria 1623
120 Ga0068854_100191855 3300005578 Bacteria 1601
121 Ga0068856_100000190 3300005614 Bacteria 64644
122 Ga0068856_100043669 3300005614 Bacteria 4410
123 Ga0068856_100233659 3300005614 Bacteria 1854
124 Ga0068856_100423385 3300005614 Bacteria 1351
125 Ga0068852_100001094 3300005616 Bacteria 17900
126 Ga0068852_100007505 3300005616 Bacteria 7960
127 Ga0068852_100040322 3300005616 Bacteria 3939
128 Ga0068852_100055342 3300005616 Bacteria 3424
129 Ga0068852_100062688 3300005616 Bacteria 3234
130 Ga0068852_100255801 3300005616 Bacteria 1679
131 Ga0068852_100378411 3300005616 Bacteria 1388
132 Ga0068859_100000117 3300005617 Bacteria 75377
133 Ga0068859_100012095 3300005617 Bacteria 8673
134 Ga0068859_100019575 3300005617 Bacteria 6800
135 Ga0068859_100075277 3300005617 Bacteria 3416
136 Ga0068864_100000161 3300005618 Bacteria 62543
137 Ga0068864_100001450 3300005618 Bacteria 19553
138 Ga0068864_100001952 3300005618 Bacteria 16953
139 Ga0068864_100013375 3300005618 Bacteria 6801
140 Ga0068864_100055305 3300005618 Bacteria 3426
141 Ga0068864_100078235 3300005618 Bacteria 2894
142 Ga0068861_100133451 3300005719 Bacteria 2018
143 Ga0068851_10004563 3300005834 Bacteria 6248
144 Ga0068851_10008659 3300005834 Bacteria 4710
145 Ga0068863_100001438 3300005841 Bacteria 23606
146 Ga0068863_100002397 3300005841 Bacteria 18643
147 Ga0068863_100012236 3300005841 Bacteria 8284
148 Ga0068858_100015068 3300005842 Bacteria 7272
149 Ga0068858_100023109 3300005842 Bacteria 5799
150 Ga0068858_100059024 3300005842 Bacteria 3546
151 Ga0068858_100091895 3300005842 Bacteria 2825
152 Ga0068860_100008816 3300005843 Bacteria 10048
153 Ga0068860_100129959 3300005843 Bacteria 2416
154 Ga0068862_100007719 3300005844 Bacteria 8898
155 Ga0068862_100021026 3300005844 Bacteria 5452
156 Ga0070717_10005953 3300006028 Bacteria 8929
157 Ga0097621_100046877 3300006237 Bacteria 3499
158 Ga0097621_100070732 3300006237 Bacteria 2882
159 Ga0097621_100109797 3300006237 Bacteria 2330
160 Ga0068871_100110684 3300006358 Bacteria 2310
161 Ga0075434_100221894 3300006871 Bacteria 1910
162 Ga0097620_100000117 3300006931 Bacteria 75377
163 Ga0097620_100012095 3300006931 Bacteria 8673
164 Ga0097620_100019575 3300006931 Bacteria 6800
165 Ga0097620_100075278 3300006931 Bacteria 3416
166 Ga0105250_10001663 3300009092 Bacteria 11788
167 Ga0105245_10170580 3300009098 Bacteria 2072
168 Ga0105242_10124715 3300009176 Bacteria 2215
169 Ga0105248_10000083 3300009177 Bacteria 110619
170 Ga0105248_10000496 3300009177 Bacteria 44725
171 Ga0105248_10000660 3300009177 Bacteria 39185
172 Ga0105248_10002500 3300009177 Bacteria 20447
173 Ga0105248_10019149 3300009177 Bacteria 7572
174 Ga0105248_10051953 3300009177 Bacteria 4599
175 Ga0105237_10033886 3300009545 Bacteria 5173
176 Ga0105238_10012694 3300009551 Bacteria 8502
177 Ga0105238_10023266 3300009551 Bacteria 6316
178 Ga0105249_10015457 3300009553 Bacteria 6754
179 Ga0105239_10081305 3300010375 Bacteria 3566
180 Ga0105246_10011519 3300011119 Bacteria 5489
181 Ga0157373_10013173 3300013100 Bacteria 6069
182 Ga0157373_10028706 3300013100 Bacteria 4012
183 Ga0157373_10154020 3300013100 Bacteria 1617
184 Ga0157373_10162690 3300013100 Bacteria 1570
185 Ga0157371_10002238 3300013102 Bacteria 18702
186 Ga0157371_10019626 3300013102 Bacteria 4980
187 Ga0157371_10040957 3300013102 Bacteria 3307
188 Ga0157371_10078378 3300013102 Bacteria 2340
189 Ga0157371_10118324 3300013102 Bacteria 1884
190 Ga0157371_10127551 3300013102 Bacteria 1809
191 Ga0157371_10189742 3300013102 Bacteria 1471
192 Ga0157370_10272671 3300013104 Bacteria 1563
193 Ga0157369_10096420 3300013105 Bacteria 3155
194 Ga0157369_10308738 3300013105 Bacteria 1645
195 Ga0157369_10329521 3300013105 Bacteria 1586
196 Ga0157372_10052507 3300013307 Bacteria 4540
197 Ga0157372_10283214 3300013307 Bacteria 1927
198 Ga0157372_10322632 3300013307 Bacteria 1798
199 Ga0157375_10002847 3300013308 Bacteria 14973
200 Ga0157375_10138302 3300013308 Bacteria 2561
201 Ga0157375_10158836 3300013308 Bacteria 2402
202 Ga0163163_10000364 3300014325 Bacteria 43563
203 Ga0182008_10054709 3300014497 Bacteria 1974
204 Ga0157379_10003770 3300014968 Bacteria 12906
205 Ga0157379_10006690 3300014968 Bacteria 9954
206 Ga0163161_10014669 3300017792 Bacteria 5456
207 Ga0206356_10862409 3300020070 Bacteria 2309
208 Ga0206354_11359883 3300020081 Bacteria 1434
209 Ga0207697_10044427 3300025315 Bacteria 1828
210 Ga0207656_10004658 3300025321 Bacteria 4807
211 Ga0207656_10020405 3300025321 Bacteria 2634
212 Ga0207680_10003328 3300025903 Bacteria 7572
213 Ga0207647_10002661 3300025904 Bacteria 13485
214 Ga0207647_10009032 3300025904 Bacteria 7098
215 Ga0207647_10017585 3300025904 Bacteria 4858
216 Ga0207647_10039384 3300025904 Bacteria 2982
217 Ga0207647_10040642 3300025904 Bacteria 2927
218 Ga0207647_10122919 3300025904 Bacteria 1529
219 Ga0207705_10000072 3300025909 Bacteria 126043
220 Ga0207705_10000123 3300025909 Bacteria 85382
221 Ga0207705_10003112 3300025909 Bacteria 12660
222 Ga0207705_10009448 3300025909 Bacteria 7092
223 Ga0207705_10051259 3300025909 Bacteria 2971
224 Ga0207705_10068123 3300025909 Bacteria 2576
225 Ga0207705_10103175 3300025909 Bacteria 2100
226 Ga0207705_10170936 3300025909 Bacteria 1636
227 Ga0207705_10195209 3300025909 Bacteria 1532
228 Ga0207707_10015333 3300025912 Bacteria 6673
229 Ga0207707_10046480 3300025912 Bacteria 3781
230 Ga0207707_10123877 3300025912 Bacteria 2260
231 Ga0207707_10174381 3300025912 Bacteria 1879
232 Ga0207695_10019756 3300025913 Bacteria 7745
233 Ga0207695_10027242 3300025913 Bacteria 6367
234 Ga0207660_10113989 3300025917 Bacteria 2038
235 Ga0207660_10114244 3300025917 Bacteria 2036
236 Ga0207662_10082239 3300025918 Bacteria 1967
237 Ga0207657_10000650 3300025919 Bacteria 36973
238 Ga0207657_10001761 3300025919 Bacteria 23376
239 Ga0207657_10003913 3300025919 Bacteria 15809
240 Ga0207657_10006621 3300025919 Bacteria 11994
241 Ga0207657_10007824 3300025919 Bacteria 10908
242 Ga0207657_10015919 3300025919 Bacteria 7265
243 Ga0207657_10017682 3300025919 Bacteria 6830
244 Ga0207657_10021597 3300025919 Bacteria 6052
245 Ga0207657_10109020 3300025919 Bacteria 2289
246 Ga0207657_10253451 3300025919 Bacteria 1402
247 Ga0207657_10306181 3300025919 Unclassified 1258
248 Ga0207649_10000158 3300025920 Bacteria 55609
249 Ga0207649_10017440 3300025920 Bacteria 4069
250 Ga0207649_10027242 3300025920 Bacteria 3352
251 Ga0207649_10034711 3300025920 Bacteria 3024
252 Ga0207649_10044301 3300025920 Bacteria 2723
253 Ga0207652_10000034 3300025921 Bacteria 138571
254 Ga0207681_10053441 3300025923 Bacteria 2742
255 Ga0207694_10008107 3300025924 Bacteria 7938
256 Ga0207694_10013779 3300025924 Bacteria 6094
257 Ga0207694_10102002 3300025924 Bacteria 2274
258 Ga0207650_10015288 3300025925 Bacteria 5342
259 Ga0207650_10032243 3300025925 Bacteria 3790
260 Ga0207650_10072876 3300025925 Bacteria 2585
261 Ga0207659_10018156 3300025926 Bacteria 4607
262 Ga0207664_10085737 3300025929 Bacteria 2571
263 Ga0207664_10230415 3300025929 Bacteria 1610
264 Ga0207644_10000998 3300025931 Bacteria 18072
265 Ga0207644_10005917 3300025931 Bacteria 7975
266 Ga0207644_10013878 3300025931 Bacteria 5381
267 Ga0207644_10023048 3300025931 Bacteria 4259
268 Ga0207690_10000160 3300025932 Bacteria 52819
269 Ga0207690_10006143 3300025932 Bacteria 7116
270 Ga0207690_10006964 3300025932 Bacteria 6702
271 Ga0207690_10025971 3300025932 Bacteria 3685
272 Ga0207690_10066676 3300025932 Bacteria 2466
273 Ga0207706_10000041 3300025933 Bacteria 130090
274 Ga0207706_10005402 3300025933 Bacteria 11912
275 Ga0207706_10010269 3300025933 Bacteria 8561
276 Ga0207706_10019845 3300025933 Bacteria 6041
277 Ga0207706_10077672 3300025933 Bacteria 2920
278 Ga0207706_10088970 3300025933 Bacteria 2714
279 Ga0207706_10145820 3300025933 Bacteria 2082
280 Ga0207706_10282125 3300025933 Bacteria 1448
281 Ga0207706_10288514 3300025933 Bacteria 1431
282 Ga0207669_10112946 3300025937 Bacteria 1825
283 Ga0207691_10021755 3300025940 Bacteria 6054
284 Ga0207691_10063191 3300025940 Bacteria 3358
285 Ga0207711_10000039 3300025941 Bacteria 162974
286 Ga0207711_10001588 3300025941 Bacteria 20991
287 Ga0207711_10003234 3300025941 Bacteria 14200
288 Ga0207711_10004366 3300025941 Bacteria 12068
289 Ga0207711_10005331 3300025941 Bacteria 10903
290 Ga0207711_10175625 3300025941 Bacteria 1946
291 Ga0207689_10049154 3300025942 Bacteria 3479
292 Ga0207661_10003009 3300025944 Bacteria 11657
293 Ga0207661_10056868 3300025944 Bacteria 3142
294 Ga0207661_10163328 3300025944 Bacteria 1933
295 Ga0207679_10007359 3300025945 Bacteria 6981
296 Ga0207679_10013419 3300025945 Bacteria 5372
297 Ga0207679_10050096 3300025945 Bacteria 3050
298 Ga0207679_10079994 3300025945 Bacteria 2494
299 Ga0207679_10388431 3300025945 Bacteria 1225
300 Ga0207667_10001389 3300025949 Bacteria 30363
301 Ga0207667_10018263 3300025949 Bacteria 7871
302 Ga0207667_10021914 3300025949 Bacteria 7072
303 Ga0207667_10036894 3300025949 Bacteria 5232
304 Ga0207667_10041224 3300025949 Bacteria 4911
305 Ga0207667_10088407 3300025949 Bacteria 3205
306 Ga0207667_10133092 3300025949 Bacteria 2561
307 Ga0207667_10160072 3300025949 Bacteria 2316
308 Ga0207667_10255147 3300025949 Bacteria 1794
309 Ga0207667_10372270 3300025949 Bacteria 1456
310 Ga0207651_10129127 3300025960 Bacteria 1931
311 Ga0207712_10002789 3300025961 Bacteria 11176
312 Ga0207668_10032613 3300025972 Bacteria 3444
313 Ga0207640_10054024 3300025981 Bacteria 2624
314 Ga0207640_10099264 3300025981 Bacteria 2037
315 Ga0207640_10175525 3300025981 Bacteria 1601
316 Ga0207658_10004949 3300025986 Bacteria 9189
317 Ga0207658_10009516 3300025986 Bacteria 6597
318 Ga0207658_10054410 3300025986 Bacteria 2961
319 Ga0207658_10057665 3300025986 Bacteria 2887
320 Ga0207658_10152590 3300025986 Bacteria 1884
321 Ga0207658_10204392 3300025986 Bacteria 1651
322 Ga0207658_10267662 3300025986 Bacteria 1459
323 Ga0207703_10004446 3300026035 Bacteria 11517
324 Ga0207703_10005412 3300026035 Bacteria 10275
325 Ga0207639_10000074 3300026041 Bacteria 91671
326 Ga0207639_10000533 3300026041 Bacteria 26188
327 Ga0207639_10012656 3300026041 Bacteria 5882
328 Ga0207639_10139453 3300026041 Bacteria 2018
329 Ga0207639_10146302 3300026041 Bacteria 1974
330 Ga0207678_10003275 3300026067 Bacteria 14617
331 Ga0207678_10004945 3300026067 Bacteria 11961
332 Ga0207678_10015579 3300026067 Bacteria 6684
333 Ga0207678_10018913 3300026067 Bacteria 6053
334 Ga0207678_10020343 3300026067 Bacteria 5823
335 Ga0207678_10025008 3300026067 Bacteria 5214
336 Ga0207678_10121721 3300026067 Bacteria 2227
337 Ga0207678_10195686 3300026067 Bacteria 1728
338 Ga0207678_10207561 3300026067 Bacteria 1676
339 Ga0207702_10000444 3300026078 Bacteria 46851
340 Ga0207702_10018250 3300026078 Bacteria 5803
341 Ga0207702_10018623 3300026078 Bacteria 5745
342 Ga0207702_10152867 3300026078 Bacteria 2101
343 Ga0207702_10248844 3300026078 Bacteria 1668
344 Ga0207641_10000185 3300026088 Bacteria 86885
345 Ga0207641_10044991 3300026088 Bacteria 3714
346 Ga0207641_10102449 3300026088 Bacteria 2524
347 Ga0207641_10112748 3300026088 Bacteria 2413
348 Ga0207676_10000253 3300026095 Bacteria 46261
349 Ga0207676_10000531 3300026095 Bacteria 31982
350 Ga0207676_10001909 3300026095 Bacteria 15221
351 Ga0207676_10075094 3300026095 Bacteria 2725
352 Ga0207676_10187357 3300026095 Bacteria 1818
353 Ga0207674_10000660 3300026116 Bacteria 44851
354 Ga0207674_10009133 3300026116 Bacteria 11375
355 Ga0207674_10009571 3300026116 Bacteria 11056
356 Ga0207674_10009795 3300026116 Bacteria 10913
357 Ga0207674_10016191 3300026116 Bacteria 8166
358 Ga0207674_10024503 3300026116 Bacteria 6447
359 Ga0207674_10025828 3300026116 Bacteria 6253
360 Ga0207675_100435906 3300026118 Bacteria 1296
361 Ga0207698_10002501 3300026142 Bacteria 10908
362 Ga0207698_10027421 3300026142 Bacteria 4043
363 Ga0207698_10044704 3300026142 Bacteria 3331
364 Ga0207698_10098688 3300026142 Bacteria 2414
365 Ga0207698_10190934 3300026142 Bacteria 1824
366 Ga0207698_10408745 3300026142 Unclassified 1299
367 Ga0209983_1002927 3300027665 Bacteria 3689
368 Ga0209974_10008028 3300027876 Bacteria 3617
369 Ga0268266_10008245 3300028379 Bacteria 9286
370 Ga0268265_10001273 3300028380 Bacteria 21747
371 Ga0268265_10009142 3300028380 Bacteria 6696
372 Ga0268265_10011171 3300028380 Bacteria 6068
373 Ga0268264_10001705 3300028381 Bacteria 20255
374 Ga0307408_100197085 3300031548 Bacteria 1627
375 Ga0307405_10014612 3300031731 Bacteria 4228
376 Ga0307405_10016561 3300031731 Bacteria 4022
377 Ga0307405_10139047 3300031731 Bacteria 1690
378 Ga0307413_10005619 3300031824 Bacteria 5620
379 Ga0307413_10013310 3300031824 Bacteria 4130
380 Ga0307413_10024423 3300031824 Bacteria 3295
381 Ga0307413_10037105 3300031824 Bacteria 2812
382 Ga0307413_10095487 3300031824 Bacteria 1949
383 Ga0307410_10014986 3300031852 Bacteria 4583
384 Ga0307410_10025503 3300031852 Bacteria 3710
385 Ga0307410_10034043 3300031852 Bacteria 3295
386 Ga0307410_10035299 3300031852 Bacteria 3246
387 Ga0307410_10063634 3300031852 Bacteria 2531
388 Ga0307410_10154655 3300031852 Bacteria 1711
389 Ga0307406_10006284 3300031901 Bacteria 6547
390 Ga0307407_10026078 3300031903 Bacteria 3090
391 Ga0307407_10036229 3300031903 Bacteria 2717
392 Ga0307412_10025110 3300031911 Bacteria 3686
393 Ga0307412_10030660 3300031911 Bacteria 3389
394 Ga0307409_100266830 3300031995 Bacteria 1574
395 Ga0307416_100002746 3300032002 Bacteria 10214
396 Ga0307416_100017277 3300032002 Bacteria 5041
397 Ga0307416_100049966 3300032002 Bacteria 3329
398 Ga0307416_100050275 3300032002 Bacteria 3322
399 Ga0307416_100106830 3300032002 Bacteria 2455
400 Ga0307414_10005561 3300032004 Bacteria 6951
401 Ga0307414_10018974 3300032004 Bacteria 4251
402 Ga0307414_10020384 3300032004 Bacteria 4132
403 Ga0307414_10026348 3300032004 Bacteria 3741
404 Ga0307414_10028842 3300032004 Bacteria 3604
405 Ga0307414_10040433 3300032004 Bacteria 3150
406 Ga0307414_10226292 3300032004 Bacteria 1539
407 Ga0307411_10001715 3300032005 Bacteria 9204
408 Ga0307411_10015233 3300032005 Bacteria 4312
409 Ga0307411_10050764 3300032005 Bacteria 2703
410 Ga0307415_100027817 3300032126 Bacteria 3588
411 Ga0307415_100080401 3300032126 Bacteria 2325
412 Ga0307415_100284535 3300032126 Bacteria 1361
413 Ga0373954_0013206 3300035118 Bacteria 3678
414 Ga0373943_0016633 3300035170 Bacteria 3356
415 Ga0373962_0022794 3300035242 Bacteria 1663
416 Ga0373935_0018990 3300035692 Bacteria 4191
417 Ga0373927_0017611 3300035695 Bacteria 4701
418 Ga0373933_0056784 3300035724 Bacteria 2351
419 Ga0373947_0011601 3300035725 Bacteria 5056
420 Ga0373937_0003627 3300036401 Bacteria 13023
421 Ga0395899_0001745 3300037312 Bacteria 18084
422 Ga0395899_0009970 3300037312 Bacteria 7286
423 Ga0395899_0020860 3300037312 Bacteria 4969
424 Ga0395899_0032253 3300037312 Bacteria 3936
425 Ga0395899_0077718 3300037312 Bacteria 2420
426 Ga0395899_0086394 3300037312 Bacteria 2278
427 Ga0395899_0097352 3300037312 Bacteria 2127
428 Ga0395899_0118899 3300037312 Bacteria 1895
429 Ga0395900_0001256 3300037418 Bacteria 31067
430 Ga0395900_0012634 3300037418 Bacteria 8634
431 Ga0395900_0019379 3300037418 Bacteria 6938
432 Ga0395900_0027008 3300037418 Bacteria 5877
433 Ga0395900_0033179 3300037418 Bacteria 5313
434 Ga0395900_0048282 3300037418 Bacteria 4385
435 Ga0395900_0076375 3300037418 Bacteria 3443
436 Ga0395900_0077138 3300037418 Bacteria 3423
437 Ga0395900_0099185 3300037418 Bacteria 2992
438 Ga0395900_0105886 3300037418 Bacteria 2889
439 Ga0395900_0204280 3300037418 Bacteria 1997
440 Ga0395900_0365494 3300037418 Bacteria 1413
441 Ga0395900_0374693 3300037418 Bacteria 1392
442 Ga0395900_0394036 3300037418 Bacteria 1350
443 Ga0395900_0495657 3300037418 Bacteria 1172
444 Ga0395898_0006840 3300037466 Bacteria 12125
445 Ga0395898_0039260 3300037466 Bacteria 4686
446 Ga0395898_0180500 3300037466 Bacteria 2018
447 Ga0395898_0209895 3300037466 Bacteria 1857
448 Ga0395905_0000610 3300037471 Bacteria 47892
449 Ga0395905_0005968 3300037471 Bacteria 12337
450 Ga0395905_0011035 3300037471 Bacteria 8743
451 Ga0395905_0031249 3300037471 Bacteria 5014
452 Ga0395905_0036513 3300037471 Bacteria 4616
453 Ga0395905_0048149 3300037471 Bacteria 3995
454 Ga0395905_0049125 3300037471 Bacteria 3953
455 Ga0395905_0051022 3300037471 Bacteria 3874
456 Ga0395905_0051592 3300037471 Bacteria 3853
457 Ga0395905_0051704 3300037471 Bacteria 3848
458 Ga0395905_0075070 3300037471 Bacteria 3168
459 Ga0395905_0129480 3300037471 Bacteria 2373
460 Ga0395905_0139508 3300037471 Bacteria 2281
461 Ga0395905_0171640 3300037471 Bacteria 2037
462 Ga0395905_0172734 3300037471 Bacteria 2030
463 Ga0395905_0216860 3300037471 Bacteria 1792
464 Ga0436364_1351497 3300037853 Bacteria 37033
465 Ga0395901_0000375 3300038443 Bacteria 53750
466 Ga0395901_0004565 3300038443 Bacteria 13977
467 Ga0395901_0022105 3300038443 Bacteria 6516
468 Ga0395901_0030699 3300038443 Bacteria 5537
469 Ga0395901_0031656 3300038443 Bacteria 5453
470 Ga0395901_0037872 3300038443 Bacteria 4987
471 Ga0395901_0055408 3300038443 Bacteria 4123
472 Ga0395901_0100403 3300038443 Bacteria 3035
473 Ga0395901_0112392 3300038443 Bacteria 2860
474 Ga0395901_0135501 3300038443 Bacteria 2588
475 Ga0395901_0139086 3300038443 Bacteria 2552
476 Ga0395901_0190459 3300038443 Bacteria 2151
477 Ga0439445_0000426 3300042004 Bacteria 8487
478 Ga0439432_012609 3300042006 Bacteria 2889
479 Ga0439449_0027027 3300042007 Bacteria 2142
480 Ga0466969_0013700 3300044656 Bacteria 4268
481 Ga0466965_0074570 3300044683 Bacteria 1710
482 Ga0466966_0010189 3300044684 Bacteria 6235
483 Ga0466966_0066305 3300044684 Bacteria 2269
484 Ga0466966_0199044 3300044684 Bacteria 1212
485 Ga0466961_0004585 3300044693 Bacteria 8678
486 Ga0466961_0014580 3300044693 Bacteria 5050
487 Ga0466961_0039945 3300044693 Bacteria 3007
488 Ga0466961_0117941 3300044693 Bacteria 1667
489 Ga0466961_0133576 3300044693 Bacteria 1555
490 Ga0466963_0008467 3300044694 Bacteria 6164
491 Ga0466963_0015497 3300044694 Bacteria 4723
492 Ga0466963_0054773 3300044694 Bacteria 2652
493 Ga0466963_0076562 3300044694 Bacteria 2259
494 Ga0466963_0094395 3300044694 Bacteria 2040
495 Ga0466971_0008837 3300044719 Bacteria 4398
496 Ga0466971_0033337 3300044719 Bacteria 2308
497 Ga0466971_0116241 3300044719 Bacteria 1236
498 Ga0466968_0055251 3300044735 Bacteria 1703
499 Ga0466970_0007423 3300044765 Bacteria 5494
500 Ga0466970_0033484 3300044765 Bacteria 2716
501 Ga0466970_0050790 3300044765 Bacteria 2212
502 Ga0466970_0058687 3300044765 Bacteria 2060
503 Ga0466970_0065838 3300044765 Bacteria 1945
504 Ga0466957_0008328 3300044842 Bacteria 5895
505 Ga0466957_0016128 3300044842 Bacteria 4367
506 Ga0466957_0017877 3300044842 Bacteria 4159
507 Ga0466957_0051930 3300044842 Bacteria 2495
508 Ga0466957_0059766 3300044842 Bacteria 2337
509 Ga0466960_0010721 3300044901 Bacteria 3813
510 Ga0466959_0122416 3300045049 Bacteria 1848
511 Ga0466959_0134007 3300045049 Bacteria 1754
512 Ga0466958_0003925 3300045836 Bacteria 7796
513 Ga0466958_0011303 3300045836 Bacteria 5026
514 Ga0466967_0003504 3300045976 Bacteria 10254
515 Ga0466967_0030324 3300045976 Bacteria 4537
516 Ga0466967_0144779 3300045976 Bacteria 2216
517 Ga0466967_0145978 3300045976 Bacteria 2207
518 Ga0466967_0239230 3300045976 Bacteria 1731
519 Ga0466967_0324664 3300045976 Bacteria 1485
520 Ga0495643_0028273 3300046522 Bacteria 3145
521 Ga0495621_0002359 3300046539 Bacteria 5077
522 Ga0495633_0063606 3300046558 Bacteria 1726
523 Ga0495669_0008359 3300046684 Bacteria 4351
524 Ga0495602_0062853 3300048088 Bacteria 3220
525 Ga0496101_0005871 3300048904 Bacteria 7861
526 Ga0496102_0032961 3300048905 Bacteria 4655
527 Ga0496103_0045499 3300048906 Bacteria 2708
528 Ga0496106_0005506 3300048909 Bacteria 9363
529 Ga0496107_0002278 3300048910 Bacteria 12386
530 Ga0496107_0060991 3300048910 Bacteria 2730
531 Ga0496108_0013638 3300048911 Bacteria 6634
532 Ga0496108_0014831 3300048911 Bacteria 6358
533 Ga0496108_0031978 3300048911 Bacteria 4367
534 Ga0496109_0000995 3300048912 Bacteria 23386
535 Ga0496109_0019207 3300048912 Bacteria 6020
536 Ga0496109_0035321 3300048912 Bacteria 4508
537 Ga0496109_0068082 3300048912 Bacteria 3263
538 Ga0496110_0004340 3300048913 Bacteria 10977
539 Ga0496110_0062646 3300048913 Bacteria 3285
540 Ga0496111_0018154 3300048914 Bacteria 4870
541 Ga0496111_0031803 3300048914 Bacteria 3760
542 Ga0496111_0189661 3300048914 Bacteria 1528
543 Ga0496112_0006596 3300048915 Bacteria 10213
544 Ga0496112_0021033 3300048915 Bacteria 6197
545 Ga0496112_0023280 3300048915 Bacteria 5915
546 Ga0496112_0208212 3300048915 Bacteria 1913
547 Ga0496113_0001781 3300048916 Bacteria 12223
548 Ga0496113_0017245 3300048916 Bacteria 5008
549 Ga0496113_0070772 3300048916 Bacteria 2652
550 Ga0496114_0000016 3300048917 Bacteria 274656
551 Ga0496114_0215047 3300048917 Bacteria 1686
552 nmdc:mga0rr50_299652_c1 3300050513 Bacteria 1344
553 nmdc:mga0a205_37225_c1 3300050515 Bacteria 4679
554 Ga0500658_0000247 3300053134 Bacteria 25342
555 Ga0466962_0008284 3300061719 Bacteria 4981
556 Ga0466962_0037107 3300061719 Bacteria 2333
557 Ga0466962_0044085 3300061719 Bacteria 2134

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_100357485 Ga0068857_1003574852 345
2 3300026116 Ga0207674_10009795 Ga0207674_100097958 345
3 3300037471 Ga0395905_0216860 Ga0395905_0216860_61_1167 345
4 3300027665 Ga0209983_1002927 Ga0209983_10029272 346
5 3300037418 Ga0395900_0495657 Ga0395900_0495657_62_1135 346
6 3300013102 Ga0157371_10040957 Ga0157371_100409572 347
7 3300026095 Ga0207676_10000253 Ga0207676_1000025340 347
8 3300005356 Ga0070674_100157500 Ga0070674_1001575001 348
9 3300005618 Ga0068864_100055305 Ga0068864_1000553053 348
10 3300013308 Ga0157375_10002847 Ga0157375_100028471 348
11 3300025904 Ga0207647_10039384 Ga0207647_100393844 348
12 3300025909 Ga0207705_10170936 Ga0207705_101709362 348
13 3300025929 Ga0207664_10085737 Ga0207664_100857372 348
14 3300025937 Ga0207669_10112946 Ga0207669_101129462 348
15 3300025981 Ga0207640_10099264 Ga0207640_100992642 348
16 3300026116 Ga0207674_10009571 Ga0207674_100095716 348
17 3300044684 Ga0466966_0199044 Ga0466966_0199044_24_1160 348
18 3300044694 Ga0466963_0008467 Ga0466963_0008467_2451_3578 348
19 3300044719 Ga0466971_0116241 Ga0466971_0116241_81_1208 348
20 3300044765 Ga0466970_0050790 Ga0466970_0050790_78_1205 348
21 3300046522 Ga0495643_0028273 Ga0495643_0028273_167_1306 348
22 3300048912 Ga0496109_0068082 Ga0496109_0068082_1544_2707 348
23 3300048914 Ga0496111_0189661 Ga0496111_0189661_75_1238 348
24 3300005339 Ga0070660_100056520 Ga0070660_1000565201 349
25 3300013102 Ga0157371_10019626 Ga0157371_100196265 349
26 3300027876 Ga0209974_10008028 Ga0209974_100080285 349
27 3300031824 Ga0307413_10013310 Ga0307413_100133104 349
28 3300031852 Ga0307410_10025503 Ga0307410_100255035 349
29 3300031901 Ga0307406_10006284 Ga0307406_100062845 349
30 3300032002 Ga0307416_100049966 Ga0307416_1000499665 349
31 3300032002 Ga0307416_100050275 Ga0307416_1000502753 349
32 3300032004 Ga0307414_10018974 Ga0307414_100189742 349
33 3300032004 Ga0307414_10020384 Ga0307414_100203845 349
34 3300032004 Ga0307414_10226292 Ga0307414_102262923 349
35 3300035724 Ga0373933_0056784 Ga0373933_0056784_21_1118 349
36 3300037418 Ga0395900_0204280 Ga0395900_0204280_454_1584 349
37 3300037471 Ga0395905_0011035 Ga0395905_0011035_1474_2604 349
38 3300038443 Ga0395901_0004565 Ga0395901_0004565_7500_8630 349
39 3300025315 Ga0207697_10044427 Ga0207697_100444272 350
40 3300025917 Ga0207660_10114244 Ga0207660_101142442 350
41 3300031731 Ga0307405_10139047 Ga0307405_101390472 350
42 3300031824 Ga0307413_10005619 Ga0307413_100056195 350
43 3300031995 Ga0307409_100266830 Ga0307409_1002668302 350
44 3300032126 Ga0307415_100027817 Ga0307415_1000278175 350
45 3300037312 Ga0395899_0097352 Ga0395899_0097352_400_1578 350
46 3300037312 Ga0395899_0118899 Ga0395899_0118899_371_1519 350
47 3300037466 Ga0395898_0180500 Ga0395898_0180500_10_1158 350
48 3300037471 Ga0395905_0005968 Ga0395905_0005968_6951_8099 350
49 3300044694 Ga0466963_0076562 Ga0466963_0076562_784_1911 350
50 3300044842 Ga0466957_0017877 Ga0466957_0017877_1862_3007 350
51 3300045836 Ga0466958_0011303 Ga0466958_0011303_3414_4559 350
52 3300045976 Ga0466967_0239230 Ga0466967_0239230_110_1252 350
53 iso_pu_bacteria 2885427238 2885427278 350
54 3300005331 Ga0070670_100005424 Ga0070670_10000542413 351
55 3300005353 Ga0070669_100047193 Ga0070669_1000471931 351
56 3300005719 Ga0068861_100133451 Ga0068861_1001334511 351
57 3300026118 Ga0207675_100435906 Ga0207675_1004359061 351
58 3300031852 Ga0307410_10063634 Ga0307410_100636343 351
59 3300031911 Ga0307412_10030660 Ga0307412_100306605 351
60 3300037312 Ga0395899_0077718 Ga0395899_0077718_733_1875 351
61 3300037418 Ga0395900_0033179 Ga0395900_0033179_2497_3657 351
62 3300037418 Ga0395900_0394036 Ga0395900_0394036_181_1323 351
63 3300038443 Ga0395901_0139086 Ga0395901_0139086_893_2053 351
64 3300050513 nmdc:mga0rr50_299652_c1 nmdc:mga0rr50_299652_c1_240_1331 351
65 3300005327 Ga0070658_10192127 Ga0070658_101921271 352
66 3300005339 Ga0070660_100004190 Ga0070660_10000419010 352
67 3300005344 Ga0070661_100029761 Ga0070661_1000297612 352
68 3300005366 Ga0070659_100181872 Ga0070659_1001818722 352
69 3300005366 Ga0070659_100219832 Ga0070659_1002198321 352
70 3300005366 Ga0070659_100315748 Ga0070659_1003157482 352
71 3300005458 Ga0070681_10063288 Ga0070681_100632883 352
72 3300005530 Ga0070679_100028567 Ga0070679_1000285673 352
73 3300005539 Ga0068853_100010276 Ga0068853_1000102765 352
74 3300005563 Ga0068855_100061554 Ga0068855_1000615545 352
75 3300005577 Ga0068857_100017687 Ga0068857_1000176876 352
76 3300005578 Ga0068854_100070324 Ga0068854_1000703242 352
77 3300005578 Ga0068854_100186487 Ga0068854_1001864872 352
78 3300005614 Ga0068856_100423385 Ga0068856_1004233852 352
79 3300005616 Ga0068852_100062688 Ga0068852_1000626884 352
80 3300025904 Ga0207647_10017585 Ga0207647_100175856 352
81 3300025909 Ga0207705_10051259 Ga0207705_100512592 352
82 3300025909 Ga0207705_10195209 Ga0207705_101952092 352
83 3300025912 Ga0207707_10046480 Ga0207707_100464803 352
84 3300025913 Ga0207695_10027242 Ga0207695_100272426 352
85 3300025919 Ga0207657_10006621 Ga0207657_100066216 352
86 3300025919 Ga0207657_10253451 Ga0207657_102534512 352
87 3300025924 Ga0207694_10008107 Ga0207694_100081074 352
88 3300025944 Ga0207661_10056868 Ga0207661_100568685 352
89 3300025949 Ga0207667_10041224 Ga0207667_100412243 352
90 3300026041 Ga0207639_10000074 Ga0207639_1000007418 352
91 3300026116 Ga0207674_10016191 Ga0207674_100161914 352
92 3300026142 Ga0207698_10044704 Ga0207698_100447044 352
93 3300031824 Ga0307413_10037105 Ga0307413_100371053 352
94 3300031852 Ga0307410_10014986 Ga0307410_100149862 352
95 3300031903 Ga0307407_10026078 Ga0307407_100260783 352
96 3300032004 Ga0307414_10026348 Ga0307414_100263483 352
97 3300032005 Ga0307411_10001715 Ga0307411_100017158 352
98 3300037418 Ga0395900_0048282 Ga0395900_0048282_328_1461 352
99 3300037471 Ga0395905_0171640 Ga0395905_0171640_618_1751 352
100 3300037471 Ga0395905_0172734 Ga0395905_0172734_842_1981 352
101 3300038443 Ga0395901_0031656 Ga0395901_0031656_889_2022 352
102 3300044901 Ga0466960_0010721 Ga0466960_0010721_1547_2692 352
103 3300005331 Ga0070670_100005656 Ga0070670_1000056562 353
104 3300005355 Ga0070671_100039172 Ga0070671_1000391724 353
105 3300005367 Ga0070667_100010989 Ga0070667_1000109893 353
106 3300005367 Ga0070667_100037919 Ga0070667_1000379193 353
107 3300005367 Ga0070667_100201129 Ga0070667_1002011291 353
108 3300005455 Ga0070663_100135224 Ga0070663_1001352243 353
109 3300005457 Ga0070662_100113147 Ga0070662_1001131472 353
110 3300005617 Ga0068859_100000117 Ga0068859_10000011757 353
111 3300005618 Ga0068864_100000161 Ga0068864_10000016135 353
112 3300005841 Ga0068863_100001438 Ga0068863_10000143828 353
113 3300005842 Ga0068858_100023109 Ga0068858_1000231095 353
114 3300005843 Ga0068860_100008816 Ga0068860_1000088168 353
115 3300005844 Ga0068862_100021026 Ga0068862_1000210263 353
116 3300006931 Ga0097620_100000117 Ga0097620_10000011757 353
117 3300009092 Ga0105250_10001663 Ga0105250_100016635 353
118 3300009177 Ga0105248_10000496 Ga0105248_1000049620 353
119 3300009177 Ga0105248_10019149 Ga0105248_100191497 353
120 3300013308 Ga0157375_10138302 Ga0157375_101383022 353
121 3300014968 Ga0157379_10006690 Ga0157379_100066907 353
122 3300025919 Ga0207657_10109020 Ga0207657_101090204 353
123 3300025929 Ga0207664_10230415 Ga0207664_102304153 353
124 3300025931 Ga0207644_10005917 Ga0207644_100059173 353
125 3300025933 Ga0207706_10019845 Ga0207706_100198455 353
126 3300025941 Ga0207711_10000039 Ga0207711_1000003950 353
127 3300025941 Ga0207711_10003234 Ga0207711_100032348 353
128 3300025945 Ga0207679_10388431 Ga0207679_103884311 353
129 3300025949 Ga0207667_10372270 Ga0207667_103722702 353
130 3300025981 Ga0207640_10175525 Ga0207640_101755253 353
131 3300025986 Ga0207658_10004949 Ga0207658_100049497 353
132 3300025986 Ga0207658_10054410 Ga0207658_100544103 353
133 3300025986 Ga0207658_10057665 Ga0207658_100576652 353
134 3300026035 Ga0207703_10005412 Ga0207703_1000541210 353
135 3300026067 Ga0207678_10018913 Ga0207678_100189132 353
136 3300026088 Ga0207641_10000185 Ga0207641_1000018541 353
137 3300026088 Ga0207641_10102449 Ga0207641_101024493 353
138 3300026095 Ga0207676_10000531 Ga0207676_100005314 353
139 3300028380 Ga0268265_10011171 Ga0268265_100111715 353
140 3300028381 Ga0268264_10001705 Ga0268264_100017053 353
141 3300031852 Ga0307410_10035299 Ga0307410_100352992 353
142 3300032002 Ga0307416_100017277 Ga0307416_1000172777 353
143 3300032004 Ga0307414_10005561 Ga0307414_100055617 353
144 3300032004 Ga0307414_10028842 Ga0307414_100288422 353
145 3300037312 Ga0395899_0009970 Ga0395899_0009970_3704_4825 353
146 3300037418 Ga0395900_0374693 Ga0395900_0374693_222_1343 353
147 3300037466 Ga0395898_0006840 Ga0395898_0006840_8766_9887 353
148 3300037471 Ga0395905_0048149 Ga0395905_0048149_471_1592 353
149 3300037471 Ga0395905_0049125 Ga0395905_0049125_321_1481 353
150 3300037471 Ga0395905_0129480 Ga0395905_0129480_114_1265 353
151 3300038443 Ga0395901_0000375 Ga0395901_0000375_7142_8347 353
152 3300038443 Ga0395901_0112392 Ga0395901_0112392_317_1468 353
153 3300038443 Ga0395901_0135501 Ga0395901_0135501_1251_2372 353
154 3300042004 Ga0439445_0000426 Ga0439445_0000426_987_2132 353
155 3300044693 Ga0466961_0004585 Ga0466961_0004585_499_1719 353
156 3300044693 Ga0466961_0039945 Ga0466961_0039945_941_2101 353
157 3300044694 Ga0466963_0094395 Ga0466963_0094395_551_1684 353
158 3300044719 Ga0466971_0008837 Ga0466971_0008837_826_1986 353
159 3300044842 Ga0466957_0008328 Ga0466957_0008328_1626_2786 353
160 3300044842 Ga0466957_0059766 Ga0466957_0059766_384_1511 353
161 3300045836 Ga0466958_0003925 Ga0466958_0003925_3439_4599 353
162 3300045976 Ga0466967_0030324 Ga0466967_0030324_270_1397 353
163 3300045976 Ga0466967_0144779 Ga0466967_0144779_661_1794 353
164 3300045976 Ga0466967_0145978 Ga0466967_0145978_675_1835 353
165 3300046539 Ga0495621_0002359 Ga0495621_0002359_2001_3149 353
166 3300046558 Ga0495633_0063606 Ga0495633_0063606_133_1281 353
167 3300053134 Ga0500658_0000247 Ga0500658_0000247_965_2071 353
168 3300061719 Ga0466962_0008284 Ga0466962_0008284_307_1467 353
169 3300005347 Ga0070668_100122418 Ga0070668_1001224181 354
170 3300005530 Ga0070679_100352352 Ga0070679_1003523521 354
171 3300005841 Ga0068863_100012236 Ga0068863_1000122369 354
172 3300005844 Ga0068862_100007719 Ga0068862_1000077196 354
173 3300006237 Ga0097621_100046877 Ga0097621_1000468775 354
174 3300013102 Ga0157371_10127551 Ga0157371_101275512 354
175 3300013104 Ga0157370_10272671 Ga0157370_102726712 354
176 3300013105 Ga0157369_10329521 Ga0157369_103295211 354
177 3300017792 Ga0163161_10014669 Ga0163161_100146696 354
178 3300025972 Ga0207668_10032613 Ga0207668_100326132 354
179 3300025986 Ga0207658_10267662 Ga0207658_102676622 354
180 3300026067 Ga0207678_10195686 Ga0207678_101956862 354
181 3300026088 Ga0207641_10112748 Ga0207641_101127483 354
182 3300028380 Ga0268265_10001273 Ga0268265_1000127316 354
183 3300031548 Ga0307408_100197085 Ga0307408_1001970852 354
184 3300031824 Ga0307413_10095487 Ga0307413_100954872 354
185 3300032004 Ga0307414_10040433 Ga0307414_100404334 354
186 3300035118 Ga0373954_0013206 Ga0373954_0013206_2492_3655 354
187 3300036401 Ga0373937_0003627 Ga0373937_0003627_6067_7230 354
188 3300037312 Ga0395899_0020860 Ga0395899_0020860_3035_4192 354
189 3300037312 Ga0395899_0032253 Ga0395899_0032253_2581_3738 354
190 3300037418 Ga0395900_0105886 Ga0395900_0105886_113_1252 354
191 3300037418 Ga0395900_0365494 Ga0395900_0365494_67_1224 354
192 3300037471 Ga0395905_0051592 Ga0395905_0051592_2524_3663 354
193 3300037471 Ga0395905_0075070 Ga0395905_0075070_323_1480 354
194 3300038443 Ga0395901_0030699 Ga0395901_0030699_3721_4878 354
195 3300038443 Ga0395901_0100403 Ga0395901_0100403_1689_2846 354
196 3300048088 Ga0495602_0062853 Ga0495602_0062853_1909_3072 354
197 3300048917 Ga0496114_0215047 Ga0496114_0215047_106_1359 354
198 3300003323 rootH1_10196665 rootH1_101966651 355
199 3300005327 Ga0070658_10195742 Ga0070658_101957421 355
200 3300005329 Ga0070683_100060909 Ga0070683_1000609096 355
201 3300005339 Ga0070660_100317432 Ga0070660_1003174321 355
202 3300005344 Ga0070661_100042178 Ga0070661_1000421783 355
203 3300005344 Ga0070661_100285901 Ga0070661_1002859011 355
204 3300005435 Ga0070714_100022207 Ga0070714_1000222078 355
205 3300005535 Ga0070684_100003373 Ga0070684_1000033732 355
206 3300005539 Ga0068853_100065209 Ga0068853_1000652094 355
207 3300005563 Ga0068855_100468006 Ga0068855_1004680062 355
208 3300005564 Ga0070664_100015505 Ga0070664_1000155052 355
209 3300005564 Ga0070664_100042127 Ga0070664_1000421272 355
210 3300005577 Ga0068857_100046023 Ga0068857_1000460232 355
211 3300005578 Ga0068854_100191855 Ga0068854_1001918552 355
212 3300005616 Ga0068852_100255801 Ga0068852_1002558012 355
213 3300006237 Ga0097621_100109797 Ga0097621_1001097972 355
214 3300006358 Ga0068871_100110684 Ga0068871_1001106843 355
215 3300006871 Ga0075434_100221894 Ga0075434_1002218942 355
216 3300013100 Ga0157373_10162690 Ga0157373_101626901 355
217 3300013102 Ga0157371_10078378 Ga0157371_100783782 355
218 3300013307 Ga0157372_10283214 Ga0157372_102832141 355
219 3300013307 Ga0157372_10322632 Ga0157372_103226322 355
220 3300025919 Ga0207657_10306181 Ga0207657_103061811 355
221 3300025932 Ga0207690_10025971 Ga0207690_100259711 355
222 3300025944 Ga0207661_10163328 Ga0207661_101633282 355
223 3300025949 Ga0207667_10255147 Ga0207667_102551472 355
224 3300026067 Ga0207678_10015579 Ga0207678_100155792 355
225 3300026078 Ga0207702_10248844 Ga0207702_102488442 355
226 3300026116 Ga0207674_10009133 Ga0207674_100091332 355
227 3300026142 Ga0207698_10408745 Ga0207698_104087451 355
228 3300035170 Ga0373943_0016633 Ga0373943_0016633_2070_3239 355
229 3300035692 Ga0373935_0018990 Ga0373935_0018990_132_1301 355
230 3300035695 Ga0373927_0017611 Ga0373927_0017611_1099_2268 355
231 3300035725 Ga0373947_0011601 Ga0373947_0011601_1557_2726 355
232 3300037418 Ga0395900_0077138 Ga0395900_0077138_1227_2378 355
233 3300044683 Ga0466965_0074570 Ga0466965_0074570_125_1240 355
234 3300044719 Ga0466971_0033337 Ga0466971_0033337_309_1481 355
235 3300048917 Ga0496114_0000016 Ga0496114_0000016_262273_263415 355
236 3300001979 JGI24740J21852_10028613 JGI24740J21852_100286132 356
237 3300001990 JGI24737J22298_10041272 JGI24737J22298_100412722 356
238 3300005327 Ga0070658_10092437 Ga0070658_100924372 356
239 3300005329 Ga0070683_100004824 Ga0070683_1000048244 356
240 3300005331 Ga0070670_100016978 Ga0070670_1000169782 356
241 3300005331 Ga0070670_100021956 Ga0070670_1000219565 356
242 3300005336 Ga0070680_100002845 Ga0070680_10000284516 356
243 3300005337 Ga0070682_100094887 Ga0070682_1000948872 356
244 3300005339 Ga0070660_100001061 Ga0070660_10000106124 356
245 3300005339 Ga0070660_100009593 Ga0070660_1000095938 356
246 3300005339 Ga0070660_100010278 Ga0070660_1000102787 356
247 3300005344 Ga0070661_100009309 Ga0070661_1000093099 356
248 3300005344 Ga0070661_100038565 Ga0070661_1000385652 356
249 3300005355 Ga0070671_100003631 Ga0070671_1000036317 356
250 3300005364 Ga0070673_100066892 Ga0070673_1000668923 356
251 3300005366 Ga0070659_100012198 Ga0070659_1000121982 356
252 3300005367 Ga0070667_100199538 Ga0070667_1001995382 356
253 3300005435 Ga0070714_100028449 Ga0070714_1000284497 356
254 3300005455 Ga0070663_100006176 Ga0070663_1000061765 356
255 3300005455 Ga0070663_100082928 Ga0070663_1000829284 356
256 3300005457 Ga0070662_100092545 Ga0070662_1000925454 356
257 3300005457 Ga0070662_100236689 Ga0070662_1002366892 356
258 3300005458 Ga0070681_10010289 Ga0070681_100102895 356
259 3300005530 Ga0070679_100026734 Ga0070679_1000267342 356
260 3300005535 Ga0070684_100086596 Ga0070684_1000865963 356
261 3300005539 Ga0068853_100021524 Ga0068853_1000215246 356
262 3300005539 Ga0068853_100101908 Ga0068853_1001019082 356
263 3300005563 Ga0068855_100159704 Ga0068855_1001597044 356
264 3300005563 Ga0068855_100204355 Ga0068855_1002043553 356
265 3300005564 Ga0070664_100118419 Ga0070664_1001184194 356
266 3300005564 Ga0070664_100215493 Ga0070664_1002154933 356
267 3300005564 Ga0070664_100344272 Ga0070664_1003442721 356
268 3300005577 Ga0068857_100123218 Ga0068857_1001232182 356
269 3300005578 Ga0068854_100146445 Ga0068854_1001464452 356
270 3300005614 Ga0068856_100233659 Ga0068856_1002336592 356
271 3300005616 Ga0068852_100007505 Ga0068852_10000750510 356
272 3300005616 Ga0068852_100040322 Ga0068852_1000403225 356
273 3300005616 Ga0068852_100055342 Ga0068852_1000553423 356
274 3300005618 Ga0068864_100001952 Ga0068864_10000195210 356
275 3300005834 Ga0068851_10008659 Ga0068851_100086594 356
276 3300005842 Ga0068858_100015068 Ga0068858_1000150683 356
277 3300005843 Ga0068860_100129959 Ga0068860_1001299593 356
278 3300006028 Ga0070717_10005953 Ga0070717_100059533 356
279 3300009177 Ga0105248_10002500 Ga0105248_100025006 356
280 3300009551 Ga0105238_10023266 Ga0105238_100232662 356
281 3300013100 Ga0157373_10028706 Ga0157373_100287062 356
282 3300013102 Ga0157371_10189742 Ga0157371_101897422 356
283 3300013105 Ga0157369_10308738 Ga0157369_103087382 356
284 3300013307 Ga0157372_10052507 Ga0157372_100525071 356
285 3300020070 Ga0206356_10862409 Ga0206356_108624093 356
286 3300025321 Ga0207656_10004658 Ga0207656_100046584 356
287 3300025904 Ga0207647_10009032 Ga0207647_100090328 356
288 3300025909 Ga0207705_10000123 Ga0207705_1000012327 356
289 3300025909 Ga0207705_10003112 Ga0207705_100031122 356
290 3300025909 Ga0207705_10009448 Ga0207705_100094482 356
291 3300025912 Ga0207707_10015333 Ga0207707_100153338 356
292 3300025913 Ga0207695_10019756 Ga0207695_1001975610 356
293 3300025917 Ga0207660_10113989 Ga0207660_101139894 356
294 3300025919 Ga0207657_10000650 Ga0207657_1000065019 356
295 3300025919 Ga0207657_10003913 Ga0207657_100039138 356
296 3300025919 Ga0207657_10015919 Ga0207657_100159198 356
297 3300025919 Ga0207657_10021597 Ga0207657_100215972 356
298 3300025920 Ga0207649_10017440 Ga0207649_100174405 356
299 3300025920 Ga0207649_10027242 Ga0207649_100272422 356
300 3300025920 Ga0207649_10034711 Ga0207649_100347111 356
301 3300025921 Ga0207652_10000034 Ga0207652_1000003487 356
302 3300025924 Ga0207694_10102002 Ga0207694_101020023 356
303 3300025925 Ga0207650_10032243 Ga0207650_100322432 356
304 3300025931 Ga0207644_10000998 Ga0207644_100009987 356
305 3300025932 Ga0207690_10006143 Ga0207690_100061437 356
306 3300025932 Ga0207690_10066676 Ga0207690_100666763 356
307 3300025933 Ga0207706_10005402 Ga0207706_1000540210 356
308 3300025933 Ga0207706_10077672 Ga0207706_100776722 356
309 3300025933 Ga0207706_10088970 Ga0207706_100889703 356
310 3300025941 Ga0207711_10005331 Ga0207711_100053316 356
311 3300025945 Ga0207679_10007359 Ga0207679_100073593 356
312 3300025949 Ga0207667_10018263 Ga0207667_100182636 356
313 3300025949 Ga0207667_10036894 Ga0207667_100368942 356
314 3300025949 Ga0207667_10133092 Ga0207667_101330923 356
315 3300025949 Ga0207667_10160072 Ga0207667_101600723 356
316 3300025960 Ga0207651_10129127 Ga0207651_101291273 356
317 3300025986 Ga0207658_10152590 Ga0207658_101525902 356
318 3300026035 Ga0207703_10004446 Ga0207703_100044469 356
319 3300026041 Ga0207639_10139453 Ga0207639_101394532 356
320 3300026041 Ga0207639_10146302 Ga0207639_101463023 356
321 3300026067 Ga0207678_10020343 Ga0207678_100203439 356
322 3300026067 Ga0207678_10025008 Ga0207678_100250085 356
323 3300026067 Ga0207678_10207561 Ga0207678_102075612 356
324 3300026078 Ga0207702_10018250 Ga0207702_100182509 356
325 3300026078 Ga0207702_10152867 Ga0207702_101528672 356
326 3300026095 Ga0207676_10075094 Ga0207676_100750943 356
327 3300026095 Ga0207676_10187357 Ga0207676_101873572 356
328 3300026116 Ga0207674_10025828 Ga0207674_100258288 356
329 3300026142 Ga0207698_10027421 Ga0207698_100274213 356
330 3300026142 Ga0207698_10098688 Ga0207698_100986883 356
331 3300028380 Ga0268265_10009142 Ga0268265_100091423 356
332 3300031731 Ga0307405_10014612 Ga0307405_100146126 356
333 3300032002 Ga0307416_100002746 Ga0307416_1000027467 356
334 3300032005 Ga0307411_10050764 Ga0307411_100507643 356
335 3300032126 Ga0307415_100080401 Ga0307415_1000804014 356
336 3300032126 Ga0307415_100284535 Ga0307415_1002845352 356
337 3300037312 Ga0395899_0086394 Ga0395899_0086394_988_2163 356
338 3300037418 Ga0395900_0012634 Ga0395900_0012634_3367_4542 356
339 3300037418 Ga0395900_0076375 Ga0395900_0076375_792_1961 356
340 3300037466 Ga0395898_0209895 Ga0395898_0209895_203_1369 356
341 3300038443 Ga0395901_0022105 Ga0395901_0022105_4585_5760 356
342 3300038443 Ga0395901_0037872 Ga0395901_0037872_856_2034 356
343 3300038443 Ga0395901_0190459 Ga0395901_0190459_693_1916 356
344 3300044656 Ga0466969_0013700 Ga0466969_0013700_2756_3922 356
345 3300044684 Ga0466966_0010189 Ga0466966_0010189_1224_2390 356
346 3300044693 Ga0466961_0014580 Ga0466961_0014580_2272_3438 356
347 3300044693 Ga0466961_0117941 Ga0466961_0117941_394_1560 356
348 3300044693 Ga0466961_0133576 Ga0466961_0133576_177_1340 356
349 3300044694 Ga0466963_0015497 Ga0466963_0015497_881_2047 356
350 3300044735 Ga0466968_0055251 Ga0466968_0055251_205_1488 356
351 3300044765 Ga0466970_0007423 Ga0466970_0007423_2340_3506 356
352 3300044765 Ga0466970_0033484 Ga0466970_0033484_1246_2412 356
353 3300044765 Ga0466970_0058687 Ga0466970_0058687_144_1310 356
354 3300044765 Ga0466970_0065838 Ga0466970_0065838_594_1763 356
355 3300045049 Ga0466959_0122416 Ga0466959_0122416_244_1410 356
356 3300045049 Ga0466959_0134007 Ga0466959_0134007_267_1550 356
357 3300045976 Ga0466967_0003504 Ga0466967_0003504_1125_2285 356
358 3300045976 Ga0466967_0324664 Ga0466967_0324664_221_1375 356
359 3300048906 Ga0496103_0045499 Ga0496103_0045499_1052_2215 356
360 3300048911 Ga0496108_0013638 Ga0496108_0013638_2251_3414 356
361 3300048912 Ga0496109_0019207 Ga0496109_0019207_3839_5002 356
362 3300048913 Ga0496110_0062646 Ga0496110_0062646_710_1873 356
363 3300048915 Ga0496112_0006596 Ga0496112_0006596_4636_5799 356
364 3300048915 Ga0496112_0208212 Ga0496112_0208212_234_1460 356
365 3300048916 Ga0496113_0070772 Ga0496113_0070772_886_2049 356
366 3300001979 JGI24740J21852_10004203 JGI24740J21852_100042035 357
367 3300001989 JGI24739J22299_10007408 JGI24739J22299_100074085 357
368 3300002067 JGI24735J21928_10025053 JGI24735J21928_100250532 357
369 3300005327 Ga0070658_10000945 Ga0070658_1000094510 357
370 3300005329 Ga0070683_100007042 Ga0070683_1000070428 357
371 3300005331 Ga0070670_100010639 Ga0070670_1000106394 357
372 3300005331 Ga0070670_100032625 Ga0070670_1000326253 357
373 3300005331 Ga0070670_100108324 Ga0070670_1001083242 357
374 3300005331 Ga0070670_100137586 Ga0070670_1001375862 357
375 3300005335 Ga0070666_10001573 Ga0070666_1000157314 357
376 3300005336 Ga0070680_100142605 Ga0070680_1001426052 357
377 3300005337 Ga0070682_100004719 Ga0070682_1000047195 357
378 3300005339 Ga0070660_100004959 Ga0070660_10000495910 357
379 3300005339 Ga0070660_100096020 Ga0070660_1000960202 357
380 3300005344 Ga0070661_100000198 Ga0070661_10000019821 357
381 3300005344 Ga0070661_100011430 Ga0070661_1000114306 357
382 3300005354 Ga0070675_100015241 Ga0070675_1000152412 357
383 3300005355 Ga0070671_100004347 Ga0070671_10000434710 357
384 3300005366 Ga0070659_100000381 Ga0070659_1000003812 357
385 3300005366 Ga0070659_100043981 Ga0070659_1000439812 357
386 3300005367 Ga0070667_100152322 Ga0070667_1001523223 357
387 3300005455 Ga0070663_100000636 Ga0070663_10000063612 357
388 3300005457 Ga0070662_100000012 Ga0070662_100000012105 357
389 3300005458 Ga0070681_10173977 Ga0070681_101739772 357
390 3300005530 Ga0070679_100349075 Ga0070679_1003490751 357
391 3300005535 Ga0070684_100006550 Ga0070684_10000655011 357
392 3300005539 Ga0068853_100000032 Ga0068853_10000003220 357
393 3300005543 Ga0070672_100053366 Ga0070672_1000533664 357
394 3300005547 Ga0070693_100065748 Ga0070693_1000657482 357
395 3300005548 Ga0070665_100003142 Ga0070665_1000031426 357
396 3300005563 Ga0068855_100001355 Ga0068855_1000013551 357
397 3300005563 Ga0068855_100327103 Ga0068855_1003271032 357
398 3300005564 Ga0070664_100000133 Ga0070664_10000013320 357
399 3300005564 Ga0070664_100011944 Ga0070664_1000119443 357
400 3300005564 Ga0070664_100175917 Ga0070664_1001759173 357
401 3300005577 Ga0068857_100038562 Ga0068857_1000385625 357
402 3300005578 Ga0068854_100031767 Ga0068854_1000317675 357
403 3300005614 Ga0068856_100000190 Ga0068856_10000019045 357
404 3300005614 Ga0068856_100043669 Ga0068856_1000436693 357
405 3300005616 Ga0068852_100001094 Ga0068852_10000109415 357
406 3300005616 Ga0068852_100378411 Ga0068852_1003784112 357
407 3300005617 Ga0068859_100012095 Ga0068859_1000120956 357
408 3300005617 Ga0068859_100019575 Ga0068859_1000195753 357
409 3300005618 Ga0068864_100001450 Ga0068864_10000145015 357
410 3300005618 Ga0068864_100013375 Ga0068864_1000133755 357
411 3300005618 Ga0068864_100078235 Ga0068864_1000782353 357
412 3300005834 Ga0068851_10004563 Ga0068851_100045637 357
413 3300005841 Ga0068863_100002397 Ga0068863_10000239715 357
414 3300005842 Ga0068858_100059024 Ga0068858_1000590242 357
415 3300005842 Ga0068858_100091895 Ga0068858_1000918953 357
416 3300006237 Ga0097621_100070732 Ga0097621_1000707323 357
417 3300006931 Ga0097620_100012095 Ga0097620_1000120956 357
418 3300006931 Ga0097620_100019575 Ga0097620_1000195757 357
419 3300009177 Ga0105248_10000083 Ga0105248_1000008315 357
420 3300009177 Ga0105248_10000660 Ga0105248_1000066033 357
421 3300009177 Ga0105248_10051953 Ga0105248_100519535 357
422 3300009545 Ga0105237_10033886 Ga0105237_100338862 357
423 3300009551 Ga0105238_10012694 Ga0105238_100126942 357
424 3300013100 Ga0157373_10013173 Ga0157373_100131739 357
425 3300013100 Ga0157373_10154020 Ga0157373_101540202 357
426 3300013102 Ga0157371_10002238 Ga0157371_1000223820 357
427 3300013102 Ga0157371_10118324 Ga0157371_101183241 357
428 3300013105 Ga0157369_10096420 Ga0157369_100964203 357
429 3300014325 Ga0163163_10000364 Ga0163163_100003648 357
430 3300014497 Ga0182008_10054709 Ga0182008_100547092 357
431 3300014968 Ga0157379_10003770 Ga0157379_1000377015 357
432 3300020081 Ga0206354_11359883 Ga0206354_113598832 357
433 3300025321 Ga0207656_10020405 Ga0207656_100204053 357
434 3300025903 Ga0207680_10003328 Ga0207680_1000332810 357
435 3300025904 Ga0207647_10040642 Ga0207647_100406425 357
436 3300025904 Ga0207647_10122919 Ga0207647_101229192 357
437 3300025909 Ga0207705_10000072 Ga0207705_1000007220 357
438 3300025909 Ga0207705_10068123 Ga0207705_100681232 357
439 3300025909 Ga0207705_10103175 Ga0207705_101031753 357
440 3300025912 Ga0207707_10123877 Ga0207707_101238772 357
441 3300025912 Ga0207707_10174381 Ga0207707_101743812 357
442 3300025918 Ga0207662_10082239 Ga0207662_100822392 357
443 3300025919 Ga0207657_10001761 Ga0207657_100017618 357
444 3300025919 Ga0207657_10007824 Ga0207657_100078242 357
445 3300025920 Ga0207649_10000158 Ga0207649_100001583 357
446 3300025924 Ga0207694_10013779 Ga0207694_100137795 357
447 3300025925 Ga0207650_10015288 Ga0207650_100152885 357
448 3300025925 Ga0207650_10072876 Ga0207650_100728762 357
449 3300025926 Ga0207659_10018156 Ga0207659_100181566 357
450 3300025931 Ga0207644_10013878 Ga0207644_100138788 357
451 3300025931 Ga0207644_10023048 Ga0207644_100230482 357
452 3300025932 Ga0207690_10000160 Ga0207690_1000016033 357
453 3300025933 Ga0207706_10000041 Ga0207706_1000004121 357
454 3300025933 Ga0207706_10145820 Ga0207706_101458203 357
455 3300025933 Ga0207706_10282125 Ga0207706_102821252 357
456 3300025933 Ga0207706_10288514 Ga0207706_102885142 357
457 3300025940 Ga0207691_10063191 Ga0207691_100631913 357
458 3300025941 Ga0207711_10001588 Ga0207711_1000158810 357
459 3300025941 Ga0207711_10004366 Ga0207711_1000436610 357
460 3300025941 Ga0207711_10175625 Ga0207711_101756252 357
461 3300025944 Ga0207661_10003009 Ga0207661_100030097 357
462 3300025945 Ga0207679_10013419 Ga0207679_100134198 357
463 3300025945 Ga0207679_10079994 Ga0207679_100799943 357
464 3300025949 Ga0207667_10001389 Ga0207667_100013892 357
465 3300025949 Ga0207667_10088407 Ga0207667_100884073 357
466 3300025981 Ga0207640_10054024 Ga0207640_100540242 357
467 3300025986 Ga0207658_10009516 Ga0207658_100095163 357
468 3300025986 Ga0207658_10204392 Ga0207658_102043923 357
469 3300026041 Ga0207639_10000533 Ga0207639_1000053320 357
470 3300026067 Ga0207678_10003275 Ga0207678_1000327513 357
471 3300026067 Ga0207678_10004945 Ga0207678_1000494514 357
472 3300026067 Ga0207678_10121721 Ga0207678_101217213 357
473 3300026078 Ga0207702_10000444 Ga0207702_1000044430 357
474 3300026078 Ga0207702_10018623 Ga0207702_100186235 357
475 3300026088 Ga0207641_10044991 Ga0207641_100449913 357
476 3300026095 Ga0207676_10001909 Ga0207676_1000190919 357
477 3300026116 Ga0207674_10000660 Ga0207674_1000066034 357
478 3300026116 Ga0207674_10024503 Ga0207674_100245032 357
479 3300026142 Ga0207698_10002501 Ga0207698_1000250112 357
480 3300026142 Ga0207698_10190934 Ga0207698_101909341 357
481 3300028379 Ga0268266_10008245 Ga0268266_100082453 357
482 3300031731 Ga0307405_10016561 Ga0307405_100165614 357
483 3300031824 Ga0307413_10024423 Ga0307413_100244234 357
484 3300031852 Ga0307410_10034043 Ga0307410_100340434 357
485 3300031903 Ga0307407_10036229 Ga0307407_100362293 357
486 3300031911 Ga0307412_10025110 Ga0307412_100251102 357
487 3300035242 Ga0373962_0022794 Ga0373962_0022794_282_1445 357
488 3300037312 Ga0395899_0001745 Ga0395899_0001745_16522_17751 357
489 3300037418 Ga0395900_0001256 Ga0395900_0001256_20616_21740 357
490 3300037418 Ga0395900_0019379 Ga0395900_0019379_3424_4653 357
491 3300037418 Ga0395900_0027008 Ga0395900_0027008_1348_2577 357
492 3300037418 Ga0395900_0099185 Ga0395900_0099185_1747_2937 357
493 3300037466 Ga0395898_0039260 Ga0395898_0039260_1750_2940 357
494 3300037471 Ga0395905_0000610 Ga0395905_0000610_24999_26123 357
495 3300037471 Ga0395905_0031249 Ga0395905_0031249_1403_2587 357
496 3300037471 Ga0395905_0036513 Ga0395905_0036513_721_1863 357
497 3300037471 Ga0395905_0051022 Ga0395905_0051022_369_1559 357
498 3300037471 Ga0395905_0051704 Ga0395905_0051704_2286_3515 357
499 3300037471 Ga0395905_0139508 Ga0395905_0139508_170_1321 357
500 3300037853 Ga0436364_1351497 Ga0436364_1351497_23882_25057 357
501 3300038443 Ga0395901_0055408 Ga0395901_0055408_1187_2377 357
502 3300042006 Ga0439432_012609 Ga0439432_012609_553_1719 357
503 3300042007 Ga0439449_0027027 Ga0439449_0027027_691_1857 357
504 3300044684 Ga0466966_0066305 Ga0466966_0066305_313_1449 357
505 3300044694 Ga0466963_0054773 Ga0466963_0054773_443_1600 357
506 3300044842 Ga0466957_0016128 Ga0466957_0016128_1946_3082 357
507 3300044842 Ga0466957_0051930 Ga0466957_0051930_335_1513 357
508 3300046684 Ga0495669_0008359 Ga0495669_0008359_1999_3168 357
509 3300048904 Ga0496101_0005871 Ga0496101_0005871_1523_2692 357
510 3300048905 Ga0496102_0032961 Ga0496102_0032961_2490_3632 357
511 3300048909 Ga0496106_0005506 Ga0496106_0005506_1881_3050 357
512 3300048910 Ga0496107_0002278 Ga0496107_0002278_6132_7301 357
513 3300048910 Ga0496107_0060991 Ga0496107_0060991_1399_2541 357
514 3300048911 Ga0496108_0014831 Ga0496108_0014831_2294_3454 357
515 3300048911 Ga0496108_0031978 Ga0496108_0031978_2352_3521 357
516 3300048912 Ga0496109_0000995 Ga0496109_0000995_3323_4492 357
517 3300048912 Ga0496109_0035321 Ga0496109_0035321_1861_3003 357
518 3300048913 Ga0496110_0004340 Ga0496110_0004340_6751_7920 357
519 3300048914 Ga0496111_0018154 Ga0496111_0018154_1108_2250 357
520 3300048914 Ga0496111_0031803 Ga0496111_0031803_897_2066 357
521 3300048915 Ga0496112_0021033 Ga0496112_0021033_643_1785 357
522 3300048915 Ga0496112_0023280 Ga0496112_0023280_2252_3421 357
523 3300048916 Ga0496113_0001781 Ga0496113_0001781_5593_6735 357
524 3300048916 Ga0496113_0017245 Ga0496113_0017245_3147_4316 357
525 3300061719 Ga0466962_0037107 Ga0466962_0037107_458_1645 357
526 3300061719 Ga0466962_0044085 Ga0466962_0044085_117_1253 357
527 3300001976 JGI24752J21851_1003557 JGI24752J21851_10035573 358
528 3300005339 Ga0070660_100012973 Ga0070660_1000129732 358
529 3300005353 Ga0070669_100082037 Ga0070669_1000820372 358
530 3300005366 Ga0070659_100007699 Ga0070659_1000076997 358
531 3300005367 Ga0070667_100268369 Ga0070667_1002683692 358
532 3300005457 Ga0070662_100062855 Ga0070662_1000628554 358
533 3300005539 Ga0068853_100032899 Ga0068853_1000328992 358
534 3300005543 Ga0070672_100028048 Ga0070672_1000280486 358
535 3300005617 Ga0068859_100075277 Ga0068859_1000752773 358
536 3300006931 Ga0097620_100075278 Ga0097620_1000752783 358
537 3300009098 Ga0105245_10170580 Ga0105245_101705803 358
538 3300009176 Ga0105242_10124715 Ga0105242_101247152 358
539 3300009553 Ga0105249_10015457 Ga0105249_100154573 358
540 3300010375 Ga0105239_10081305 Ga0105239_100813052 358
541 3300011119 Ga0105246_10011519 Ga0105246_100115195 358
542 3300013308 Ga0157375_10158836 Ga0157375_101588361 358
543 3300025904 Ga0207647_10002661 Ga0207647_100026616 358
544 3300025919 Ga0207657_10017682 Ga0207657_100176828 358
545 3300025920 Ga0207649_10044301 Ga0207649_100443013 358
546 3300025923 Ga0207681_10053441 Ga0207681_100534415 358
547 3300025932 Ga0207690_10006964 Ga0207690_100069647 358
548 3300025933 Ga0207706_10010269 Ga0207706_1001026912 358
549 3300025940 Ga0207691_10021755 Ga0207691_100217553 358
550 3300025942 Ga0207689_10049154 Ga0207689_100491543 358
551 3300025945 Ga0207679_10050096 Ga0207679_100500962 358
552 3300025949 Ga0207667_10021914 Ga0207667_100219149 358
553 3300025961 Ga0207712_10002789 Ga0207712_100027899 358
554 3300026041 Ga0207639_10012656 Ga0207639_100126562 358
555 3300031852 Ga0307410_10154655 Ga0307410_101546552 358
556 3300032002 Ga0307416_100106830 Ga0307416_1001068302 358
557 3300032005 Ga0307411_10015233 Ga0307411_100152332 358
558 3300050515 nmdc:mga0a205_37225_c1 nmdc:mga0a205_37225_c1_3144_4304 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11288

DUF3089

Protein of unknown function (DUF3089)

54

250

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tgl-assembly1.cif.gz_A structure and molecular model refinement of rhizomucor miehei triacylglyceride lipase: a case study of the use of simulated annealing in partial model refinement 0.7216 117 182
1tgl-assembly1.cif.gz_A a serine protease triad forms the catalytic centre of a triacylglycerol lipase 0.7038 117 182
1ex9-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa lipase complexed with rc-(rp,sp)-1,2-dioctylcarbamoyl-glycero-3-o-octylphosphonate 0.6983 49 180
6y9f-assembly1.cif.gz_A crystal structure of putative ancestral haloalkane dehalogenase anchld3 (node 3) 0.6591 46 186
7cog-assembly3.cif.gz_C cholesterol esterase from burkholderia stabilis (monoclinic crystal form) 0.6545 49 180
ID Description Score Start End Superfamily
af_Q9SJ35_38_207_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7708 123 154 3.40.50.1820
af_Q8BVA5_31_323_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7653 141 178 3.40.50.1820
af_A4I7Q7_4_265_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.753 119 183 3.40.50.1820
af_Q10SS2_402_638_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7302 116 188 3.40.50.1820
af_P25641_174_392_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7237 122 180 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2U1FZH4-F1-model_v4 deleted 0.9957 10 356
AF-A0A7G9L109-F1-model_v4 DUF3089 domain-containing protein 0.9868 10 355
AF-A0A7H0G233-F1-model_v4 deleted 0.9794 122 332
AF-A0A537LZ70-F1-model_v4 DUF3089 domain-containing protein 0.9633 135 356
AF-A0A2U1FZH4-F1-model_v4 deleted 0.9625 10 356

Feature Viewer

pLDDT pTM Quality
91.91 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map