F463337

General Info

Members Datasets Scaffolds Average Seq Length
557 326 471 156

Family's Representative Sequence

Representative Sequence 3300042012|Ga0439455_0162534|Ga0439455_0162534_30_563
Length 177
Sequence LLSQAAQIQTNGAEPMGENQHVKFPQEVIDEYAALGVDLPALFSAGHLGTRMGVHIVEASADRVVGTMPVEGNTQPYGLLHGGASAVLAETLGSVGSMLHAGSSKLAVGVDLNCTHHRSARSGLVTGVATPVHRGRTTATYEIAITDEQDRRVCSARLTCVLRDVLPGEAQHAGISD

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221548 Streptomyces sp. Root55 Isolate Unclassified
9 2643221578 Streptomyces sp. Root63 Isolate Unclassified
10 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221670 Streptomyces sp. Root431 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
16 2643221714 Streptomyces sp. Root264 Isolate Unclassified
17 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
18 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
19 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
20 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
21 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
22 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
23 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
24 2808606448 Streptomyces sp. 193411 Isolate Unclassified
25 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
26 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
27 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
28 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
29 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
30 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
31 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
32 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
33 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
34 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
35 2862574272 Streptomyces sp. AcE210 Isolate Nodule
36 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
37 2867428634 Streptomyces sp. RP5T Isolate Unclassified
38 2867475112 Streptomyces sp. TM32 Isolate Unclassified
39 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
40 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
41 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
42 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
43 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
44 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
45 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
46 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
47 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
48 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
49 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
50 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
51 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
52 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
53 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
54 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
55 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
56 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
57 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
58 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
59 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
60 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
61 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
62 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
63 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
64 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
65 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
66 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
67 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
68 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
69 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
70 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
71 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
72 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
73 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
74 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
75 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
76 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
77 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
78 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
79 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
82 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
136 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
137 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
138 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
139 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
142 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
146 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
147 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
148 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
149 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
150 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
151 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
152 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
153 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
156 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
172 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
259 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
260 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
295 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
303 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
304 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
305 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
306 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
311 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
312 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
313 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
314 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
315 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
316 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
317 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
318 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
319 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
320 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
321 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
322 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
323 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
324 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
325 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
326 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.84
Metatranscriptomes 0.54
Isolates 15.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.67
Nodule 0.72
Rhizoplane 0.9
Rhizosphere 79.71
Stem 0
Stem Tuber 0
Unclassified 14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10059342 3300001989 Bacteria 1212
2 JGI24737J22298_10008960 3300001990 Bacteria 3338
3 JGI24738J21930_10067621 3300002075 Bacteria 738
4 rootH1_10039667 3300003316 Bacteria 4574
5 rootH1_10068310 3300003316 Bacteria 1452
6 rootH1_10068310 3300003323 Bacteria 8470
7 rootH2_10022151 3300003320 Bacteria 4192
8 rootH1_10018153 3300003323 Bacteria 4010
9 rootH1_10024636 3300003323 Bacteria 3346
10 JGI25160J50197_1024160 3300003354 Bacteria 1731
11 JGI25160J50197_1042123 3300003354 Bacteria 1042
12 JGI25160J50197_1042633 3300003354 Bacteria 1030
13 Ga0006562J51391_1024697 3300003578 Bacteria 3090
14 Ga0006562J51391_1051187 3300003578 Bacteria 1604
15 Ga0068869_100366384 3300005334 Bacteria 1178
16 Ga0070682_101261287 3300005337 Bacteria 626
17 Ga0068868_100051154 3300005338 Bacteria 3248
18 Ga0070659_100016483 3300005366 Bacteria 5548
19 Ga0070659_100550014 3300005366 Bacteria 988
20 Ga0070685_10336385 3300005466 Bacteria 1028
21 Ga0068853_100208871 3300005539 Bacteria 1779
22 Ga0068856_101389533 3300005614 Bacteria 717
23 Ga0081455_10019246 3300005937 Bacteria 6467
24 Ga0075363_100066440 3300006048 Bacteria 1952
25 Ga0075367_10001268 3300006178 Bacteria 10661
26 Ga0075367_10555418 3300006178 Bacteria 729
27 Ga0075370_10148109 3300006353 Bacteria 1375
28 Ga0099826_10172169 3300006948 Bacteria 1214
29 Ga0105251_10025034 3300009011 Bacteria 3058
30 Ga0105244_10271582 3300009036 Bacteria 787
31 Ga0105245_10819573 3300009098 Bacteria 969
32 Ga0105243_12294303 3300009148 Bacteria 577
33 Ga0105246_10028144 3300011119 Bacteria 3690
34 Ga0105246_10594710 3300011119 Bacteria 955
35 Ga0157369_10412033 3300013105 Bacteria 1401
36 Ga0157375_10624070 3300013308 Bacteria 1236
37 Ga0157375_11247477 3300013308 Bacteria 873
38 Ga0182008_10001675 3300014497 Bacteria 14580
39 Ga0182007_10001128 3300015262 Bacteria 14477
40 Ga0182005_1138208 3300015265 Bacteria 703
41 Ga0182005_1227135 3300015265 Bacteria 570
42 Ga0183367_1007 3300015688 Bacteria 498079
43 Ga0209758_1003871 3300025297 Bacteria 13111
44 Ga0207426_1001638 3300025302 Bacteria 17519
45 Ga0207426_1008848 3300025302 Bacteria 4030
46 Ga0207426_1024329 3300025302 Bacteria 2056
47 Ga0207426_1045924 3300025302 Bacteria 1325
48 Ga0207426_1063420 3300025302 Bacteria 1055
49 Ga0207713_1081291 3300025735 Bacteria 1165
50 Ga0207647_10013318 3300025904 Bacteria 5707
51 Ga0207703_10781776 3300026035 Bacteria 911
52 Ga0207702_10854388 3300026078 Bacteria 901
53 Ga0209371_1020785 3300027312 Bacteria 1608
54 Ga0307517_10025700 3300028786 Bacteria 7183
55 Ga0307515_10003749 3300028794 Bacteria 31847
56 Ga0307515_10180449 3300028794 Bacteria 2063
57 Ga0307515_10258441 3300028794 Bacteria 1482
58 Ga0268256_1019922 3300030500 Bacteria 1822
59 Ga0307511_10003571 3300030521 Bacteria 15935
60 Ga0307511_10018908 3300030521 Bacteria 6568
61 Ga0307511_10024115 3300030521 Bacteria 5647
62 Ga0307512_10017856 3300030522 Bacteria 6495
63 Ga0307513_10000030 3300031456 Bacteria 190657
64 Ga0307513_10031878 3300031456 Bacteria 5957
65 Ga0307513_10070621 3300031456 Bacteria 3648
66 Ga0307513_10109430 3300031456 Bacteria 2760
67 Ga0307509_10050397 3300031507 Bacteria 4458
68 Ga0307509_10076423 3300031507 Bacteria 3475
69 Ga0307509_10458968 3300031507 Bacteria 966
70 Ga0307508_10022615 3300031616 Bacteria 5713
71 Ga0307508_10027794 3300031616 Bacteria 5118
72 Ga0307508_10128228 3300031616 Bacteria 2140
73 Ga0307508_10190950 3300031616 Bacteria 1650
74 Ga0307514_10004349 3300031649 Bacteria 13057
75 Ga0307514_10262010 3300031649 Bacteria 1011
76 Ga0307516_10004257 3300031730 Bacteria 17797
77 Ga0307516_10034197 3300031730 Bacteria 5110
78 Ga0307516_10078914 3300031730 Bacteria 3137
79 Ga0307413_10172383 3300031824 Bacteria 1533
80 Ga0307518_10011865 3300031838 Bacteria 6231
81 Ga0307518_10137621 3300031838 Bacteria 1707
82 Ga0307518_10190048 3300031838 Bacteria 1377
83 Ga0307410_10037089 3300031852 Bacteria 3181
84 Ga0307412_11655321 3300031911 Bacteria 586
85 Ga0307409_100270324 3300031995 Bacteria 1565
86 Ga0307416_100746648 3300032002 Bacteria 1071
87 Ga0307411_10773048 3300032005 Bacteria 843
88 Ga0307507_10018693 3300033179 Bacteria 7862
89 Ga0307507_10042910 3300033179 Bacteria 4496
90 Ga0307510_10012422 3300033180 Bacteria 10100
91 Ga0307510_10063329 3300033180 Bacteria 3767
92 Ga0307510_10121796 3300033180 Bacteria 2310
93 Ga0307510_10164911 3300033180 Bacteria 1805
94 Ga0395900_0673888 3300037418 Bacteria 969
95 Ga0395900_0742731 3300037418 Bacteria 912
96 Ga0395898_0009500 3300037466 Bacteria 10211
97 Ga0395898_0075987 3300037466 Bacteria 3244
98 Ga0395901_0278616 3300038443 Bacteria 1738
99 Ga0395901_1282041 3300038443 Bacteria 695
100 Ga0439436_0005949 3300041404 Bacteria 3740
101 Ga0439438_113308 3300041405 Bacteria 654
102 Ga0439439_0005444 3300041406 Bacteria 2906
103 Ga0439439_0014973 3300041406 Bacteria 1891
104 Ga0451797_1047328 3300041453 Bacteria 512
105 Ga0451837_1269520 3300041494 Bacteria 1294
106 Ga0451841_0643032 3300041498 Bacteria 543
107 Ga0451845_0024019 3300041501 Bacteria 731
108 Ga0451851_0621849 3300041507 Bacteria 637
109 Ga0451853_1330357 3300041512 Bacteria 797
110 Ga0451853_1587073 3300041512 Bacteria 1623
111 Ga0451853_1921525 3300041512 Bacteria 3622
112 Ga0439433_0006138 3300041999 Bacteria 2582
113 Ga0439442_009565 3300042002 Bacteria 1960
114 Ga0439448_0028994 3300042005 Bacteria 1750
115 Ga0439449_0000255 3300042007 Bacteria 19095
116 Ga0439449_0015638 3300042007 Bacteria 2852
117 Ga0439449_0084696 3300042007 Bacteria 1169
118 Ga0439449_0155736 3300042007 Bacteria 852
119 Ga0439449_0265913 3300042007 Bacteria 645
120 Ga0439450_065209 3300042008 Bacteria 886
121 Ga0439455_0024172 3300042012 Bacteria 1468
122 Ga0439455_0162534 3300042012 Bacteria 639
123 Ga0439457_000609 3300042014 Bacteria 10557
124 Ga0439457_014962 3300042014 Bacteria 1733
125 Ga0439462_0001054 3300042015 Bacteria 5937
126 Ga0439463_114933 3300042016 Bacteria 695
127 Ga0450894_000132 3300042131 Bacteria 12987
128 Ga0450903_006498 3300042138 Bacteria 1938
129 Ga0450903_008851 3300042138 Bacteria 1645
130 Ga0450906_008897 3300042145 Bacteria 1929
131 Ga0450907_019432 3300042146 Bacteria 1139
132 Ga0439458_0066737 3300042157 Bacteria 904
133 Ga0450908_067830 3300042184 Bacteria 631
134 Ga0450901_006271 3300042533 Bacteria 1222
135 Ga0466972_0004589 3300044658 Bacteria 6924
136 Ga0466972_0006898 3300044658 Bacteria 5699
137 Ga0466972_0011830 3300044658 Bacteria 4384
138 Ga0466972_0033224 3300044658 Bacteria 2531
139 Ga0466965_0000990 3300044683 Bacteria 10987
140 Ga0466965_0037291 3300044683 Bacteria 2387
141 Ga0466966_0001473 3300044684 Bacteria 15143
142 Ga0466966_0074812 3300044684 Bacteria 2116
143 Ga0466961_0002142 3300044693 Bacteria 12281
144 Ga0466961_0002762 3300044693 Bacteria 10923
145 Ga0466961_0120855 3300044693 Bacteria 1645
146 Ga0466961_0516578 3300044693 Bacteria 721
147 Ga0466963_0000222 3300044694 Bacteria 24250
148 Ga0466964_0043069 3300044706 Bacteria 1830
149 Ga0466964_0699502 3300044706 Bacteria 565
150 Ga0466971_0000186 3300044719 Bacteria 23665
151 Ga0466971_0089705 3300044719 Bacteria 1407
152 Ga0466968_0061848 3300044735 Bacteria 1616
153 Ga0466968_0144477 3300044735 Bacteria 1090
154 Ga0466970_0000510 3300044765 Bacteria 19094
155 Ga0466970_0016755 3300044765 Bacteria 3781
156 Ga0466957_0000142 3300044842 Bacteria 30899
157 Ga0466957_1122986 3300044842 Bacteria 567
158 Ga0466960_0015130 3300044901 Bacteria 3321
159 Ga0466960_0576253 3300044901 Bacteria 666
160 Ga0466959_0002283 3300045049 Bacteria 12230
161 Ga0466959_0376577 3300045049 Bacteria 966
162 Ga0466958_0034285 3300045836 Bacteria 3027
163 Ga0466958_0320315 3300045836 Bacteria 996
164 Ga0466967_0001081 3300045976 Bacteria 15072
165 Ga0466967_0066128 3300045976 Bacteria 3220
166 Ga0466967_0123856 3300045976 Bacteria 2392
167 Ga0466967_1054185 3300045976 Bacteria 810
168 Ga0466967_1731070 3300045976 Bacteria 622
169 Ga0495617_021962 3300046452 Bacteria 2156
170 Ga0495627_040572 3300046453 Bacteria 1433
171 Ga0495592_0062435 3300046454 Bacteria 2735
172 Ga0495592_0080787 3300046454 Bacteria 2351
173 Ga0495603_0002340 3300046455 Bacteria 11129
174 Ga0495603_0016445 3300046455 Bacteria 4475
175 Ga0495603_0075165 3300046455 Bacteria 1983
176 Ga0495603_0132246 3300046455 Bacteria 1452
177 Ga0495603_0133439 3300046455 Bacteria 1445
178 Ga0495590_0071728 3300046457 Bacteria 1216
179 Ga0495629_0001976 3300046459 Bacteria 15974
180 Ga0495629_0009300 3300046459 Bacteria 7191
181 Ga0495629_0011352 3300046459 Bacteria 6470
182 Ga0495629_0035615 3300046459 Bacteria 3517
183 Ga0495629_0076406 3300046459 Bacteria 2338
184 Ga0495629_0316880 3300046459 Bacteria 1066
185 Ga0495638_0041363 3300046460 Bacteria 2916
186 Ga0495638_0043506 3300046460 Bacteria 2833
187 Ga0495638_0075567 3300046460 Bacteria 2053
188 Ga0495651_0026499 3300046462 Bacteria 4515
189 Ga0495651_0078704 3300046462 Bacteria 2493
190 Ga0495580_0141993 3300046472 Bacteria 1664
191 Ga0495582_0040544 3300046473 Bacteria 2565
192 Ga0495605_0081912 3300046474 Bacteria 1508
193 Ga0495605_0172882 3300046474 Bacteria 954
194 Ga0495639_0003779 3300046475 Bacteria 6509
195 Ga0495662_0012504 3300046476 Bacteria 4141
196 Ga0495662_0045722 3300046476 Bacteria 2113
197 Ga0495662_0055260 3300046476 Bacteria 1918
198 Ga0495664_0020634 3300046477 Bacteria 3801
199 Ga0495664_0076564 3300046477 Bacteria 2002
200 Ga0495584_0153653 3300046491 Bacteria 1169
201 Ga0495585_0011131 3300046492 Bacteria 5335
202 Ga0495585_0102112 3300046492 Bacteria 1533
203 Ga0495585_0133009 3300046492 Bacteria 1307
204 Ga0495585_0241661 3300046492 Bacteria 904
205 Ga0495594_0001101 3300046499 Bacteria 14082
206 Ga0495594_0161133 3300046499 Bacteria 1275
207 Ga0495594_0383175 3300046499 Bacteria 800
208 Ga0495594_0689729 3300046499 Bacteria 578
209 Ga0495596_0286519 3300046500 Bacteria 640
210 Ga0495607_0019364 3300046501 Bacteria 4324
211 Ga0495583_0091516 3300046506 Bacteria 1308
212 Ga0495606_0028005 3300046507 Bacteria 3982
213 Ga0495608_0189711 3300046511 Bacteria 1298
214 Ga0495610_0104936 3300046512 Bacteria 1260
215 Ga0495616_0014808 3300046513 Bacteria 4354
216 Ga0495618_0034859 3300046514 Bacteria 3158
217 Ga0495620_0080204 3300046515 Bacteria 1321
218 Ga0495628_0032839 3300046516 Bacteria 4186
219 Ga0495628_0091147 3300046516 Bacteria 2359
220 Ga0495628_1016394 3300046516 Bacteria 570
221 Ga0495630_0211068 3300046517 Bacteria 1482
222 Ga0495631_0007075 3300046518 Bacteria 5738
223 Ga0495631_0306941 3300046518 Bacteria 675
224 Ga0495631_0456890 3300046518 Bacteria 544
225 Ga0495632_0191079 3300046519 Bacteria 935
226 Ga0495637_0100289 3300046520 Bacteria 1132
227 Ga0495643_0007012 3300046522 Bacteria 7320
228 Ga0495643_0147027 3300046522 Bacteria 1170
229 Ga0495643_0171198 3300046522 Bacteria 1062
230 Ga0495644_0120767 3300046523 Bacteria 997
231 Ga0495648_0096162 3300046524 Bacteria 1646
232 Ga0495648_0277478 3300046524 Bacteria 796
233 Ga0495666_0070448 3300046526 Bacteria 1663
234 Ga0495642_0127156 3300046528 Bacteria 1096
235 Ga0495642_0193341 3300046528 Bacteria 886
236 Ga0495652_0061229 3300046529 Bacteria 3178
237 Ga0495640_0021333 3300046533 Bacteria 4756
238 Ga0495640_0037356 3300046533 Bacteria 3425
239 Ga0495586_0024729 3300046535 Bacteria 3212
240 Ga0495586_0256827 3300046535 Bacteria 998
241 Ga0495587_0001745 3300046536 Bacteria 14514
242 Ga0495609_0103626 3300046538 Bacteria 1231
243 Ga0495597_0106661 3300046542 Bacteria 1177
244 Ga0495645_0345725 3300046543 Bacteria 959
245 Ga0495622_0018349 3300046557 Bacteria 3258
246 Ga0495622_0019045 3300046557 Bacteria 3197
247 Ga0495622_0083555 3300046557 Bacteria 1469
248 Ga0495622_0391286 3300046557 Bacteria 599
249 Ga0495622_0484890 3300046557 Bacteria 529
250 Ga0495633_0162148 3300046558 Bacteria 1031
251 Ga0495667_0069994 3300046559 Bacteria 2289
252 Ga0495656_0062120 3300046615 Bacteria 1633
253 Ga0495668_0168595 3300046616 Bacteria 1199
254 Ga0495634_0003781 3300046642 Bacteria 12025
255 Ga0495634_0065476 3300046642 Bacteria 2408
256 Ga0495611_0009386 3300046648 Bacteria 4136
257 Ga0495611_0520206 3300046648 Bacteria 540
258 Ga0495625_0009511 3300046660 Bacteria 8120
259 Ga0495625_0030296 3300046660 Bacteria 4039
260 Ga0495625_0189598 3300046660 Bacteria 1363
261 Ga0495635_0002533 3300046663 Bacteria 12500
262 Ga0495635_0005524 3300046663 Bacteria 8794
263 Ga0495661_0054383 3300046665 Bacteria 2403
264 Ga0495588_0005625 3300046674 Bacteria 5585
265 Ga0495588_0008317 3300046674 Bacteria 4755
266 Ga0495588_0181970 3300046674 Bacteria 1110
267 Ga0495657_0004721 3300046675 Bacteria 10858
268 Ga0495657_0022748 3300046675 Bacteria 4485
269 Ga0495657_0067148 3300046675 Bacteria 2354
270 Ga0495599_0255605 3300046678 Bacteria 1065
271 Ga0495623_0105579 3300046679 Bacteria 1712
272 Ga0495646_0007939 3300046680 Bacteria 6743
273 Ga0495646_0331773 3300046680 Bacteria 799
274 Ga0495658_0009346 3300046683 Bacteria 4884
275 Ga0495613_0002714 3300046689 Bacteria 13288
276 Ga0495613_0018528 3300046689 Bacteria 5190
277 Ga0495613_0037071 3300046689 Bacteria 3615
278 Ga0495613_0042333 3300046689 Bacteria 3370
279 Ga0495613_0128485 3300046689 Bacteria 1815
280 Ga0495613_0353236 3300046689 Bacteria 1009
281 Ga0495613_0568284 3300046689 Bacteria 757
282 Ga0495613_0695689 3300046689 Bacteria 669
283 Ga0495624_0099836 3300046690 Bacteria 1787
284 Ga0495624_0168261 3300046690 Bacteria 1337
285 Ga0495670_0020448 3300046691 Bacteria 3265
286 Ga0495670_0309508 3300046691 Bacteria 847
287 Ga0495671_0004267 3300046692 Bacteria 8588
288 Ga0495649_0297272 3300046694 Bacteria 822
289 Ga0495649_0365051 3300046694 Bacteria 728
290 Ga0495589_0009342 3300046794 Bacteria 5100
291 Ga0495589_0027281 3300046794 Bacteria 2887
292 Ga0495589_0059338 3300046794 Bacteria 1880
293 Ga0495589_0079936 3300046794 Bacteria 1590
294 Ga0495589_0186938 3300046794 Bacteria 981
295 Ga0495589_0469446 3300046794 Bacteria 575
296 Ga0495600_0009397 3300046809 Bacteria 6040
297 Ga0495600_0192921 3300046809 Bacteria 1309
298 Ga0495660_0043215 3300046810 Bacteria 2486
299 Ga0495660_0082737 3300046810 Bacteria 1680
300 Ga0495581_0013656 3300047315 Bacteria 4709
301 Ga0495581_0146683 3300047315 Bacteria 1377
302 Ga0495581_0468363 3300047315 Bacteria 733
303 Ga0495604_0004721 3300047317 Bacteria 10797
304 Ga0495604_0007492 3300047317 Bacteria 8637
305 Ga0495604_0101334 3300047317 Bacteria 2115
306 Ga0495636_0029901 3300047318 Bacteria 2225
307 Ga0495674_0068719 3300047319 Bacteria 3065
308 Ga0495674_0155988 3300047319 Bacteria 1912
309 Ga0495676_0003672 3300047321 Bacteria 13926
310 Ga0495676_0016165 3300047321 Bacteria 6628
311 Ga0495676_0032194 3300047321 Bacteria 4429
312 Ga0495676_0051787 3300047321 Bacteria 3281
313 Ga0495676_0073665 3300047321 Bacteria 2617
314 Ga0495676_0096151 3300047321 Bacteria 2202
315 Ga0495680_0023148 3300047322 Bacteria 5168
316 Ga0495683_0097214 3300047323 Bacteria 1419
317 Ga0495683_0154815 3300047323 Bacteria 1064
318 Ga0495683_0244300 3300047323 Bacteria 791
319 Ga0495687_002219 3300047443 Bacteria 16044
320 Ga0495687_004479 3300047443 Bacteria 9408
321 Ga0495687_075031 3300047443 Bacteria 1342
322 Ga0495687_084145 3300047443 Bacteria 1237
323 Ga0495687_133718 3300047443 Bacteria 873
324 Ga0495675_0012667 3300047444 Bacteria 5307
325 Ga0495675_0671064 3300047444 Bacteria 582
326 Ga0495685_007135 3300047447 Bacteria 3682
327 Ga0495685_010341 3300047447 Bacteria 3126
328 Ga0495685_022884 3300047447 Bacteria 2150
329 Ga0495685_060857 3300047447 Bacteria 1272
330 Ga0495685_121956 3300047447 Bacteria 855
331 Ga0495681_0006687 3300047470 Bacteria 7526
332 Ga0495681_0042176 3300047470 Bacteria 2210
333 Ga0495684_0134375 3300047471 Bacteria 1857
334 Ga0495684_0392550 3300047471 Bacteria 976
335 Ga0495686_0194694 3300047472 Bacteria 1166
336 Ga0495686_0236003 3300047472 Bacteria 1033
337 Ga0495593_0007913 3300047673 Bacteria 6192
338 Ga0495593_0026169 3300047673 Bacteria 3224
339 Ga0495593_0155245 3300047673 Bacteria 1157
340 Ga0495593_0299659 3300047673 Bacteria 803
341 Ga0495602_0013280 3300048088 Bacteria 8424
342 Ga0495614_0001522 3300048089 Bacteria 10051
343 Ga0495614_0001594 3300048089 Bacteria 9849
344 Ga0495614_0013338 3300048089 Bacteria 3604
345 Ga0495614_0050110 3300048089 Bacteria 1789
346 Ga0495614_0410299 3300048089 Bacteria 637
347 Ga0495626_0140297 3300048091 Bacteria 1025
348 Ga0496102_1108891 3300048905 Bacteria 711
349 Ga0496106_0068138 3300048909 Bacteria 2714
350 Ga0496109_1108460 3300048912 Bacteria 728
351 Ga0495678_175064 3300049459 Bacteria 676
352 Ga0495682_0174463 3300049460 Bacteria 764
353 Ga0501323_058246 3300049539 Bacteria 599
354 Ga0501031_0046952 3300049568 Bacteria 2815
355 Ga0501031_0121228 3300049568 Bacteria 1708
356 Ga0501031_0269730 3300049568 Bacteria 1105
357 Ga0501032_0014091 3300049569 Bacteria 5669
358 Ga0501032_0019651 3300049569 Bacteria 4721
359 Ga0501032_0295536 3300049569 Bacteria 1047
360 Ga0501033_0013532 3300049570 Bacteria 6211
361 Ga0501033_0062687 3300049570 Bacteria 2737
362 Ga0501033_0084950 3300049570 Bacteria 2319
363 Ga0501034_0004564 3300049571 Bacteria 15362
364 Ga0501034_0015742 3300049571 Bacteria 7765
365 Ga0501034_0023390 3300049571 Bacteria 6296
366 Ga0501034_0058859 3300049571 Bacteria 3860
367 Ga0501034_0340641 3300049571 Bacteria 1429
368 Ga0501034_0470277 3300049571 Bacteria 1173
369 Ga0501036_0001770 3300049572 Bacteria 16765
370 Ga0501036_0018976 3300049572 Bacteria 5769
371 Ga0501036_0030186 3300049572 Bacteria 4580
372 Ga0501036_0032867 3300049572 Bacteria 4386
373 Ga0501036_0087148 3300049572 Bacteria 2639
374 Ga0501036_1402038 3300049572 Bacteria 566
375 Ga0501037_0008049 3300049573 Bacteria 7723
376 Ga0501037_0033377 3300049573 Bacteria 3801
377 Ga0501037_0047470 3300049573 Bacteria 3147
378 Ga0501037_0092516 3300049573 Bacteria 2187
379 Ga0501038_0027856 3300049574 Bacteria 5021
380 Ga0501038_0031773 3300049574 Bacteria 4663
381 Ga0501038_0063005 3300049574 Bacteria 3167
382 Ga0501038_0313941 3300049574 Bacteria 1228
383 Ga0501039_0004423 3300049575 Bacteria 10607
384 Ga0501039_0024430 3300049575 Bacteria 4642
385 Ga0501039_0025988 3300049575 Bacteria 4500
386 Ga0501039_0215730 3300049575 Bacteria 1509
387 Ga0501040_0075810 3300049576 Bacteria 2324
388 Ga0501041_0001446 3300049577 Bacteria 13128
389 Ga0501042_0071421 3300049578 Bacteria 2483
390 Ga0501042_0160214 3300049578 Bacteria 1623
391 Ga0501043_0004139 3300049579 Bacteria 11852
392 Ga0501043_0011228 3300049579 Bacteria 7015
393 Ga0501043_0022747 3300049579 Bacteria 4916
394 Ga0501046_0017693 3300049580 Bacteria 5944
395 Ga0501046_0032459 3300049580 Bacteria 4228
396 Ga0501046_0413132 3300049580 Bacteria 973
397 Ga0501046_0428545 3300049580 Bacteria 953
398 Ga0501047_0007180 3300049581 Bacteria 10470
399 Ga0501047_0011699 3300049581 Bacteria 8296
400 Ga0501047_0015121 3300049581 Bacteria 7347
401 Ga0501047_0018861 3300049581 Bacteria 6616
402 Ga0501047_0029719 3300049581 Bacteria 5268
403 Ga0501047_0097537 3300049581 Bacteria 2817
404 Ga0501047_0411284 3300049581 Bacteria 1185
405 Ga0501048_0016631 3300049582 Bacteria 5423
406 Ga0501048_0020600 3300049582 Bacteria 4832
407 Ga0501048_0134259 3300049582 Bacteria 1748
408 Ga0501067_0001781 3300049583 Bacteria 11835
409 Ga0501068_0035025 3300049584 Bacteria 2995
410 Ga0501068_0677277 3300049584 Bacteria 674
411 Ga0501069_0004294 3300049585 Bacteria 7368
412 Ga0501070_0003747 3300049586 Bacteria 13127
413 Ga0501070_0047949 3300049586 Bacteria 3549
414 Ga0501070_0313645 3300049586 Bacteria 1276
415 Ga0501070_0490041 3300049586 Bacteria 988
416 Ga0501070_0883562 3300049586 Bacteria 698
417 Ga0501071_0009771 3300049587 Bacteria 6401
418 Ga0501072_0006345 3300049588 Bacteria 9007
419 Ga0501072_0740013 3300049588 Bacteria 772
420 Ga0501073_0066016 3300049589 Bacteria 2522
421 Ga0501074_0001410 3300049590 Bacteria 16005
422 Ga0501074_0157226 3300049590 Bacteria 1623
423 Ga0501074_1078571 3300049590 Bacteria 564
424 Ga0501076_0017192 3300049592 Bacteria 5494
425 Ga0501077_0021341 3300049593 Bacteria 4098
426 Ga0501079_0030211 3300049741 Bacteria 4163
427 Ga0501080_0099173 3300049742 Bacteria 2703
428 Ga0501080_0894975 3300049742 Bacteria 774
429 Ga0501083_0081592 3300049744 Bacteria 2144
430 Ga0501282_024154 3300049778 Bacteria 676
431 Ga0501035_0004400 3300049822 Bacteria 13370
432 Ga0501035_0007135 3300049822 Bacteria 10447
433 Ga0501035_0049003 3300049822 Bacteria 3786
434 Ga0501035_0462340 3300049822 Bacteria 1048
435 Ga0501035_0629874 3300049822 Bacteria 871
436 Ga0501035_0784253 3300049822 Bacteria 762
437 Ga0501044_0002238 3300049823 Bacteria 22150
438 Ga0501044_0005962 3300049823 Bacteria 13485
439 Ga0501044_0011218 3300049823 Bacteria 9716
440 Ga0501044_0025051 3300049823 Bacteria 6326
441 Ga0501044_0118716 3300049823 Bacteria 2647
442 Ga0501044_0383667 3300049823 Bacteria 1320
443 Ga0501044_0674994 3300049823 Bacteria 920
444 Ga0501044_0775416 3300049823 Bacteria 839
445 Ga0501044_0939491 3300049823 Bacteria 738
446 Ga0501045_0147287 3300049824 Bacteria 1751
447 Ga0501045_0637688 3300049824 Bacteria 788
448 nmdc:mga03n38_23917_c1 3300050490 Bacteria 2492
449 nmdc:mga06z11_1765_c1 3300050494 Bacteria 8126
450 nmdc:mga04h51_1026_c1 3300050495 Bacteria 6435
451 nmdc:mga07m45_124203_c1 3300050496 Bacteria 1492
452 Ga0495612_0040456 3300053078 Bacteria 1899
453 Ga0500610_0081091 3300053079 Bacteria 1691
454 Ga0495619_0167500 3300053085 Bacteria 1519
455 Ga0500644_0033619 3300053088 Bacteria 1647
456 Ga0500583_0143116 3300053092 Bacteria 1189
457 Ga0500640_017816 3300053095 Bacteria 3020
458 Ga0500560_002741 3300053107 Bacteria 3437
459 Ga0500573_0003725 3300053140 Bacteria 7930
460 Ga0500573_0229431 3300053140 Bacteria 969
461 Ga0500600_0084064 3300053149 Bacteria 1714
462 Ga0500624_004260 3300053157 Bacteria 1877
463 Ga0501084_0013860 3300054114 Bacteria 6672
464 Ga0501084_0383374 3300054114 Bacteria 1188
465 Ga0501084_1171462 3300054114 Bacteria 645
466 Ga0501084_1403711 3300054114 Bacteria 585
467 Ga0501082_0006415 3300060353 Bacteria 10203
468 Ga0501082_0516931 3300060353 Bacteria 1044
469 Ga0466962_0002417 3300061719 Bacteria 8859
470 Ga0466962_0016465 3300061719 Bacteria 3567
471 Ga0530510_0040106 3300061734 Bacteria 3379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_12294303 Ga0105243_122943031 128
2 3300005334 Ga0068869_100366384 Ga0068869_1003663842 132
3 3300005338 Ga0068868_100051154 Ga0068868_1000511542 132
4 3300005366 Ga0070659_100016483 Ga0070659_1000164832 132
5 3300003316 rootH1_10039667 rootH1_100396672 139
6 3300003320 rootH2_10022151 rootH2_100221515 139
7 3300003323 rootH1_10018153 rootH1_100181533 139
8 3300003323 rootH1_10024636 rootH1_100246362 139
9 3300031456 Ga0307513_10000030 Ga0307513_10000030136 140
10 3300041498 Ga0451841_0643032 Ga0451841_0643032_66_512 140
11 3300049824 Ga0501045_0637688 Ga0501045_0637688_67_537 141
12 iso_pu_bacteria 2643221647 2644270988 141
13 iso_pu_bacteria 2784746768 2785367809 141
14 iso_pu_bacteria 2786546132 2786668853 141
15 iso_pu_bacteria 2862574272 2862583099 141
16 iso_pu_bacteria 2867428634 2867435400 141
17 iso_pu_bacteria 2877676314 2877682749 141
18 iso_pu_bacteria 2954380949 2954387942 141
19 iso_pu_bacteria 2954673503 2954675132 141
20 iso_pu_bacteria 2954682443 2954689003 141
21 iso_pu_bacteria 2954691527 2954698752 141
22 iso_pu_bacteria 2954701450 2954703470 141
23 iso_pu_bacteria 2954711539 2954717726 141
24 iso_pu_bacteria 2954721474 2954727693 141
25 iso_pu_bacteria 2954731030 2954734109 141
26 iso_pu_bacteria 2954740390 2954746585 141
27 iso_pu_bacteria 2954749733 2954752994 141
28 iso_pu_bacteria 2954759201 2954765703 141
29 iso_pu_bacteria 3006425503 3006426435 141
30 iso_pu_bacteria 8056447290 8056450066 141
31 iso_pu_bacteria 8056667051 8056667661 141
32 3300042008 Ga0439450_065209 Ga0439450_065209_401_853 142
33 3300046516 Ga0495628_1016394 Ga0495628_1016394_13_501 142
34 3300060353 Ga0501082_0516931 Ga0501082_0516931_22_480 142
35 iso_pu_bacteria 2582581313 2585306671 142
36 iso_pu_bacteria 2954002825 2954004485 142
37 iso_pu_bacteria 3006486233 3006491011 142
38 3300031911 Ga0307412_11655321 Ga0307412_116553212 143
39 iso_pu_bacteria 2802429296 2804844277 143
40 iso_pu_bacteria 2862178590 2862183095 143
41 iso_pu_bacteria 2867475112 2867475956 143
42 iso_pu_bacteria 2935390628 2935395579 143
43 iso_pu_bacteria 2997451912 2997458668 143
44 iso_pu_bacteria 8025413630 8025417058 143
45 iso_pu_bacteria 8054160619 8054163551 143
46 3300041405 Ga0439438_113308 Ga0439438_113308_100_558 144
47 3300042007 Ga0439449_0084696 Ga0439449_0084696_432_890 144
48 3300049569 Ga0501032_0295536 Ga0501032_0295536_158_640 144
49 3300049822 Ga0501035_0462340 Ga0501035_0462340_158_640 144
50 3300049823 Ga0501044_0775416 Ga0501044_0775416_143_625 144
51 iso_pu_bacteria 2582581312 2585302182 144
52 iso_pu_bacteria 2616644941 2616899300 144
53 iso_pu_bacteria 2643221548 2643759186 144
54 iso_pu_bacteria 2643221578 2643897240 144
55 iso_pu_bacteria 2643221673 2644408385 144
56 iso_pu_bacteria 2643221682 2644463396 144
57 iso_pu_bacteria 2808606982 2811847470 144
58 iso_pu_bacteria 2818991463 2819694237 144
59 iso_pu_bacteria 2875391855 2875393182 144
60 iso_pu_bacteria 2946045630 2946051508 144
61 iso_pu_bacteria 2966598605 2966603864 144
62 iso_pu_bacteria 3006321560 3006323317 144
63 3300006948 Ga0099826_10172169 Ga0099826_101721691 145
64 3300009011 Ga0105251_10025034 Ga0105251_100250341 145
65 3300013308 Ga0157375_10624070 Ga0157375_106240702 145
66 3300025735 Ga0207713_1081291 Ga0207713_10812911 145
67 3300026035 Ga0207703_10781776 Ga0207703_107817762 145
68 3300027312 Ga0209371_1020785 Ga0209371_10207852 145
69 3300030521 Ga0307511_10018908 Ga0307511_100189083 145
70 3300031616 Ga0307508_10027794 Ga0307508_100277941 145
71 3300042005 Ga0439448_0028994 Ga0439448_0028994_61_522 145
72 3300042012 Ga0439455_0024172 Ga0439455_0024172_762_1223 145
73 3300042016 Ga0439463_114933 Ga0439463_114933_222_683 145
74 3300042138 Ga0450903_006498 Ga0450903_006498_1009_1470 145
75 3300042157 Ga0439458_0066737 Ga0439458_0066737_45_506 145
76 3300046455 Ga0495603_0002340 Ga0495603_0002340_9928_10389 145
77 3300046455 Ga0495603_0016445 Ga0495603_0016445_3751_4212 145
78 3300046455 Ga0495603_0133439 Ga0495603_0133439_659_1120 145
79 3300046459 Ga0495629_0076406 Ga0495629_0076406_1320_1781 145
80 3300046460 Ga0495638_0041363 Ga0495638_0041363_2229_2690 145
81 3300046473 Ga0495582_0040544 Ga0495582_0040544_175_636 145
82 3300046475 Ga0495639_0003779 Ga0495639_0003779_738_1199 145
83 3300046476 Ga0495662_0045722 Ga0495662_0045722_1458_1919 145
84 3300046476 Ga0495662_0055260 Ga0495662_0055260_1310_1771 145
85 3300046492 Ga0495585_0102112 Ga0495585_0102112_812_1273 145
86 3300046499 Ga0495594_0161133 Ga0495594_0161133_786_1247 145
87 3300046499 Ga0495594_0383175 Ga0495594_0383175_175_636 145
88 3300046515 Ga0495620_0080204 Ga0495620_0080204_436_897 145
89 3300046517 Ga0495630_0211068 Ga0495630_0211068_901_1362 145
90 3300046518 Ga0495631_0306941 Ga0495631_0306941_202_663 145
91 3300046518 Ga0495631_0456890 Ga0495631_0456890_53_514 145
92 3300046522 Ga0495643_0171198 Ga0495643_0171198_534_995 145
93 3300046524 Ga0495648_0277478 Ga0495648_0277478_264_725 145
94 3300046528 Ga0495642_0127156 Ga0495642_0127156_609_1070 145
95 3300046528 Ga0495642_0193341 Ga0495642_0193341_286_747 145
96 3300046535 Ga0495586_0256827 Ga0495586_0256827_231_692 145
97 3300046557 Ga0495622_0083555 Ga0495622_0083555_399_860 145
98 3300046615 Ga0495656_0062120 Ga0495656_0062120_25_486 145
99 3300046660 Ga0495625_0189598 Ga0495625_0189598_370_831 145
100 3300046674 Ga0495588_0005625 Ga0495588_0005625_1667_2128 145
101 3300046675 Ga0495657_0004721 Ga0495657_0004721_10341_10802 145
102 3300046689 Ga0495613_0042333 Ga0495613_0042333_1574_2035 145
103 3300046689 Ga0495613_0568284 Ga0495613_0568284_123_584 145
104 3300046691 Ga0495670_0020448 Ga0495670_0020448_2624_3085 145
105 3300046691 Ga0495670_0309508 Ga0495670_0309508_251_712 145
106 3300046794 Ga0495589_0009342 Ga0495589_0009342_2147_2608 145
107 3300046794 Ga0495589_0027281 Ga0495589_0027281_1991_2452 145
108 3300046794 Ga0495589_0059338 Ga0495589_0059338_1068_1529 145
109 3300046794 Ga0495589_0186938 Ga0495589_0186938_467_928 145
110 3300047315 Ga0495581_0146683 Ga0495581_0146683_388_849 145
111 3300047315 Ga0495581_0468363 Ga0495581_0468363_27_488 145
112 3300047318 Ga0495636_0029901 Ga0495636_0029901_1523_1984 145
113 3300047321 Ga0495676_0051787 Ga0495676_0051787_1259_1720 145
114 3300047321 Ga0495676_0096151 Ga0495676_0096151_206_667 145
115 3300047323 Ga0495683_0154815 Ga0495683_0154815_379_840 145
116 3300047443 Ga0495687_084145 Ga0495687_084145_458_919 145
117 3300047444 Ga0495675_0012667 Ga0495675_0012667_568_1029 145
118 3300047447 Ga0495685_007135 Ga0495685_007135_615_1076 145
119 3300047447 Ga0495685_022884 Ga0495685_022884_904_1365 145
120 3300047447 Ga0495685_121956 Ga0495685_121956_313_774 145
121 3300047673 Ga0495593_0155245 Ga0495593_0155245_609_1070 145
122 3300048089 Ga0495614_0410299 Ga0495614_0410299_47_508 145
123 3300048912 Ga0496109_1108460 Ga0496109_1108460_87_548 145
124 3300049586 Ga0501070_0490041 Ga0501070_0490041_62_523 145
125 3300049590 Ga0501074_1078571 Ga0501074_1078571_35_496 145
126 iso_pu_bacteria 2873151551 2873157145 145
127 iso_pu_bacteria 3006393351 3006396051 145
128 iso_pu_bacteria 8025478263 8025479254 145
129 3300041453 Ga0451797_1047328 Ga0451797_1047328_29_493 146
130 3300041507 Ga0451851_0621849 Ga0451851_0621849_126_590 146
131 3300041512 Ga0451853_1330357 Ga0451853_1330357_157_621 146
132 3300041512 Ga0451853_1587073 Ga0451853_1587073_728_1192 146
133 iso_pu_bacteria 2862290372 2862297313 146
134 3300003354 JGI25160J50197_1042123 JGI25160J50197_10421231 147
135 3300003354 JGI25160J50197_1042633 JGI25160J50197_10426332 147
136 3300003578 Ga0006562J51391_1051187 Ga0006562J51391_10511871 147
137 3300025302 Ga0207426_1001638 Ga0207426_10016382 147
138 3300025302 Ga0207426_1024329 Ga0207426_10243291 147
139 3300025302 Ga0207426_1045924 Ga0207426_10459241 147
140 3300028794 Ga0307515_10180449 Ga0307515_101804492 147
141 3300031456 Ga0307513_10031878 Ga0307513_100318781 147
142 3300031649 Ga0307514_10262010 Ga0307514_102620101 147
143 3300031852 Ga0307410_10037089 Ga0307410_100370891 147
144 3300031995 Ga0307409_100270324 Ga0307409_1002703242 147
145 3300046459 Ga0495629_0009300 Ga0495629_0009300_2375_2845 147
146 3300046499 Ga0495594_0001101 Ga0495594_0001101_1752_2222 147
147 3300046674 Ga0495588_0008317 Ga0495588_0008317_1445_1915 147
148 3300047321 Ga0495676_0016165 Ga0495676_0016165_2248_2718 147
149 3300049586 Ga0501070_0883562 Ga0501070_0883562_221_688 147
150 iso_pu_bacteria 2784132148 2784587264 147
151 iso_pu_bacteria 2912757875 2912759385 147
152 iso_pu_bacteria 8025530807 8025535502 147
153 3300003354 JGI25160J50197_1024160 JGI25160J50197_10241601 148
154 3300005466 Ga0070685_10336385 Ga0070685_103363852 148
155 3300011119 Ga0105246_10594710 Ga0105246_105947102 148
156 3300015265 Ga0182005_1227135 Ga0182005_12271351 148
157 3300025302 Ga0207426_1008848 Ga0207426_10088481 148
158 3300031616 Ga0307508_10022615 Ga0307508_100226153 148
159 3300031730 Ga0307516_10078914 Ga0307516_100789141 148
160 3300042146 Ga0450907_019432 Ga0450907_019432_387_860 148
161 3300044901 Ga0466960_0576253 Ga0466960_0576253_130_618 148
162 3300046455 Ga0495603_0132246 Ga0495603_0132246_321_791 148
163 3300046459 Ga0495629_0001976 Ga0495629_0001976_1375_1845 148
164 3300046492 Ga0495585_0011131 Ga0495585_0011131_321_794 148
165 3300046492 Ga0495585_0241661 Ga0495585_0241661_35_505 148
166 3300046523 Ga0495644_0120767 Ga0495644_0120767_350_820 148
167 3300046533 Ga0495640_0021333 Ga0495640_0021333_3346_3819 148
168 3300046557 Ga0495622_0391286 Ga0495622_0391286_73_543 148
169 3300046557 Ga0495622_0484890 Ga0495622_0484890_40_510 148
170 3300046648 Ga0495611_0009386 Ga0495611_0009386_403_873 148
171 3300046689 Ga0495613_0002714 Ga0495613_0002714_1915_2385 148
172 3300046689 Ga0495613_0353236 Ga0495613_0353236_399_872 148
173 3300046794 Ga0495589_0469446 Ga0495589_0469446_68_541 148
174 3300047317 Ga0495604_0007492 Ga0495604_0007492_4227_4700 148
175 3300047321 Ga0495676_0003672 Ga0495676_0003672_1388_1858 148
176 3300047323 Ga0495683_0244300 Ga0495683_0244300_287_757 148
177 3300047673 Ga0495593_0299659 Ga0495593_0299659_265_735 148
178 3300048089 Ga0495614_0001594 Ga0495614_0001594_1403_1873 148
179 3300048909 Ga0496106_0068138 Ga0496106_0068138_43_513 148
180 3300049539 Ga0501323_058246 Ga0501323_058246_106_576 148
181 3300049568 Ga0501031_0046952 Ga0501031_0046952_700_1173 148
182 3300049569 Ga0501032_0014091 Ga0501032_0014091_3554_4027 148
183 3300049570 Ga0501033_0062687 Ga0501033_0062687_1686_2159 148
184 3300049571 Ga0501034_0023390 Ga0501034_0023390_5124_5597 148
185 3300049572 Ga0501036_0018976 Ga0501036_0018976_2450_2923 148
186 3300049572 Ga0501036_1402038 Ga0501036_1402038_11_484 148
187 3300049573 Ga0501037_0033377 Ga0501037_0033377_1558_2031 148
188 3300049574 Ga0501038_0031773 Ga0501038_0031773_1330_1803 148
189 3300049575 Ga0501039_0025988 Ga0501039_0025988_3328_3801 148
190 3300049576 Ga0501040_0075810 Ga0501040_0075810_22_495 148
191 3300049577 Ga0501041_0001446 Ga0501041_0001446_181_654 148
192 3300049578 Ga0501042_0160214 Ga0501042_0160214_700_1173 148
193 3300049579 Ga0501043_0011228 Ga0501043_0011228_3554_4027 148
194 3300049580 Ga0501046_0017693 Ga0501046_0017693_3022_3495 148
195 3300049580 Ga0501046_0032459 Ga0501046_0032459_1726_2199 148
196 3300049581 Ga0501047_0011699 Ga0501047_0011699_2499_2972 148
197 3300049581 Ga0501047_0411284 Ga0501047_0411284_670_1143 148
198 3300049582 Ga0501048_0020600 Ga0501048_0020600_1513_1986 148
199 3300049583 Ga0501067_0001781 Ga0501067_0001781_5452_5925 148
200 3300049584 Ga0501068_0035025 Ga0501068_0035025_2364_2837 148
201 3300049585 Ga0501069_0004294 Ga0501069_0004294_1830_2303 148
202 3300049586 Ga0501070_0047949 Ga0501070_0047949_1519_1992 148
203 3300049587 Ga0501071_0009771 Ga0501071_0009771_5071_5544 148
204 3300049588 Ga0501072_0006345 Ga0501072_0006345_3089_3562 148
205 3300049589 Ga0501073_0066016 Ga0501073_0066016_1542_2015 148
206 3300049590 Ga0501074_0157226 Ga0501074_0157226_700_1173 148
207 3300049592 Ga0501076_0017192 Ga0501076_0017192_1822_2295 148
208 3300049593 Ga0501077_0021341 Ga0501077_0021341_2605_3078 148
209 3300049741 Ga0501079_0030211 Ga0501079_0030211_1686_2159 148
210 3300049744 Ga0501083_0081592 Ga0501083_0081592_1583_2056 148
211 3300049822 Ga0501035_0049003 Ga0501035_0049003_453_926 148
212 3300049823 Ga0501044_0002238 Ga0501044_0002238_17071_17544 148
213 3300049824 Ga0501045_0147287 Ga0501045_0147287_579_1052 148
214 3300054114 Ga0501084_0013860 Ga0501084_0013860_5500_5973 148
215 3300060353 Ga0501082_0006415 Ga0501082_0006415_5899_6372 148
216 3300061734 Ga0530510_0040106 Ga0530510_0040106_2859_3332 148
217 iso_pu_bacteria 2784746763 2785345075 148
218 iso_pu_bacteria 2811994917 2812481825 148
219 iso_pu_bacteria 8048406513 8048409996 148
220 3300013308 Ga0157375_11247477 Ga0157375_112474771 149
221 3300049823 Ga0501044_0939491 Ga0501044_0939491_173_652 149
222 3300053140 Ga0500573_0003725 Ga0500573_0003725_2399_2875 149
223 3300053149 Ga0500600_0084064 Ga0500600_0084064_1032_1505 149
224 iso_pu_bacteria 2616644814 2616694148 149
225 iso_pu_bacteria 2643221587 2643945294 149
226 iso_pu_bacteria 2643221670 2644387510 149
227 iso_pu_bacteria 2643221677 2644432193 149
228 iso_pu_bacteria 2862382967 2862390562 149
229 iso_pu_bacteria 8008558824 8008561974 149
230 3300005337 Ga0070682_101261287 Ga0070682_1012612871 150
231 3300005539 Ga0068853_100208871 Ga0068853_1002088712 150
232 3300031824 Ga0307413_10172383 Ga0307413_101723832 150
233 3300032005 Ga0307411_10773048 Ga0307411_107730482 150
234 3300044765 Ga0466970_0016755 Ga0466970_0016755_100_639 150
235 3300049571 Ga0501034_0470277 Ga0501034_0470277_613_1089 150
236 3300049572 Ga0501036_0087148 Ga0501036_0087148_1970_2446 150
237 3300049573 Ga0501037_0092516 Ga0501037_0092516_1117_1593 150
238 3300049575 Ga0501039_0215730 Ga0501039_0215730_484_960 150
239 3300049580 Ga0501046_0428545 Ga0501046_0428545_353_829 150
240 3300049581 Ga0501047_0007180 Ga0501047_0007180_6035_6511 150
241 3300049584 Ga0501068_0677277 Ga0501068_0677277_111_587 150
242 3300049588 Ga0501072_0740013 Ga0501072_0740013_190_666 150
243 3300049742 Ga0501080_0099173 Ga0501080_0099173_648_1124 150
244 3300049778 Ga0501282_024154 Ga0501282_024154_182_658 150
245 3300049822 Ga0501035_0784253 Ga0501035_0784253_120_596 150
246 3300049823 Ga0501044_0025051 Ga0501044_0025051_2979_3455 150
247 3300054114 Ga0501084_1171462 Ga0501084_1171462_100_576 150
248 iso_pu_bacteria 2547132111 2547409713 150
249 iso_pu_bacteria 2554235005 2554259082 150
250 iso_pu_bacteria 2582581314 2585314226 150
251 iso_pu_bacteria 2643221714 2644629517 150
252 iso_pu_bacteria 2808606359 2808848272 150
253 iso_pu_bacteria 2808606375 2808919045 150
254 iso_pu_bacteria 2808606448 2809230836 150
255 iso_pu_bacteria 2811994879 2812359718 150
256 iso_pu_bacteria 2852635781 2852638303 150
257 iso_pu_bacteria 2862281513 2862288830 150
258 iso_pu_bacteria 2862507626 2862513656 150
259 iso_pu_bacteria 2863404153 2863406333 150
260 iso_pu_bacteria 2912723979 2912725599 150
261 iso_pu_bacteria 2918501144 2918503065 150
262 iso_pu_bacteria 2919468124 2919473089 150
263 iso_pu_bacteria 2946064051 2946066192 150
264 iso_pu_bacteria 2946072368 2946074465 150
265 iso_pu_bacteria 2947224130 2947231183 150
266 iso_pu_bacteria 2990059506 2990064836 150
267 iso_pu_bacteria 3006493962 3006495426 150
268 iso_pu_bacteria 8008574985 8008580197 150
269 iso_pu_bacteria 8023623736 8023631292 150
270 iso_pu_bacteria 8047893842 8047899736 150
271 iso_pu_bacteria 8048127548 8048135164 150
272 iso_pu_bacteria 8048356638 8048359194 150
273 iso_pu_bacteria 8048369669 8048376684 150
274 iso_pu_bacteria 8048379754 8048385737 150
275 iso_pu_bacteria 8056829672 8056831108 150
276 3300049568 Ga0501031_0269730 Ga0501031_0269730_103_591 151
277 3300049570 Ga0501033_0013532 Ga0501033_0013532_55_543 151
278 3300049571 Ga0501034_0340641 Ga0501034_0340641_556_1044 151
279 3300049573 Ga0501037_0047470 Ga0501037_0047470_1227_1715 151
280 3300049580 Ga0501046_0413132 Ga0501046_0413132_228_716 151
281 3300049581 Ga0501047_0015121 Ga0501047_0015121_2894_3382 151
282 3300049582 Ga0501048_0134259 Ga0501048_0134259_605_1093 151
283 3300049823 Ga0501044_0118716 Ga0501044_0118716_599_1087 151
284 3300006178 Ga0075367_10555418 Ga0075367_105554181 152
285 3300041406 Ga0439439_0005444 Ga0439439_0005444_1459_1944 152
286 3300042007 Ga0439449_0265913 Ga0439449_0265913_16_501 152
287 3300042014 Ga0439457_000609 Ga0439457_000609_4912_5397 152
288 3300042533 Ga0450901_006271 Ga0450901_006271_10_501 152
289 3300048905 Ga0496102_1108891 Ga0496102_1108891_19_504 152
290 3300032002 Ga0307416_100746648 Ga0307416_1007466481 153
291 3300042007 Ga0439449_0000255 Ga0439449_0000255_10831_11316 153
292 3300045976 Ga0466967_1731070 Ga0466967_1731070_98_586 153
293 3300046452 Ga0495617_021962 Ga0495617_021962_1400_1885 153
294 3300046453 Ga0495627_040572 Ga0495627_040572_188_673 153
295 3300046454 Ga0495592_0080787 Ga0495592_0080787_1754_2239 153
296 3300046455 Ga0495603_0075165 Ga0495603_0075165_1148_1633 153
297 3300046457 Ga0495590_0071728 Ga0495590_0071728_411_896 153
298 3300046459 Ga0495629_0316880 Ga0495629_0316880_398_883 153
299 3300046460 Ga0495638_0075567 Ga0495638_0075567_1324_1809 153
300 3300046462 Ga0495651_0026499 Ga0495651_0026499_393_878 153
301 3300046472 Ga0495580_0141993 Ga0495580_0141993_80_565 153
302 3300046474 Ga0495605_0081912 Ga0495605_0081912_236_721 153
303 3300046474 Ga0495605_0172882 Ga0495605_0172882_253_738 153
304 3300046477 Ga0495664_0076564 Ga0495664_0076564_971_1456 153
305 3300046491 Ga0495584_0153653 Ga0495584_0153653_25_510 153
306 3300046492 Ga0495585_0133009 Ga0495585_0133009_479_964 153
307 3300046500 Ga0495596_0286519 Ga0495596_0286519_43_528 153
308 3300046501 Ga0495607_0019364 Ga0495607_0019364_308_793 153
309 3300046506 Ga0495583_0091516 Ga0495583_0091516_213_698 153
310 3300046507 Ga0495606_0028005 Ga0495606_0028005_207_692 153
311 3300046511 Ga0495608_0189711 Ga0495608_0189711_123_608 153
312 3300046512 Ga0495610_0104936 Ga0495610_0104936_516_1001 153
313 3300046513 Ga0495616_0014808 Ga0495616_0014808_311_796 153
314 3300046516 Ga0495628_0091147 Ga0495628_0091147_66_551 153
315 3300046518 Ga0495631_0007075 Ga0495631_0007075_5232_5717 153
316 3300046519 Ga0495632_0191079 Ga0495632_0191079_259_744 153
317 3300046520 Ga0495637_0100289 Ga0495637_0100289_478_963 153
318 3300046522 Ga0495643_0007012 Ga0495643_0007012_6470_6955 153
319 3300046524 Ga0495648_0096162 Ga0495648_0096162_1138_1623 153
320 3300046526 Ga0495666_0070448 Ga0495666_0070448_140_625 153
321 3300046533 Ga0495640_0037356 Ga0495640_0037356_1278_1763 153
322 3300046538 Ga0495609_0103626 Ga0495609_0103626_257_742 153
323 3300046542 Ga0495597_0106661 Ga0495597_0106661_83_568 153
324 3300046557 Ga0495622_0019045 Ga0495622_0019045_731_1216 153
325 3300046558 Ga0495633_0162148 Ga0495633_0162148_339_824 153
326 3300046559 Ga0495667_0069994 Ga0495667_0069994_245_730 153
327 3300046616 Ga0495668_0168595 Ga0495668_0168595_249_734 153
328 3300046642 Ga0495634_0065476 Ga0495634_0065476_1345_1830 153
329 3300046663 Ga0495635_0005524 Ga0495635_0005524_751_1236 153
330 3300046665 Ga0495661_0054383 Ga0495661_0054383_1701_2186 153
331 3300046675 Ga0495657_0022748 Ga0495657_0022748_2119_2604 153
332 3300046675 Ga0495657_0067148 Ga0495657_0067148_986_1471 153
333 3300046678 Ga0495599_0255605 Ga0495599_0255605_176_661 153
334 3300046680 Ga0495646_0331773 Ga0495646_0331773_13_498 153
335 3300046689 Ga0495613_0037071 Ga0495613_0037071_721_1206 153
336 3300046689 Ga0495613_0128485 Ga0495613_0128485_766_1251 153
337 3300046689 Ga0495613_0695689 Ga0495613_0695689_12_497 153
338 3300046690 Ga0495624_0099836 Ga0495624_0099836_1132_1617 153
339 3300046690 Ga0495624_0168261 Ga0495624_0168261_392_877 153
340 3300046694 Ga0495649_0297272 Ga0495649_0297272_133_618 153
341 3300046694 Ga0495649_0365051 Ga0495649_0365051_136_621 153
342 3300046794 Ga0495589_0079936 Ga0495589_0079936_218_703 153
343 3300046809 Ga0495600_0192921 Ga0495600_0192921_317_802 153
344 3300046810 Ga0495660_0043215 Ga0495660_0043215_890_1375 153
345 3300046810 Ga0495660_0082737 Ga0495660_0082737_41_526 153
346 3300047317 Ga0495604_0101334 Ga0495604_0101334_1517_2002 153
347 3300047319 Ga0495674_0155988 Ga0495674_0155988_1001_1486 153
348 3300047321 Ga0495676_0073665 Ga0495676_0073665_405_890 153
349 3300047322 Ga0495680_0023148 Ga0495680_0023148_2486_2971 153
350 3300047323 Ga0495683_0097214 Ga0495683_0097214_45_530 153
351 3300047443 Ga0495687_075031 Ga0495687_075031_208_693 153
352 3300047443 Ga0495687_133718 Ga0495687_133718_268_753 153
353 3300047447 Ga0495685_060857 Ga0495685_060857_127_612 153
354 3300047470 Ga0495681_0042176 Ga0495681_0042176_122_607 153
355 3300047471 Ga0495684_0134375 Ga0495684_0134375_932_1417 153
356 3300047472 Ga0495686_0194694 Ga0495686_0194694_618_1103 153
357 3300047673 Ga0495593_0026169 Ga0495593_0026169_925_1410 153
358 3300048089 Ga0495614_0050110 Ga0495614_0050110_185_670 153
359 3300048091 Ga0495626_0140297 Ga0495626_0140297_227_712 153
360 3300049459 Ga0495678_175064 Ga0495678_175064_142_627 153
361 3300049460 Ga0495682_0174463 Ga0495682_0174463_50_535 153
362 3300049571 Ga0501034_0058859 Ga0501034_0058859_1491_1979 153
363 3300049572 Ga0501036_0030186 Ga0501036_0030186_2863_3351 153
364 3300049574 Ga0501038_0313941 Ga0501038_0313941_281_769 153
365 3300001989 JGI24739J22299_10059342 JGI24739J22299_100593421 154
366 3300001990 JGI24737J22298_10008960 JGI24737J22298_100089603 154
367 3300002075 JGI24738J21930_10067621 JGI24738J21930_100676212 154
368 3300003316 rootH1_10068310 rootH1_100683103 154
369 3300003578 Ga0006562J51391_1024697 Ga0006562J51391_10246972 154
370 3300005366 Ga0070659_100550014 Ga0070659_1005500142 154
371 3300005614 Ga0068856_101389533 Ga0068856_1013895331 154
372 3300005937 Ga0081455_10019246 Ga0081455_100192464 154
373 3300006048 Ga0075363_100066440 Ga0075363_1000664402 154
374 3300006178 Ga0075367_10001268 Ga0075367_100012686 154
375 3300006353 Ga0075370_10148109 Ga0075370_101481092 154
376 3300009036 Ga0105244_10271582 Ga0105244_102715821 154
377 3300009098 Ga0105245_10819573 Ga0105245_108195732 154
378 3300011119 Ga0105246_10028144 Ga0105246_100281442 154
379 3300013105 Ga0157369_10412033 Ga0157369_104120332 154
380 3300014497 Ga0182008_10001675 Ga0182008_100016755 154
381 3300015262 Ga0182007_10001128 Ga0182007_100011289 154
382 3300015265 Ga0182005_1138208 Ga0182005_11382082 154
383 3300015688 Ga0183367_1007 Ga0183367_1007279 154
384 3300025297 Ga0209758_1003871 Ga0209758_10038719 154
385 3300025302 Ga0207426_1063420 Ga0207426_10634202 154
386 3300025904 Ga0207647_10013318 Ga0207647_100133183 154
387 3300026078 Ga0207702_10854388 Ga0207702_108543882 154
388 3300028786 Ga0307517_10025700 Ga0307517_100257004 154
389 3300028794 Ga0307515_10003749 Ga0307515_100037499 154
390 3300028794 Ga0307515_10258441 Ga0307515_102584412 154
391 3300030500 Ga0268256_1019922 Ga0268256_10199221 154
392 3300030521 Ga0307511_10003571 Ga0307511_100035719 154
393 3300030521 Ga0307511_10024115 Ga0307511_100241154 154
394 3300030522 Ga0307512_10017856 Ga0307512_100178562 154
395 3300031456 Ga0307513_10070621 Ga0307513_100706213 154
396 3300031456 Ga0307513_10109430 Ga0307513_101094302 154
397 3300031507 Ga0307509_10050397 Ga0307509_100503973 154
398 3300031507 Ga0307509_10076423 Ga0307509_100764232 154
399 3300031507 Ga0307509_10458968 Ga0307509_104589682 154
400 3300031616 Ga0307508_10128228 Ga0307508_101282282 154
401 3300031616 Ga0307508_10190950 Ga0307508_101909502 154
402 3300031649 Ga0307514_10004349 Ga0307514_100043498 154
403 3300031730 Ga0307516_10004257 Ga0307516_1000425712 154
404 3300031730 Ga0307516_10034197 Ga0307516_100341972 154
405 3300031838 Ga0307518_10011865 Ga0307518_100118655 154
406 3300031838 Ga0307518_10137621 Ga0307518_101376212 154
407 3300031838 Ga0307518_10190048 Ga0307518_101900482 154
408 3300033179 Ga0307507_10018693 Ga0307507_100186933 154
409 3300033179 Ga0307507_10042910 Ga0307507_100429103 154
410 3300033180 Ga0307510_10012422 Ga0307510_100124222 154
411 3300033180 Ga0307510_10063329 Ga0307510_100633292 154
412 3300033180 Ga0307510_10121796 Ga0307510_101217961 154
413 3300033180 Ga0307510_10164911 Ga0307510_101649112 154
414 3300037418 Ga0395900_0673888 Ga0395900_0673888_43_534 154
415 3300037418 Ga0395900_0742731 Ga0395900_0742731_325_828 154
416 3300037466 Ga0395898_0009500 Ga0395898_0009500_3036_3527 154
417 3300037466 Ga0395898_0075987 Ga0395898_0075987_199_687 154
418 3300038443 Ga0395901_0278616 Ga0395901_0278616_1131_1622 154
419 3300038443 Ga0395901_1282041 Ga0395901_1282041_56_544 154
420 3300041404 Ga0439436_0005949 Ga0439436_0005949_3081_3569 154
421 3300041406 Ga0439439_0014973 Ga0439439_0014973_1106_1594 154
422 3300041494 Ga0451837_1269520 Ga0451837_1269520_319_807 154
423 3300041501 Ga0451845_0024019 Ga0451845_0024019_138_626 154
424 3300041512 Ga0451853_1921525 Ga0451853_1921525_159_647 154
425 3300041999 Ga0439433_0006138 Ga0439433_0006138_1259_1747 154
426 3300042002 Ga0439442_009565 Ga0439442_009565_406_894 154
427 3300042007 Ga0439449_0015638 Ga0439449_0015638_1432_1920 154
428 3300042007 Ga0439449_0155736 Ga0439449_0155736_16_504 154
429 3300042012 Ga0439455_0162534 Ga0439455_0162534_30_563 154
430 3300042014 Ga0439457_014962 Ga0439457_014962_217_705 154
431 3300042015 Ga0439462_0001054 Ga0439462_0001054_4162_4650 154
432 3300042131 Ga0450894_000132 Ga0450894_000132_8644_9132 154
433 3300042138 Ga0450903_008851 Ga0450903_008851_1025_1513 154
434 3300042145 Ga0450906_008897 Ga0450906_008897_836_1324 154
435 3300042184 Ga0450908_067830 Ga0450908_067830_75_563 154
436 3300044658 Ga0466972_0004589 Ga0466972_0004589_3784_4272 154
437 3300044658 Ga0466972_0006898 Ga0466972_0006898_3516_4004 154
438 3300044658 Ga0466972_0011830 Ga0466972_0011830_3782_4270 154
439 3300044658 Ga0466972_0033224 Ga0466972_0033224_1483_1974 154
440 3300044683 Ga0466965_0000990 Ga0466965_0000990_2417_2905 154
441 3300044683 Ga0466965_0037291 Ga0466965_0037291_651_1139 154
442 3300044684 Ga0466966_0001473 Ga0466966_0001473_12661_13149 154
443 3300044684 Ga0466966_0074812 Ga0466966_0074812_506_994 154
444 3300044693 Ga0466961_0002142 Ga0466961_0002142_11290_11778 154
445 3300044693 Ga0466961_0002762 Ga0466961_0002762_8461_8949 154
446 3300044693 Ga0466961_0120855 Ga0466961_0120855_989_1477 154
447 3300044693 Ga0466961_0516578 Ga0466961_0516578_62_550 154
448 3300044694 Ga0466963_0000222 Ga0466963_0000222_9832_10320 154
449 3300044706 Ga0466964_0043069 Ga0466964_0043069_1046_1534 154
450 3300044706 Ga0466964_0699502 Ga0466964_0699502_56_547 154
451 3300044719 Ga0466971_0000186 Ga0466971_0000186_6344_6832 154
452 3300044719 Ga0466971_0089705 Ga0466971_0089705_143_631 154
453 3300044735 Ga0466968_0061848 Ga0466968_0061848_933_1421 154
454 3300044735 Ga0466968_0144477 Ga0466968_0144477_35_523 154
455 3300044765 Ga0466970_0000510 Ga0466970_0000510_4703_5191 154
456 3300044842 Ga0466957_0000142 Ga0466957_0000142_15536_16024 154
457 3300044842 Ga0466957_1122986 Ga0466957_1122986_69_557 154
458 3300044901 Ga0466960_0015130 Ga0466960_0015130_2749_3237 154
459 3300045049 Ga0466959_0002283 Ga0466959_0002283_8632_9120 154
460 3300045049 Ga0466959_0376577 Ga0466959_0376577_56_544 154
461 3300045836 Ga0466958_0034285 Ga0466958_0034285_2123_2611 154
462 3300045836 Ga0466958_0320315 Ga0466958_0320315_57_548 154
463 3300045976 Ga0466967_0001081 Ga0466967_0001081_504_992 154
464 3300045976 Ga0466967_0066128 Ga0466967_0066128_2467_2955 154
465 3300045976 Ga0466967_0123856 Ga0466967_0123856_1433_1921 154
466 3300045976 Ga0466967_1054185 Ga0466967_1054185_229_735 154
467 3300046454 Ga0495592_0062435 Ga0495592_0062435_2026_2520 154
468 3300046459 Ga0495629_0011352 Ga0495629_0011352_1859_2347 154
469 3300046459 Ga0495629_0035615 Ga0495629_0035615_2670_3164 154
470 3300046460 Ga0495638_0043506 Ga0495638_0043506_505_993 154
471 3300046462 Ga0495651_0078704 Ga0495651_0078704_606_1100 154
472 3300046476 Ga0495662_0012504 Ga0495662_0012504_1527_2021 154
473 3300046477 Ga0495664_0020634 Ga0495664_0020634_1874_2368 154
474 3300046499 Ga0495594_0689729 Ga0495594_0689729_74_562 154
475 3300046514 Ga0495618_0034859 Ga0495618_0034859_855_1349 154
476 3300046516 Ga0495628_0032839 Ga0495628_0032839_100_594 154
477 3300046522 Ga0495643_0147027 Ga0495643_0147027_325_813 154
478 3300046529 Ga0495652_0061229 Ga0495652_0061229_627_1121 154
479 3300046535 Ga0495586_0024729 Ga0495586_0024729_2000_2494 154
480 3300046536 Ga0495587_0001745 Ga0495587_0001745_9603_10097 154
481 3300046543 Ga0495645_0345725 Ga0495645_0345725_271_765 154
482 3300046557 Ga0495622_0018349 Ga0495622_0018349_1550_2044 154
483 3300046642 Ga0495634_0003781 Ga0495634_0003781_8577_9071 154
484 3300046648 Ga0495611_0520206 Ga0495611_0520206_41_529 154
485 3300046660 Ga0495625_0009511 Ga0495625_0009511_6668_7156 154
486 3300046660 Ga0495625_0030296 Ga0495625_0030296_2895_3410 154
487 3300046663 Ga0495635_0002533 Ga0495635_0002533_1923_2417 154
488 3300046674 Ga0495588_0181970 Ga0495588_0181970_532_1020 154
489 3300046679 Ga0495623_0105579 Ga0495623_0105579_861_1355 154
490 3300046680 Ga0495646_0007939 Ga0495646_0007939_2500_2994 154
491 3300046683 Ga0495658_0009346 Ga0495658_0009346_3866_4360 154
492 3300046689 Ga0495613_0018528 Ga0495613_0018528_3447_3941 154
493 3300046692 Ga0495671_0004267 Ga0495671_0004267_1418_1906 154
494 3300046809 Ga0495600_0009397 Ga0495600_0009397_4502_4996 154
495 3300047315 Ga0495581_0013656 Ga0495581_0013656_2255_2749 154
496 3300047317 Ga0495604_0004721 Ga0495604_0004721_1797_2291 154
497 3300047319 Ga0495674_0068719 Ga0495674_0068719_1718_2212 154
498 3300047321 Ga0495676_0032194 Ga0495676_0032194_1945_2439 154
499 3300047443 Ga0495687_002219 Ga0495687_002219_14698_15186 154
500 3300047443 Ga0495687_004479 Ga0495687_004479_2143_2631 154
501 3300047444 Ga0495675_0671064 Ga0495675_0671064_37_531 154
502 3300047447 Ga0495685_010341 Ga0495685_010341_1461_1949 154
503 3300047470 Ga0495681_0006687 Ga0495681_0006687_329_817 154
504 3300047471 Ga0495684_0392550 Ga0495684_0392550_114_608 154
505 3300047472 Ga0495686_0236003 Ga0495686_0236003_408_896 154
506 3300047673 Ga0495593_0007913 Ga0495593_0007913_4290_4784 154
507 3300048088 Ga0495602_0013280 Ga0495602_0013280_5628_6122 154
508 3300048089 Ga0495614_0001522 Ga0495614_0001522_2132_2620 154
509 3300048089 Ga0495614_0013338 Ga0495614_0013338_951_1445 154
510 3300049568 Ga0501031_0121228 Ga0501031_0121228_903_1391 154
511 3300049569 Ga0501032_0019651 Ga0501032_0019651_76_564 154
512 3300049570 Ga0501033_0084950 Ga0501033_0084950_1526_2017 154
513 3300049571 Ga0501034_0004564 Ga0501034_0004564_6588_7079 154
514 3300049571 Ga0501034_0015742 Ga0501034_0015742_6622_7110 154
515 3300049572 Ga0501036_0001770 Ga0501036_0001770_6163_6654 154
516 3300049572 Ga0501036_0032867 Ga0501036_0032867_3217_3705 154
517 3300049573 Ga0501037_0008049 Ga0501037_0008049_5618_6106 154
518 3300049574 Ga0501038_0027856 Ga0501038_0027856_2569_3057 154
519 3300049574 Ga0501038_0063005 Ga0501038_0063005_1317_1808 154
520 3300049575 Ga0501039_0004423 Ga0501039_0004423_3195_3686 154
521 3300049575 Ga0501039_0024430 Ga0501039_0024430_4108_4596 154
522 3300049578 Ga0501042_0071421 Ga0501042_0071421_1484_1972 154
523 3300049579 Ga0501043_0004139 Ga0501043_0004139_3864_4352 154
524 3300049579 Ga0501043_0022747 Ga0501043_0022747_822_1313 154
525 3300049581 Ga0501047_0018861 Ga0501047_0018861_489_977 154
526 3300049581 Ga0501047_0029719 Ga0501047_0029719_2539_3030 154
527 3300049581 Ga0501047_0097537 Ga0501047_0097537_1596_2084 154
528 3300049582 Ga0501048_0016631 Ga0501048_0016631_1524_2012 154
529 3300049586 Ga0501070_0003747 Ga0501070_0003747_12558_13049 154
530 3300049586 Ga0501070_0313645 Ga0501070_0313645_202_690 154
531 3300049590 Ga0501074_0001410 Ga0501074_0001410_6075_6566 154
532 3300049742 Ga0501080_0894975 Ga0501080_0894975_91_579 154
533 3300049822 Ga0501035_0004400 Ga0501035_0004400_10284_10775 154
534 3300049822 Ga0501035_0007135 Ga0501035_0007135_3037_3525 154
535 3300049822 Ga0501035_0629874 Ga0501035_0629874_92_583 154
536 3300049823 Ga0501044_0005962 Ga0501044_0005962_8812_9300 154
537 3300049823 Ga0501044_0011218 Ga0501044_0011218_1525_2013 154
538 3300049823 Ga0501044_0383667 Ga0501044_0383667_391_882 154
539 3300049823 Ga0501044_0674994 Ga0501044_0674994_21_509 154
540 3300050490 nmdc:mga03n38_23917_c1 nmdc:mga03n38_23917_c1_506_994 154
541 3300050494 nmdc:mga06z11_1765_c1 nmdc:mga06z11_1765_c1_3803_4291 154
542 3300050495 nmdc:mga04h51_1026_c1 nmdc:mga04h51_1026_c1_1521_2009 154
543 3300050496 nmdc:mga07m45_124203_c1 nmdc:mga07m45_124203_c1_840_1328 154
544 3300053078 Ga0495612_0040456 Ga0495612_0040456_73_567 154
545 3300053079 Ga0500610_0081091 Ga0500610_0081091_875_1363 154
546 3300053085 Ga0495619_0167500 Ga0495619_0167500_918_1412 154
547 3300053088 Ga0500644_0033619 Ga0500644_0033619_144_632 154
548 3300053092 Ga0500583_0143116 Ga0500583_0143116_351_839 154
549 3300053095 Ga0500640_017816 Ga0500640_017816_1120_1614 154
550 3300053107 Ga0500560_002741 Ga0500560_002741_1438_1926 154
551 3300053140 Ga0500573_0229431 Ga0500573_0229431_354_848 154
552 3300053157 Ga0500624_004260 Ga0500624_004260_1195_1689 154
553 3300054114 Ga0501084_0383374 Ga0501084_0383374_201_689 154
554 3300054114 Ga0501084_1403711 Ga0501084_1403711_45_536 154
555 3300061719 Ga0466962_0002417 Ga0466962_0002417_441_929 154
556 3300061719 Ga0466962_0016465 Ga0466962_0016465_1307_1798 154
557 iso_pu_bacteria 2912715099 2912721767 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

77

154

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s4k-assembly1.cif.gz_A structure of a putative esterase rv1847/mt1895 from mycobacterium tuberculosis 0.9071 33 143
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.8924 32 142
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.8922 32 141
4qdb-assembly4.cif.gz_F crystal structure of mutant thioesterase pa1618 (q49a) from pseudomonas aeruginosa 0.8724 33 139
3lz7-assembly1.cif.gz_A crystal structure of thioesterase hi1161 ec3.1.2.- from haemophilus influenzae. orthorombic crystal form. northeast structural genomics consortium target ir63 0.8708 33 141
ID Description Score Start End Superfamily
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9065 33 143 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8918 32 141 3.10.129.10
af_Q9FI76_3_136_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8434 28 140 3.10.129.10
af_A0A0N7KK42_47_200_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8398 29 140 3.10.129.10
af_Q2FZ56_72_189_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8365 40 140 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1C0AI59-F1-model_v4 Aromatic compound degradation protein PaaI 0.9105 32 144 GO:0005829
GO:0061522
AF-A0A3D3YUM2-F1-model_v4 Aromatic compound degradation protein PaaI 0.9097 33 144 GO:0005829
GO:0061522
AF-A0A544ZQF4-F1-model_v4 Hotdog fold thioesterase 0.9096 32 143 GO:0005829
GO:0061522
AF-A0A5C8K171-F1-model_v4 Hotdog fold thioesterase 0.9094 37 142 GO:0005829
GO:0061522
AF-A0A357HGC7-F1-model_v4 Thioesterase 0.9086 33 143 GO:0005829
GO:0061522

Feature Viewer

pLDDT pTM Quality
82.73 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map