F463302
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 557 | 228 | 557 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100193511|Ga0075431_1001935112 |
| Length | 424 |
| Sequence | VQPLCSLCLCGEEIHGTTTTETQRTQRLYREELKLGHYTLEGSLNTTSFAVHESIGVKRIVLHRVRVPFLEPFRISNGVVAEKDAILIEITTDQGIVGWGEASPMSGSFYSADTPDSSWTVLKDEMVPALLSLRRVDGDEVHEFLRQQPGDAFSRAGIEGALWDAYANARGIALCELFGIEWRAVPSGVAIGIFETTDELIERVRRYVGEGYQRVKIKIQPGWDLEPVEFVRKQFPHLRLMVDANAAYTLRDLQVFRELDQFELMMIEQPLAASAIEEAGELQAQLKTPLCADESAESLASLEQIINNAAARIINIKVQRVGGLSAALVMLERTRSAGLQCWVGTMPELGIASAQGLHLAMHSGFSFPTDIEASSRWYVDDLVEPPLRIDEAGFIQVPRALGTGFKVVREKIDRYTTAVESFCL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 164 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 178 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 181 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 218 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.9 |
| Rhizosphere | 96.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10025006 | 3300003203 | Bacteria | 2327 |
| 2 | Ga0065704_10168727 | 3300005289 | Bacteria | 1305 |
| 3 | Ga0065704_10179851 | 3300005289 | Bacteria | 1243 |
| 4 | Ga0065712_10000115 | 3300005290 | Bacteria | 144502 |
| 5 | Ga0065712_10071107 | 3300005290 | Bacteria | 5480 |
| 6 | Ga0065715_10003032 | 3300005293 | Bacteria | 5905 |
| 7 | Ga0065715_10003978 | 3300005293 | Unclassified | 4025 |
| 8 | Ga0065715_10090451 | 3300005293 | Bacteria | 6980 |
| 9 | Ga0065715_10160211 | 3300005293 | Bacteria | 1637 |
| 10 | Ga0065707_10009392 | 3300005295 | Bacteria | 2395 |
| 11 | Ga0070658_10021836 | 3300005327 | Bacteria | 5131 |
| 12 | Ga0070658_10041318 | 3300005327 | Bacteria | 3720 |
| 13 | Ga0070658_10082218 | 3300005327 | Bacteria | 2646 |
| 14 | Ga0070658_10328549 | 3300005327 | Bacteria | 1306 |
| 15 | Ga0070683_100000021 | 3300005329 | Bacteria | 183486 |
| 16 | Ga0070690_100004947 | 3300005330 | Bacteria | 7451 |
| 17 | Ga0070690_100139041 | 3300005330 | Bacteria | 1647 |
| 18 | Ga0070670_100011220 | 3300005331 | Bacteria | 7659 |
| 19 | Ga0070670_100044693 | 3300005331 | Bacteria | 3808 |
| 20 | Ga0068869_100012781 | 3300005334 | Bacteria | 5554 |
| 21 | Ga0068869_100042160 | 3300005334 | Unclassified | 3271 |
| 22 | Ga0068869_100059823 | 3300005334 | Bacteria | 2790 |
| 23 | Ga0068869_100186165 | 3300005334 | Unclassified | 1630 |
| 24 | Ga0070666_10015597 | 3300005335 | Bacteria | 4849 |
| 25 | Ga0070680_100002897 | 3300005336 | Bacteria | 12745 |
| 26 | Ga0070680_100117884 | 3300005336 | Bacteria | 2214 |
| 27 | Ga0070682_100005421 | 3300005337 | Bacteria | 7105 |
| 28 | Ga0070682_100021210 | 3300005337 | Unclassified | 3830 |
| 29 | Ga0068868_100014431 | 3300005338 | Bacteria | 5822 |
| 30 | Ga0068868_100015298 | 3300005338 | Bacteria | 5672 |
| 31 | Ga0068868_100140825 | 3300005338 | Bacteria | 1980 |
| 32 | Ga0070660_100050185 | 3300005339 | Unclassified | 3210 |
| 33 | Ga0070689_100131574 | 3300005340 | Bacteria | 2006 |
| 34 | Ga0070687_100009738 | 3300005343 | Bacteria | 4130 |
| 35 | Ga0070687_100063379 | 3300005343 | Unclassified | 1960 |
| 36 | Ga0070687_100088464 | 3300005343 | Bacteria | 1708 |
| 37 | Ga0070669_100129740 | 3300005353 | Bacteria | 1932 |
| 38 | Ga0070669_100170916 | 3300005353 | Bacteria | 1694 |
| 39 | Ga0070675_100306827 | 3300005354 | Bacteria | 1399 |
| 40 | Ga0070671_100043941 | 3300005355 | Bacteria | 3713 |
| 41 | Ga0070673_100016117 | 3300005364 | Bacteria | 5274 |
| 42 | Ga0070688_100016374 | 3300005365 | Bacteria | 4238 |
| 43 | Ga0070659_100003961 | 3300005366 | Bacteria | 10538 |
| 44 | Ga0070659_100077650 | 3300005366 | Bacteria | 2649 |
| 45 | Ga0070659_100147990 | 3300005366 | Unclassified | 1914 |
| 46 | Ga0070667_100027179 | 3300005367 | Bacteria | 4761 |
| 47 | Ga0070711_100000931 | 3300005439 | Bacteria | 15461 |
| 48 | Ga0070711_100077664 | 3300005439 | Bacteria | 2357 |
| 49 | Ga0070705_100024816 | 3300005440 | Bacteria | 3241 |
| 50 | Ga0070705_100033954 | 3300005440 | Unclassified | 2848 |
| 51 | Ga0070705_100182722 | 3300005440 | Unclassified | 1422 |
| 52 | Ga0070700_100039598 | 3300005441 | Bacteria | 2880 |
| 53 | Ga0070700_100081886 | 3300005441 | Bacteria | 2086 |
| 54 | Ga0070700_100086660 | 3300005441 | Bacteria | 2034 |
| 55 | Ga0070694_100023010 | 3300005444 | Bacteria | 4001 |
| 56 | Ga0070694_100036812 | 3300005444 | Bacteria | 3243 |
| 57 | Ga0070694_100056906 | 3300005444 | Unclassified | 2657 |
| 58 | Ga0070694_100170670 | 3300005444 | Unclassified | 1602 |
| 59 | Ga0070708_100001518 | 3300005445 | Bacteria | 17724 |
| 60 | Ga0070663_100175768 | 3300005455 | Bacteria | 1658 |
| 61 | Ga0070681_10002826 | 3300005458 | Bacteria | 16033 |
| 62 | Ga0070681_10011692 | 3300005458 | Bacteria | 8695 |
| 63 | Ga0070681_10032432 | 3300005458 | Bacteria | 5242 |
| 64 | Ga0070681_10035292 | 3300005458 | Bacteria | 5024 |
| 65 | Ga0070681_10037049 | 3300005458 | Bacteria | 4895 |
| 66 | Ga0068867_100039914 | 3300005459 | Bacteria | 3423 |
| 67 | Ga0068867_100043863 | 3300005459 | Bacteria | 3275 |
| 68 | Ga0070706_100000452 | 3300005467 | Bacteria | 49138 |
| 69 | Ga0070706_100018984 | 3300005467 | Bacteria | 6342 |
| 70 | Ga0070706_100020539 | 3300005467 | Bacteria | 6086 |
| 71 | Ga0070706_100105202 | 3300005467 | Bacteria | 2626 |
| 72 | Ga0070706_100193560 | 3300005467 | Bacteria | 1900 |
| 73 | Ga0070706_100220497 | 3300005467 | Bacteria | 1770 |
| 74 | Ga0070707_100001233 | 3300005468 | Bacteria | 25094 |
| 75 | Ga0070707_100022551 | 3300005468 | Bacteria | 5953 |
| 76 | Ga0070707_100038528 | 3300005468 | Bacteria | 4566 |
| 77 | Ga0070707_100098794 | 3300005468 | Bacteria | 2827 |
| 78 | Ga0070698_100005974 | 3300005471 | Bacteria | 13272 |
| 79 | Ga0070698_100012714 | 3300005471 | Bacteria | 8913 |
| 80 | Ga0070698_100023131 | 3300005471 | Bacteria | 6498 |
| 81 | Ga0070698_100190033 | 3300005471 | Unclassified | 1991 |
| 82 | Ga0070699_100016094 | 3300005518 | Bacteria | 6420 |
| 83 | Ga0070699_100024926 | 3300005518 | Bacteria | 5157 |
| 84 | Ga0070699_100030707 | 3300005518 | Unclassified | 4640 |
| 85 | Ga0070699_100030796 | 3300005518 | Bacteria | 4632 |
| 86 | Ga0070679_100000024 | 3300005530 | Bacteria | 121394 |
| 87 | Ga0070679_100009548 | 3300005530 | Bacteria | 9177 |
| 88 | Ga0070679_100022298 | 3300005530 | Bacteria | 6188 |
| 89 | Ga0070679_100043317 | 3300005530 | Bacteria | 4483 |
| 90 | Ga0070679_100126980 | 3300005530 | Bacteria | 2532 |
| 91 | Ga0070679_100145094 | 3300005530 | Bacteria | 2351 |
| 92 | Ga0070684_100000010 | 3300005535 | Bacteria | 183486 |
| 93 | Ga0070684_100047549 | 3300005535 | Bacteria | 3718 |
| 94 | Ga0070697_100000043 | 3300005536 | Bacteria | 93782 |
| 95 | Ga0070697_100000192 | 3300005536 | Bacteria | 49825 |
| 96 | Ga0070697_100000695 | 3300005536 | Bacteria | 25189 |
| 97 | Ga0070697_100127036 | 3300005536 | Bacteria | 2136 |
| 98 | Ga0070697_100142231 | 3300005536 | Unclassified | 2018 |
| 99 | Ga0068853_100006614 | 3300005539 | Bacteria | 9229 |
| 100 | Ga0070686_100014687 | 3300005544 | Unclassified | 4519 |
| 101 | Ga0070695_100033173 | 3300005545 | Bacteria | 3230 |
| 102 | Ga0070695_100044926 | 3300005545 | Bacteria | 2814 |
| 103 | Ga0070695_100188288 | 3300005545 | Bacteria | 1467 |
| 104 | Ga0070696_100044752 | 3300005546 | Bacteria | 3065 |
| 105 | Ga0070693_100121652 | 3300005547 | Bacteria | 1620 |
| 106 | Ga0070665_100130282 | 3300005548 | Bacteria | 2517 |
| 107 | Ga0070665_100211319 | 3300005548 | Bacteria | 1941 |
| 108 | Ga0070704_100075893 | 3300005549 | Bacteria | 2457 |
| 109 | Ga0070704_100090011 | 3300005549 | Bacteria | 2284 |
| 110 | Ga0070704_100102047 | 3300005549 | Bacteria | 2164 |
| 111 | Ga0070704_100145136 | 3300005549 | Unclassified | 1858 |
| 112 | Ga0070704_100284630 | 3300005549 | Bacteria | 1371 |
| 113 | Ga0068855_100006381 | 3300005563 | Bacteria | 14369 |
| 114 | Ga0068855_100008615 | 3300005563 | Bacteria | 12324 |
| 115 | Ga0068855_100052768 | 3300005563 | Bacteria | 4786 |
| 116 | Ga0068855_100395738 | 3300005563 | Bacteria | 1515 |
| 117 | Ga0070664_100231112 | 3300005564 | Unclassified | 1658 |
| 118 | Ga0068857_100004403 | 3300005577 | Bacteria | 11905 |
| 119 | Ga0068857_100009275 | 3300005577 | Bacteria | 8537 |
| 120 | Ga0068857_100036084 | 3300005577 | Bacteria | 4380 |
| 121 | Ga0068854_100049090 | 3300005578 | Bacteria | 3013 |
| 122 | Ga0068856_100031235 | 3300005614 | Bacteria | 5211 |
| 123 | Ga0068856_100036669 | 3300005614 | Bacteria | 4808 |
| 124 | Ga0068856_100100190 | 3300005614 | Bacteria | 2889 |
| 125 | Ga0068856_100100440 | 3300005614 | Bacteria | 2885 |
| 126 | Ga0070702_100003620 | 3300005615 | Bacteria | 6948 |
| 127 | Ga0070702_100117331 | 3300005615 | Bacteria | 1660 |
| 128 | Ga0068852_100086989 | 3300005616 | Bacteria | 2787 |
| 129 | Ga0068852_100117669 | 3300005616 | Bacteria | 2427 |
| 130 | Ga0068852_100138198 | 3300005616 | Bacteria | 2252 |
| 131 | Ga0068859_100005492 | 3300005617 | Bacteria | 12908 |
| 132 | Ga0068859_100028044 | 3300005617 | Bacteria | 5647 |
| 133 | Ga0068859_100035655 | 3300005617 | Bacteria | 4991 |
| 134 | Ga0068859_100043442 | 3300005617 | Bacteria | 4516 |
| 135 | Ga0068859_100094508 | 3300005617 | Bacteria | 3042 |
| 136 | Ga0068859_100108160 | 3300005617 | Unclassified | 2842 |
| 137 | Ga0068859_100191234 | 3300005617 | Bacteria | 2131 |
| 138 | Ga0068859_100192611 | 3300005617 | Bacteria | 2123 |
| 139 | Ga0068859_100200060 | 3300005617 | Bacteria | 2082 |
| 140 | Ga0068864_100020345 | 3300005618 | Bacteria | 5552 |
| 141 | Ga0068864_100132563 | 3300005618 | Unclassified | 2240 |
| 142 | Ga0068864_100171461 | 3300005618 | Bacteria | 1978 |
| 143 | Ga0068866_10010160 | 3300005718 | Bacteria | 4025 |
| 144 | Ga0068861_100025052 | 3300005719 | Bacteria | 4321 |
| 145 | Ga0068861_100061865 | 3300005719 | Bacteria | 2874 |
| 146 | Ga0068851_10004072 | 3300005834 | Bacteria | 6564 |
| 147 | Ga0068863_100018832 | 3300005841 | Bacteria | 6606 |
| 148 | Ga0068863_100070073 | 3300005841 | Bacteria | 3316 |
| 149 | Ga0068863_100124970 | 3300005841 | Unclassified | 2454 |
| 150 | Ga0068863_100192914 | 3300005841 | Bacteria | 1958 |
| 151 | Ga0068863_100342164 | 3300005841 | Bacteria | 1455 |
| 152 | Ga0068858_100007926 | 3300005842 | Bacteria | 10236 |
| 153 | Ga0068858_100036407 | 3300005842 | Bacteria | 4563 |
| 154 | Ga0068858_100040084 | 3300005842 | Unclassified | 4343 |
| 155 | Ga0068858_100059441 | 3300005842 | Bacteria | 3533 |
| 156 | Ga0068858_100112772 | 3300005842 | Bacteria | 2539 |
| 157 | Ga0068860_100007661 | 3300005843 | Bacteria | 10800 |
| 158 | Ga0068860_100009604 | 3300005843 | Bacteria | 9613 |
| 159 | Ga0068862_100075458 | 3300005844 | Bacteria | 2916 |
| 160 | Ga0081539_10000043 | 3300005985 | Bacteria | 288108 |
| 161 | Ga0081539_10007178 | 3300005985 | Bacteria | 10269 |
| 162 | Ga0081539_10042197 | 3300005985 | Unclassified | 2659 |
| 163 | Ga0070715_10021916 | 3300006163 | Bacteria | 2484 |
| 164 | Ga0070716_100009299 | 3300006173 | Bacteria | 4898 |
| 165 | Ga0070716_100129216 | 3300006173 | Unclassified | 1594 |
| 166 | Ga0070712_100000445 | 3300006175 | Bacteria | 23661 |
| 167 | Ga0097621_100003224 | 3300006237 | Bacteria | 11213 |
| 168 | Ga0097621_100005607 | 3300006237 | Bacteria | 8852 |
| 169 | Ga0097621_100010726 | 3300006237 | Bacteria | 6718 |
| 170 | Ga0097621_100019452 | 3300006237 | Bacteria | 5211 |
| 171 | Ga0097621_100227181 | 3300006237 | Bacteria | 1629 |
| 172 | Ga0068871_100006192 | 3300006358 | Bacteria | 8436 |
| 173 | Ga0068871_100007548 | 3300006358 | Bacteria | 7779 |
| 174 | Ga0068871_100016723 | 3300006358 | Bacteria | 5534 |
| 175 | Ga0068871_100193739 | 3300006358 | Bacteria | 1752 |
| 176 | Ga0075428_100047888 | 3300006844 | Unclassified | 4694 |
| 177 | Ga0075428_100311227 | 3300006844 | Bacteria | 1693 |
| 178 | Ga0075431_100062459 | 3300006847 | Bacteria | 3844 |
| 179 | Ga0075431_100193511 | 3300006847 | Bacteria | 2083 |
| 180 | Ga0075433_10003126 | 3300006852 | Bacteria | 12751 |
| 181 | Ga0075433_10022329 | 3300006852 | Bacteria | 5311 |
| 182 | Ga0075433_10027374 | 3300006852 | Bacteria | 4835 |
| 183 | Ga0075433_10097983 | 3300006852 | Bacteria | 2595 |
| 184 | Ga0075433_10174817 | 3300006852 | Bacteria | 1911 |
| 185 | Ga0075434_100176517 | 3300006871 | Bacteria | 2156 |
| 186 | Ga0075429_100147437 | 3300006880 | Bacteria | 2060 |
| 187 | Ga0075436_100033523 | 3300006914 | Bacteria | 3540 |
| 188 | Ga0075436_100049077 | 3300006914 | Bacteria | 2912 |
| 189 | Ga0097620_100005491 | 3300006931 | Bacteria | 12908 |
| 190 | Ga0097620_100028044 | 3300006931 | Bacteria | 5647 |
| 191 | Ga0097620_100035656 | 3300006931 | Bacteria | 4991 |
| 192 | Ga0097620_100043449 | 3300006931 | Bacteria | 4516 |
| 193 | Ga0097620_100094506 | 3300006931 | Bacteria | 3042 |
| 194 | Ga0097620_100108153 | 3300006931 | Unclassified | 2842 |
| 195 | Ga0097620_100191248 | 3300006931 | Bacteria | 2131 |
| 196 | Ga0097620_100192607 | 3300006931 | Bacteria | 2123 |
| 197 | Ga0097620_100200057 | 3300006931 | Bacteria | 2082 |
| 198 | Ga0075435_100130005 | 3300007076 | Bacteria | 2107 |
| 199 | Ga0105240_10001081 | 3300009093 | Bacteria | 48105 |
| 200 | Ga0105240_10001462 | 3300009093 | Bacteria | 40375 |
| 201 | Ga0105240_10024119 | 3300009093 | Bacteria | 8029 |
| 202 | Ga0105240_10190007 | 3300009093 | Bacteria | 2416 |
| 203 | Ga0111539_10134232 | 3300009094 | Bacteria | 2898 |
| 204 | Ga0111539_10199108 | 3300009094 | Bacteria | 2336 |
| 205 | Ga0105245_10002961 | 3300009098 | Bacteria | 15229 |
| 206 | Ga0105245_10003583 | 3300009098 | Bacteria | 13862 |
| 207 | Ga0105245_10013874 | 3300009098 | Bacteria | 7020 |
| 208 | Ga0105245_10084873 | 3300009098 | Bacteria | 2902 |
| 209 | Ga0105247_10030428 | 3300009101 | Bacteria | 3273 |
| 210 | Ga0105247_10101265 | 3300009101 | Bacteria | 1842 |
| 211 | Ga0114129_10036974 | 3300009147 | Bacteria | 6894 |
| 212 | Ga0114129_10074352 | 3300009147 | Unclassified | 4733 |
| 213 | Ga0114129_10094958 | 3300009147 | Unclassified | 4130 |
| 214 | Ga0114129_10252698 | 3300009147 | Bacteria | 2366 |
| 215 | Ga0114129_10523764 | 3300009147 | Bacteria | 1545 |
| 216 | Ga0105243_10048803 | 3300009148 | Bacteria | 3338 |
| 217 | Ga0105243_10090367 | 3300009148 | Bacteria | 2520 |
| 218 | Ga0105243_10138871 | 3300009148 | Unclassified | 2071 |
| 219 | Ga0105243_10206935 | 3300009148 | Bacteria | 1725 |
| 220 | Ga0105241_10021842 | 3300009174 | Bacteria | 4737 |
| 221 | Ga0105241_10023577 | 3300009174 | Bacteria | 4564 |
| 222 | Ga0105241_10059875 | 3300009174 | Bacteria | 2929 |
| 223 | Ga0105241_10157623 | 3300009174 | Bacteria | 1863 |
| 224 | Ga0105241_10160393 | 3300009174 | Bacteria | 1848 |
| 225 | Ga0105241_10265771 | 3300009174 | Bacteria | 1459 |
| 226 | Ga0105242_10029701 | 3300009176 | Bacteria | 4360 |
| 227 | Ga0105242_10110566 | 3300009176 | Bacteria | 2341 |
| 228 | Ga0105242_10132819 | 3300009176 | Bacteria | 2151 |
| 229 | Ga0105248_10007065 | 3300009177 | Bacteria | 12300 |
| 230 | Ga0105248_10008484 | 3300009177 | Bacteria | 11279 |
| 231 | Ga0105248_10021339 | 3300009177 | Bacteria | 7177 |
| 232 | Ga0105248_10025877 | 3300009177 | Bacteria | 6527 |
| 233 | Ga0105248_10041537 | 3300009177 | Bacteria | 5156 |
| 234 | Ga0105248_10041604 | 3300009177 | Bacteria | 5152 |
| 235 | Ga0105248_10224934 | 3300009177 | Bacteria | 2112 |
| 236 | Ga0105237_10000506 | 3300009545 | Bacteria | 55083 |
| 237 | Ga0105237_10027216 | 3300009545 | Bacteria | 5838 |
| 238 | Ga0105237_10103450 | 3300009545 | Unclassified | 2840 |
| 239 | Ga0105237_10162831 | 3300009545 | Bacteria | 2229 |
| 240 | Ga0105238_10026874 | 3300009551 | Bacteria | 5866 |
| 241 | Ga0105238_10068045 | 3300009551 | Bacteria | 3562 |
| 242 | Ga0105238_10122670 | 3300009551 | Bacteria | 2578 |
| 243 | Ga0105238_10226562 | 3300009551 | Bacteria | 1846 |
| 244 | Ga0105238_10263773 | 3300009551 | Bacteria | 1702 |
| 245 | Ga0105249_10054535 | 3300009553 | Bacteria | 3656 |
| 246 | Ga0105249_10074532 | 3300009553 | Bacteria | 3141 |
| 247 | Ga0105249_10242198 | 3300009553 | Bacteria | 1784 |
| 248 | Ga0105249_10693125 | 3300009553 | Unclassified | 1078 |
| 249 | Ga0105239_10026006 | 3300010375 | Bacteria | 6444 |
| 250 | Ga0105239_10063569 | 3300010375 | Bacteria | 4053 |
| 251 | Ga0105239_10146160 | 3300010375 | Bacteria | 2637 |
| 252 | Ga0105239_10172080 | 3300010375 | Bacteria | 2422 |
| 253 | Ga0105239_10225435 | 3300010375 | Bacteria | 2102 |
| 254 | Ga0105239_10668913 | 3300010375 | Bacteria | 1186 |
| 255 | Ga0105246_10226480 | 3300011119 | Bacteria | 1469 |
| 256 | Ga0157373_10002359 | 3300013100 | Bacteria | 14329 |
| 257 | Ga0157373_10009713 | 3300013100 | Bacteria | 7101 |
| 258 | Ga0157373_10078890 | 3300013100 | Bacteria | 2322 |
| 259 | Ga0157370_10002433 | 3300013104 | Bacteria | 22448 |
| 260 | Ga0157370_10002565 | 3300013104 | Bacteria | 21805 |
| 261 | Ga0157370_10014337 | 3300013104 | Bacteria | 8110 |
| 262 | Ga0157370_10184820 | 3300013104 | Bacteria | 1936 |
| 263 | Ga0157370_10242189 | 3300013104 | Bacteria | 1669 |
| 264 | Ga0157370_10249625 | 3300013104 | Bacteria | 1641 |
| 265 | Ga0157369_10163100 | 3300013105 | Bacteria | 2352 |
| 266 | Ga0157369_10203438 | 3300013105 | Bacteria | 2078 |
| 267 | Ga0157374_10004841 | 3300013296 | Bacteria | 11302 |
| 268 | Ga0157374_10031059 | 3300013296 | Bacteria | 4851 |
| 269 | Ga0157374_10331326 | 3300013296 | Unclassified | 1510 |
| 270 | Ga0157378_10002212 | 3300013297 | Bacteria | 17253 |
| 271 | Ga0157378_10005454 | 3300013297 | Bacteria | 11140 |
| 272 | Ga0157378_10007890 | 3300013297 | Bacteria | 9292 |
| 273 | Ga0157378_10115071 | 3300013297 | Bacteria | 2471 |
| 274 | Ga0163162_10005567 | 3300013306 | Bacteria | 12188 |
| 275 | Ga0163162_10009410 | 3300013306 | Bacteria | 9504 |
| 276 | Ga0163162_10025973 | 3300013306 | Bacteria | 5788 |
| 277 | Ga0163162_10033314 | 3300013306 | Bacteria | 5119 |
| 278 | Ga0163162_10035653 | 3300013306 | Bacteria | 4956 |
| 279 | Ga0163162_10061562 | 3300013306 | Unclassified | 3791 |
| 280 | Ga0163162_10071436 | 3300013306 | Unclassified | 3524 |
| 281 | Ga0163162_10144071 | 3300013306 | Bacteria | 2497 |
| 282 | Ga0163162_10186559 | 3300013306 | Bacteria | 2201 |
| 283 | Ga0157372_10122165 | 3300013307 | Bacteria | 2992 |
| 284 | Ga0157372_10359528 | 3300013307 | Bacteria | 1696 |
| 285 | Ga0157375_10056314 | 3300013308 | Bacteria | 3881 |
| 286 | Ga0157375_10125508 | 3300013308 | Bacteria | 2681 |
| 287 | Ga0157375_10145427 | 3300013308 | Bacteria | 2501 |
| 288 | Ga0157375_10483758 | 3300013308 | Bacteria | 1403 |
| 289 | Ga0163163_10001650 | 3300014325 | Bacteria | 18789 |
| 290 | Ga0163163_10002569 | 3300014325 | Bacteria | 15365 |
| 291 | Ga0163163_10005524 | 3300014325 | Bacteria | 10945 |
| 292 | Ga0163163_10006693 | 3300014325 | Bacteria | 10098 |
| 293 | Ga0163163_10011781 | 3300014325 | Bacteria | 7949 |
| 294 | Ga0163163_10025404 | 3300014325 | Bacteria | 5647 |
| 295 | Ga0163163_10073106 | 3300014325 | Bacteria | 3419 |
| 296 | Ga0163163_10084927 | 3300014325 | Bacteria | 3173 |
| 297 | Ga0163163_10120077 | 3300014325 | Bacteria | 2662 |
| 298 | Ga0163163_10233577 | 3300014325 | Bacteria | 1888 |
| 299 | Ga0163163_10272026 | 3300014325 | Bacteria | 1745 |
| 300 | Ga0157380_10011778 | 3300014326 | Bacteria | 6324 |
| 301 | Ga0157377_10155057 | 3300014745 | Bacteria | 1419 |
| 302 | Ga0157376_10001577 | 3300014969 | Bacteria | 15067 |
| 303 | Ga0157376_10067761 | 3300014969 | Bacteria | 3019 |
| 304 | Ga0157376_10081340 | 3300014969 | Bacteria | 2781 |
| 305 | Ga0213872_10000182 | 3300021361 | Bacteria | 56427 |
| 306 | Ga0213876_10000190 | 3300021384 | Bacteria | 64067 |
| 307 | Ga0213876_10116309 | 3300021384 | Bacteria | 1419 |
| 308 | Ga0213875_10000002 | 3300021388 | Bacteria | 921066 |
| 309 | Ga0213875_10002433 | 3300021388 | Bacteria | 11139 |
| 310 | Ga0213875_10028154 | 3300021388 | Bacteria | 2671 |
| 311 | Ga0207656_10002158 | 3300025321 | Bacteria | 6573 |
| 312 | Ga0207653_10001251 | 3300025885 | Bacteria | 8300 |
| 313 | Ga0207642_10020481 | 3300025899 | Bacteria | 2583 |
| 314 | Ga0207680_10007757 | 3300025903 | Bacteria | 5244 |
| 315 | Ga0207680_10041666 | 3300025903 | Bacteria | 2681 |
| 316 | Ga0207680_10089308 | 3300025903 | Bacteria | 1956 |
| 317 | Ga0207643_10001447 | 3300025908 | Bacteria | 13632 |
| 318 | Ga0207643_10014797 | 3300025908 | Bacteria | 4243 |
| 319 | Ga0207643_10061646 | 3300025908 | Bacteria | 2142 |
| 320 | Ga0207705_10039367 | 3300025909 | Bacteria | 3388 |
| 321 | Ga0207684_10000216 | 3300025910 | Bacteria | 89242 |
| 322 | Ga0207684_10008212 | 3300025910 | Bacteria | 9296 |
| 323 | Ga0207684_10022730 | 3300025910 | Bacteria | 5354 |
| 324 | Ga0207684_10234475 | 3300025910 | Unclassified | 1583 |
| 325 | Ga0207707_10000188 | 3300025912 | Bacteria | 65222 |
| 326 | Ga0207707_10023499 | 3300025912 | Bacteria | 5392 |
| 327 | Ga0207707_10077565 | 3300025912 | Bacteria | 2900 |
| 328 | Ga0207707_10081820 | 3300025912 | Bacteria | 2819 |
| 329 | Ga0207707_10154111 | 3300025912 | Bacteria | 2009 |
| 330 | Ga0207695_10000956 | 3300025913 | Bacteria | 51440 |
| 331 | Ga0207695_10004456 | 3300025913 | Bacteria | 19085 |
| 332 | Ga0207695_10006735 | 3300025913 | Bacteria | 14829 |
| 333 | Ga0207695_10006834 | 3300025913 | Bacteria | 14691 |
| 334 | Ga0207695_10090951 | 3300025913 | Bacteria | 3066 |
| 335 | Ga0207695_10102144 | 3300025913 | Bacteria | 2861 |
| 336 | Ga0207695_10161432 | 3300025913 | Bacteria | 2172 |
| 337 | Ga0207695_10175099 | 3300025913 | Unclassified | 2068 |
| 338 | Ga0207695_10352483 | 3300025913 | Bacteria | 1359 |
| 339 | Ga0207671_10005190 | 3300025914 | Bacteria | 12106 |
| 340 | Ga0207671_10043411 | 3300025914 | Bacteria | 3325 |
| 341 | Ga0207671_10121391 | 3300025914 | Bacteria | 1997 |
| 342 | Ga0207693_10000120 | 3300025915 | Bacteria | 69565 |
| 343 | Ga0207663_10003410 | 3300025916 | Bacteria | 7773 |
| 344 | Ga0207660_10000403 | 3300025917 | Bacteria | 28503 |
| 345 | Ga0207662_10002321 | 3300025918 | Bacteria | 9530 |
| 346 | Ga0207662_10017817 | 3300025918 | Bacteria | 4021 |
| 347 | Ga0207662_10020960 | 3300025918 | Bacteria | 3731 |
| 348 | Ga0207662_10067195 | 3300025918 | Unclassified | 2162 |
| 349 | Ga0207657_10188374 | 3300025919 | Bacteria | 1666 |
| 350 | Ga0207652_10001088 | 3300025921 | Bacteria | 24610 |
| 351 | Ga0207652_10045909 | 3300025921 | Bacteria | 3726 |
| 352 | Ga0207652_10176495 | 3300025921 | Bacteria | 1919 |
| 353 | Ga0207646_10016348 | 3300025922 | Bacteria | 6963 |
| 354 | Ga0207646_10069727 | 3300025922 | Bacteria | 3140 |
| 355 | Ga0207694_10090693 | 3300025924 | Bacteria | 2411 |
| 356 | Ga0207650_10191154 | 3300025925 | Bacteria | 1635 |
| 357 | Ga0207687_10013347 | 3300025927 | Bacteria | 5363 |
| 358 | Ga0207687_10016925 | 3300025927 | Bacteria | 4792 |
| 359 | Ga0207687_10059404 | 3300025927 | Bacteria | 2694 |
| 360 | Ga0207644_10000697 | 3300025931 | Bacteria | 21261 |
| 361 | Ga0207644_10141482 | 3300025931 | Bacteria | 1853 |
| 362 | Ga0207690_10118328 | 3300025932 | Unclassified | 1920 |
| 363 | Ga0207706_10020273 | 3300025933 | Bacteria | 5976 |
| 364 | Ga0207686_10026264 | 3300025934 | Bacteria | 3396 |
| 365 | Ga0207709_10068805 | 3300025935 | Bacteria | 2239 |
| 366 | Ga0207709_10083229 | 3300025935 | Unclassified | 2068 |
| 367 | Ga0207670_10005206 | 3300025936 | Bacteria | 7113 |
| 368 | Ga0207670_10028244 | 3300025936 | Bacteria | 3559 |
| 369 | Ga0207669_10147436 | 3300025937 | Bacteria | 1643 |
| 370 | Ga0207665_10000030 | 3300025939 | Bacteria | 94900 |
| 371 | Ga0207665_10155987 | 3300025939 | Unclassified | 1638 |
| 372 | Ga0207691_10001277 | 3300025940 | Bacteria | 25156 |
| 373 | Ga0207711_10024304 | 3300025941 | Bacteria | 5074 |
| 374 | Ga0207711_10035254 | 3300025941 | Bacteria | 4240 |
| 375 | Ga0207711_10037421 | 3300025941 | Bacteria | 4121 |
| 376 | Ga0207711_10037483 | 3300025941 | Bacteria | 4119 |
| 377 | Ga0207711_10122997 | 3300025941 | Bacteria | 2318 |
| 378 | Ga0207711_10159506 | 3300025941 | Bacteria | 2040 |
| 379 | Ga0207711_10211963 | 3300025941 | Unclassified | 1769 |
| 380 | Ga0207711_10254852 | 3300025941 | Unclassified | 1612 |
| 381 | Ga0207689_10003167 | 3300025942 | Bacteria | 15083 |
| 382 | Ga0207689_10005239 | 3300025942 | Bacteria | 11629 |
| 383 | Ga0207689_10006129 | 3300025942 | Bacteria | 10639 |
| 384 | Ga0207689_10023365 | 3300025942 | Bacteria | 5190 |
| 385 | Ga0207689_10135479 | 3300025942 | Bacteria | 2028 |
| 386 | Ga0207689_10157109 | 3300025942 | Unclassified | 1874 |
| 387 | Ga0207661_10000012 | 3300025944 | Bacteria | 354345 |
| 388 | Ga0207679_10148668 | 3300025945 | Bacteria | 1903 |
| 389 | Ga0207667_10012848 | 3300025949 | Bacteria | 9622 |
| 390 | Ga0207667_10023104 | 3300025949 | Bacteria | 6850 |
| 391 | Ga0207667_10039208 | 3300025949 | Bacteria | 5051 |
| 392 | Ga0207667_10211305 | 3300025949 | Bacteria | 1989 |
| 393 | Ga0207667_10311084 | 3300025949 | Bacteria | 1609 |
| 394 | Ga0207651_10025235 | 3300025960 | Bacteria | 3693 |
| 395 | Ga0207651_10036023 | 3300025960 | Bacteria | 3225 |
| 396 | Ga0207651_10144317 | 3300025960 | Bacteria | 1843 |
| 397 | Ga0207712_10326679 | 3300025961 | Bacteria | 1268 |
| 398 | Ga0207658_10037802 | 3300025986 | Bacteria | 3472 |
| 399 | Ga0207677_10017181 | 3300026023 | Bacteria | 4306 |
| 400 | Ga0207677_10113601 | 3300026023 | Bacteria | 2022 |
| 401 | Ga0207703_10022493 | 3300026035 | Bacteria | 4946 |
| 402 | Ga0207703_10067362 | 3300026035 | Unclassified | 2946 |
| 403 | Ga0207703_10118070 | 3300026035 | Bacteria | 2273 |
| 404 | Ga0207703_10135098 | 3300026035 | Bacteria | 2134 |
| 405 | Ga0207703_10143076 | 3300026035 | Bacteria | 2077 |
| 406 | Ga0207703_10330799 | 3300026035 | Unclassified | 1397 |
| 407 | Ga0207639_10030418 | 3300026041 | Bacteria | 3959 |
| 408 | Ga0207639_10127024 | 3300026041 | Bacteria | 2105 |
| 409 | Ga0207678_10057538 | 3300026067 | Bacteria | 3346 |
| 410 | Ga0207678_10131094 | 3300026067 | Bacteria | 2138 |
| 411 | Ga0207708_10018867 | 3300026075 | Bacteria | 5195 |
| 412 | Ga0207708_10044077 | 3300026075 | Unclassified | 3399 |
| 413 | Ga0207708_10044449 | 3300026075 | Bacteria | 3384 |
| 414 | Ga0207708_10119787 | 3300026075 | Bacteria | 2050 |
| 415 | Ga0207702_10136543 | 3300026078 | Bacteria | 2213 |
| 416 | Ga0207641_10112100 | 3300026088 | Bacteria | 2420 |
| 417 | Ga0207641_10117660 | 3300026088 | Bacteria | 2366 |
| 418 | Ga0207641_10173256 | 3300026088 | Unclassified | 1971 |
| 419 | Ga0207648_10010987 | 3300026089 | Bacteria | 8552 |
| 420 | Ga0207648_10012665 | 3300026089 | Bacteria | 7885 |
| 421 | Ga0207648_10014814 | 3300026089 | Bacteria | 7194 |
| 422 | Ga0207648_10097066 | 3300026089 | Bacteria | 2579 |
| 423 | Ga0207648_10115874 | 3300026089 | Bacteria | 2355 |
| 424 | Ga0207676_10002012 | 3300026095 | Bacteria | 14807 |
| 425 | Ga0207676_10077850 | 3300026095 | Bacteria | 2684 |
| 426 | Ga0207676_10108948 | 3300026095 | Bacteria | 2313 |
| 427 | Ga0207674_10000258 | 3300026116 | Bacteria | 66186 |
| 428 | Ga0207674_10013162 | 3300026116 | Bacteria | 9207 |
| 429 | Ga0207674_10357554 | 3300026116 | Unclassified | 1412 |
| 430 | Ga0207675_100004638 | 3300026118 | Bacteria | 13243 |
| 431 | Ga0207675_100068758 | 3300026118 | Unclassified | 3310 |
| 432 | Ga0207675_100088894 | 3300026118 | Bacteria | 2902 |
| 433 | Ga0207698_10119294 | 3300026142 | Bacteria | 2229 |
| 434 | Ga0209588_1000854 | 3300027671 | Bacteria | 7775 |
| 435 | Ga0207428_10143737 | 3300027907 | Bacteria | 1819 |
| 436 | Ga0207428_10186881 | 3300027907 | Unclassified | 1563 |
| 437 | Ga0268266_10001048 | 3300028379 | Bacteria | 34678 |
| 438 | Ga0268266_10049494 | 3300028379 | Bacteria | 3604 |
| 439 | Ga0268265_10080851 | 3300028380 | Bacteria | 2564 |
| 440 | Ga0268264_10011513 | 3300028381 | Bacteria | 7307 |
| 441 | Ga0268264_10064123 | 3300028381 | Bacteria | 3091 |
| 442 | Ga0268264_10115156 | 3300028381 | Bacteria | 2361 |
| 443 | Ga0265323_10002725 | 3300028653 | Bacteria | 7964 |
| 444 | Ga0265329_10023513 | 3300031242 | Bacteria | 2052 |
| 445 | Ga0265316_10010253 | 3300031344 | Bacteria | 8551 |
| 446 | Ga0265316_10012442 | 3300031344 | Bacteria | 7630 |
| 447 | Ga0265316_10102988 | 3300031344 | Bacteria | 2168 |
| 448 | Ga0265316_10107657 | 3300031344 | Bacteria | 2113 |
| 449 | Ga0265316_10115600 | 3300031344 | Bacteria | 2028 |
| 450 | Ga0307415_100112508 | 3300032126 | Bacteria | 2023 |
| 451 | Ga0373954_0076447 | 3300035118 | Bacteria | 1596 |
| 452 | Ga0373943_0019944 | 3300035170 | Bacteria | 3088 |
| 453 | Ga0373935_0036866 | 3300035692 | Bacteria | 3059 |
| 454 | Ga0373935_0056366 | 3300035692 | Bacteria | 2505 |
| 455 | Ga0373927_0003141 | 3300035695 | Bacteria | 11935 |
| 456 | Ga0373927_0044038 | 3300035695 | Bacteria | 2888 |
| 457 | Ga0373947_0089555 | 3300035725 | Bacteria | 1917 |
| 458 | Ga0373947_0134284 | 3300035725 | Bacteria | 1582 |
| 459 | Ga0373937_0026652 | 3300036401 | Bacteria | 5222 |
| 460 | Ga0373937_0140306 | 3300036401 | Bacteria | 2261 |
| 461 | Ga0373937_0144233 | 3300036401 | Bacteria | 2228 |
| 462 | Ga0373925_0015405 | 3300037068 | Bacteria | 5528 |
| 463 | Ga0373925_0107697 | 3300037068 | Bacteria | 2150 |
| 464 | Ga0373925_0324829 | 3300037068 | Bacteria | 1246 |
| 465 | Ga0395900_0147356 | 3300037418 | Bacteria | 2407 |
| 466 | Ga0395900_0240000 | 3300037418 | Bacteria | 1819 |
| 467 | Ga0395898_0272982 | 3300037466 | Bacteria | 1613 |
| 468 | Ga0436364_0478638 | 3300037853 | Unclassified | 3096 |
| 469 | Ga0436364_0517360 | 3300037853 | Bacteria | 13526 |
| 470 | Ga0436364_0919396 | 3300037853 | Bacteria | 13386 |
| 471 | Ga0395901_0133428 | 3300038443 | Bacteria | 2610 |
| 472 | Ga0242420_014565 | 3300038996 | Bacteria | 1351 |
| 473 | Ga0436365_0001504 | 3300039437 | Bacteria | 2646 |
| 474 | Ga0436365_0576586 | 3300039437 | Bacteria | 106320 |
| 475 | Ga0436365_1492531 | 3300039437 | Bacteria | 5639 |
| 476 | Ga0436365_1793553 | 3300039437 | Bacteria | 7084 |
| 477 | Ga0436360_1323621 | 3300039438 | Bacteria | 1903 |
| 478 | Ga0436361_0126076 | 3300039447 | Bacteria | 97470 |
| 479 | Ga0436363_0737069 | 3300039450 | Bacteria | 2125 |
| 480 | Ga0439448_0029165 | 3300042005 | Bacteria | 1746 |
| 481 | Ga0439455_0043303 | 3300042012 | Bacteria | 1158 |
| 482 | Ga0451577_0161665 | 3300042876 | Bacteria | 2017 |
| 483 | Ga0466957_0263213 | 3300044842 | Bacteria | 1150 |
| 484 | Ga0451576_0525896 | 3300045051 | Unclassified | 1243 |
| 485 | Ga0466967_0112795 | 3300045976 | Bacteria | 2500 |
| 486 | Ga0495592_0008047 | 3300046454 | Bacteria | 7918 |
| 487 | Ga0495651_0019957 | 3300046462 | Bacteria | 5199 |
| 488 | Ga0495651_0272397 | 3300046462 | Bacteria | 1147 |
| 489 | Ga0495653_0046441 | 3300046463 | Bacteria | 3363 |
| 490 | Ga0495639_0028109 | 3300046475 | Bacteria | 2492 |
| 491 | Ga0495662_0058736 | 3300046476 | Bacteria | 1858 |
| 492 | Ga0495664_0010701 | 3300046477 | Bacteria | 5153 |
| 493 | Ga0495664_0113408 | 3300046477 | Bacteria | 1637 |
| 494 | Ga0495594_0112244 | 3300046499 | Bacteria | 1537 |
| 495 | Ga0495628_0033135 | 3300046516 | Bacteria | 4165 |
| 496 | Ga0495652_0118298 | 3300046529 | Bacteria | 2118 |
| 497 | Ga0495621_0023003 | 3300046539 | Bacteria | 2071 |
| 498 | Ga0495634_0129413 | 3300046642 | Bacteria | 1610 |
| 499 | Ga0495599_0146449 | 3300046678 | Bacteria | 1464 |
| 500 | Ga0495623_0198969 | 3300046679 | Bacteria | 1153 |
| 501 | Ga0495658_0166147 | 3300046683 | Bacteria | 1363 |
| 502 | Ga0495613_0060230 | 3300046689 | Bacteria | 2781 |
| 503 | Ga0495674_0013188 | 3300047319 | Bacteria | 7769 |
| 504 | Ga0495674_0083076 | 3300047319 | Bacteria | 2746 |
| 505 | Ga0495674_0114505 | 3300047319 | Bacteria | 2283 |
| 506 | Ga0495674_0123573 | 3300047319 | Bacteria | 2185 |
| 507 | Ga0495674_0153187 | 3300047319 | Bacteria | 1932 |
| 508 | Ga0495680_0009823 | 3300047322 | Bacteria | 8580 |
| 509 | Ga0495675_0036147 | 3300047444 | Bacteria | 3152 |
| 510 | Ga0495675_0117237 | 3300047444 | Bacteria | 1660 |
| 511 | Ga0495684_0025144 | 3300047471 | Bacteria | 4579 |
| 512 | Ga0495602_0051524 | 3300048088 | Bacteria | 3665 |
| 513 | Ga0495614_0010864 | 3300048089 | Bacteria | 4010 |
| 514 | Ga0496108_0048914 | 3300048911 | Bacteria | 3536 |
| 515 | Ga0496112_0128781 | 3300048915 | Unclassified | 2502 |
| 516 | Ga0496112_0270713 | 3300048915 | Bacteria | 1647 |
| 517 | Ga0496112_0381590 | 3300048915 | Bacteria | 1350 |
| 518 | Ga0496115_0015570 | 3300048918 | Bacteria | 5772 |
| 519 | Ga0501034_0009063 | 3300049571 | Bacteria | 10451 |
| 520 | Ga0501037_0022707 | 3300049573 | Bacteria | 4639 |
| 521 | Ga0501038_0179013 | 3300049574 | Unclassified | 1712 |
| 522 | Ga0501043_0035939 | 3300049579 | Bacteria | 3897 |
| 523 | Ga0501047_0004792 | 3300049581 | Bacteria | 12731 |
| 524 | Ga0501070_0030266 | 3300049586 | Bacteria | 4536 |
| 525 | Ga0501070_0035687 | 3300049586 | Bacteria | 4153 |
| 526 | Ga0501073_0010061 | 3300049589 | Bacteria | 6955 |
| 527 | Ga0501073_0094455 | 3300049589 | Unclassified | 2077 |
| 528 | Ga0501249_002297 | 3300049679 | Bacteria | 3870 |
| 529 | Ga0501268_009875 | 3300049765 | Unclassified | 1475 |
| 530 | Ga0501035_0004621 | 3300049822 | Bacteria | 13052 |
| 531 | Ga0501044_0001767 | 3300049823 | Bacteria | 25271 |
| 532 | Ga0501044_0002962 | 3300049823 | Bacteria | 19309 |
| 533 | nmdc:mga05p37_151371_c1 | 3300050507 | Unclassified | 2837 |
| 534 | nmdc:mga05p37_17568_c1 | 3300050507 | Bacteria | 8636 |
| 535 | nmdc:mga05p37_27645_c1 | 3300050507 | Bacteria | 6909 |
| 536 | nmdc:mga05p37_370186_c1 | 3300050507 | Bacteria | 1682 |
| 537 | nmdc:mga05p37_387094_c1 | 3300050507 | Bacteria | 1636 |
| 538 | nmdc:mga05p37_524231_c1 | 3300050507 | Bacteria | 1354 |
| 539 | nmdc:mga0qj67_21139_c1 | 3300050509 | Bacteria | 4990 |
| 540 | nmdc:mga0qj67_84472_c1 | 3300050509 | Bacteria | 2546 |
| 541 | nmdc:mga06r32_103117_c1 | 3300050510 | Bacteria | 2801 |
| 542 | nmdc:mga06r32_142184_c1 | 3300050510 | Bacteria | 2376 |
| 543 | nmdc:mga06r32_28441_c1 | 3300050510 | Bacteria | 5230 |
| 544 | nmdc:mga08y16_1416_c1 | 3300050511 | Bacteria | 24064 |
| 545 | nmdc:mga08y16_375066_c1 | 3300050511 | Bacteria | 1459 |
| 546 | nmdc:mga08y16_94382_c1 | 3300050511 | Unclassified | 3116 |
| 547 | nmdc:mga0n895_329363_c1 | 3300050512 | Unclassified | 1547 |
| 548 | nmdc:mga0n895_456462_c1 | 3300050512 | Bacteria | 1290 |
| 549 | nmdc:mga08x19_27360_c1 | 3300050514 | Bacteria | 3566 |
| 550 | nmdc:mga0a205_10688_c1 | 3300050515 | Bacteria | 8438 |
| 551 | nmdc:mga0a205_15001_c1 | 3300050515 | Bacteria | 7232 |
| 552 | nmdc:mga0a205_286565_c1 | 3300050515 | Bacteria | 1522 |
| 553 | nmdc:mga0a205_30300_c1 | 3300050515 | Bacteria | 5179 |
| 554 | nmdc:mga0a205_38625_c1 | 3300050515 | Unclassified | 4593 |
| 555 | nmdc:mga0a205_68959_c1 | 3300050515 | Unclassified | 3415 |
| 556 | Ga0501082_0000143 | 3300060353 | Bacteria | 59481 |
| 557 | Ga0501082_0164847 | 3300060353 | Bacteria | 1926 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037068 | Ga0373925_0324829 | Ga0373925_0324829_84_992 | 278 |
| 2 | 3300046679 | Ga0495623_0198969 | Ga0495623_0198969_220_1140 | 301 |
| 3 | 3300042012 | Ga0439455_0043303 | Ga0439455_0043303_142_1095 | 311 |
| 4 | 3300005439 | Ga0070711_100000931 | Ga0070711_1000009314 | 316 |
| 5 | 3300025931 | Ga0207644_10000697 | Ga0207644_1000069710 | 316 |
| 6 | 3300044842 | Ga0466957_0263213 | Ga0466957_0263213_160_1131 | 319 |
| 7 | 3300009553 | Ga0105249_10693125 | Ga0105249_106931251 | 330 |
| 8 | 3300050512 | nmdc:mga0n895_329363_c1 | nmdc:mga0n895_329363_c1_39_1145 | 341 |
| 9 | 3300005467 | Ga0070706_100020539 | Ga0070706_1000205393 | 342 |
| 10 | 3300005468 | Ga0070707_100001233 | Ga0070707_10000123314 | 342 |
| 11 | 3300005536 | Ga0070697_100127036 | Ga0070697_1001270362 | 342 |
| 12 | 3300025910 | Ga0207684_10008212 | Ga0207684_100082127 | 342 |
| 13 | 3300025922 | Ga0207646_10016348 | Ga0207646_100163487 | 342 |
| 14 | 3300005536 | Ga0070697_100000695 | Ga0070697_10000069512 | 343 |
| 15 | 3300006163 | Ga0070715_10021916 | Ga0070715_100219162 | 344 |
| 16 | 3300025910 | Ga0207684_10234475 | Ga0207684_102344751 | 344 |
| 17 | 3300046475 | Ga0495639_0028109 | Ga0495639_0028109_1247_2353 | 344 |
| 18 | 3300046499 | Ga0495594_0112244 | Ga0495594_0112244_308_1414 | 344 |
| 19 | 3300046683 | Ga0495658_0166147 | Ga0495658_0166147_71_1177 | 344 |
| 20 | 3300046689 | Ga0495613_0060230 | Ga0495613_0060230_1226_2332 | 344 |
| 21 | 3300047319 | Ga0495674_0123573 | Ga0495674_0123573_461_1567 | 344 |
| 22 | 3300048089 | Ga0495614_0010864 | Ga0495614_0010864_2202_3308 | 344 |
| 23 | 3300028379 | Ga0268266_10001048 | Ga0268266_1000104824 | 345 |
| 24 | 3300005334 | Ga0068869_100186165 | Ga0068869_1001861652 | 350 |
| 25 | 3300005985 | Ga0081539_10042197 | Ga0081539_100421972 | 350 |
| 26 | 3300006173 | Ga0070716_100009299 | Ga0070716_1000092992 | 350 |
| 27 | 3300025939 | Ga0207665_10000030 | Ga0207665_100000307 | 350 |
| 28 | 3300028653 | Ga0265323_10002725 | Ga0265323_100027254 | 350 |
| 29 | 3300006175 | Ga0070712_100000445 | Ga0070712_10000044514 | 351 |
| 30 | 3300009147 | Ga0114129_10523764 | Ga0114129_105237642 | 351 |
| 31 | 3300009148 | Ga0105243_10048803 | Ga0105243_100488031 | 351 |
| 32 | 3300009174 | Ga0105241_10059875 | Ga0105241_100598752 | 351 |
| 33 | 3300009177 | Ga0105248_10025877 | Ga0105248_100258775 | 351 |
| 34 | 3300013297 | Ga0157378_10007890 | Ga0157378_100078902 | 351 |
| 35 | 3300013306 | Ga0163162_10186559 | Ga0163162_101865592 | 351 |
| 36 | 3300014325 | Ga0163163_10233577 | Ga0163163_102335771 | 351 |
| 37 | 3300014969 | Ga0157376_10001577 | Ga0157376_100015776 | 351 |
| 38 | 3300025916 | Ga0207663_10003410 | Ga0207663_100034104 | 351 |
| 39 | 3300027671 | Ga0209588_1000854 | Ga0209588_10008542 | 352 |
| 40 | 3300049573 | Ga0501037_0022707 | Ga0501037_0022707_3317_4387 | 352 |
| 41 | 3300049574 | Ga0501038_0179013 | Ga0501038_0179013_497_1567 | 352 |
| 42 | 3300049579 | Ga0501043_0035939 | Ga0501043_0035939_1574_2644 | 352 |
| 43 | 3300049589 | Ga0501073_0010061 | Ga0501073_0010061_4046_5116 | 352 |
| 44 | 3300005614 | Ga0068856_100036669 | Ga0068856_1000366694 | 353 |
| 45 | 3300013104 | Ga0157370_10014337 | Ga0157370_100143373 | 353 |
| 46 | 3300013307 | Ga0157372_10359528 | Ga0157372_103595282 | 353 |
| 47 | 3300021388 | Ga0213875_10000002 | Ga0213875_10000002115 | 353 |
| 48 | 3300031344 | Ga0265316_10010253 | Ga0265316_100102535 | 353 |
| 49 | 3300037068 | Ga0373925_0015405 | Ga0373925_0015405_4429_5502 | 353 |
| 50 | 3300037853 | Ga0436364_0919396 | Ga0436364_0919396_3616_4689 | 353 |
| 51 | 3300042876 | Ga0451577_0161665 | Ga0451577_0161665_231_1304 | 353 |
| 52 | 3300049571 | Ga0501034_0009063 | Ga0501034_0009063_6584_7702 | 353 |
| 53 | 3300049581 | Ga0501047_0004792 | Ga0501047_0004792_6907_8025 | 353 |
| 54 | 3300049586 | Ga0501070_0030266 | Ga0501070_0030266_249_1367 | 353 |
| 55 | 3300049679 | Ga0501249_002297 | Ga0501249_002297_734_1810 | 353 |
| 56 | 3300049765 | Ga0501268_009875 | Ga0501268_009875_43_1119 | 353 |
| 57 | 3300049822 | Ga0501035_0004621 | Ga0501035_0004621_11313_12431 | 353 |
| 58 | 3300049823 | Ga0501044_0001767 | Ga0501044_0001767_10506_11579 | 353 |
| 59 | 3300050507 | nmdc:mga05p37_387094_c1 | nmdc:mga05p37_387094_c1_561_1622 | 353 |
| 60 | 3300005289 | Ga0065704_10179851 | Ga0065704_101798511 | 354 |
| 61 | 3300005330 | Ga0070690_100004947 | Ga0070690_1000049474 | 354 |
| 62 | 3300005544 | Ga0070686_100014687 | Ga0070686_1000146871 | 354 |
| 63 | 3300009094 | Ga0111539_10134232 | Ga0111539_101342322 | 354 |
| 64 | 3300050511 | nmdc:mga08y16_1416_c1 | nmdc:mga08y16_1416_c1_22873_23949 | 354 |
| 65 | 3300005337 | Ga0070682_100021210 | Ga0070682_1000212103 | 355 |
| 66 | 3300005440 | Ga0070705_100033954 | Ga0070705_1000339542 | 355 |
| 67 | 3300005842 | Ga0068858_100040084 | Ga0068858_1000400844 | 355 |
| 68 | 3300006237 | Ga0097621_100003224 | Ga0097621_1000032245 | 355 |
| 69 | 3300009147 | Ga0114129_10074352 | Ga0114129_100743523 | 355 |
| 70 | 3300009551 | Ga0105238_10122670 | Ga0105238_101226701 | 355 |
| 71 | 3300026035 | Ga0207703_10067362 | Ga0207703_100673623 | 355 |
| 72 | 3300026075 | Ga0207708_10044077 | Ga0207708_100440773 | 355 |
| 73 | 3300005444 | Ga0070694_100023010 | Ga0070694_1000230102 | 356 |
| 74 | 3300009174 | Ga0105241_10160393 | Ga0105241_101603932 | 356 |
| 75 | 3300009177 | Ga0105248_10224934 | Ga0105248_102249342 | 356 |
| 76 | 3300013308 | Ga0157375_10145427 | Ga0157375_101454271 | 356 |
| 77 | 3300014326 | Ga0157380_10011778 | Ga0157380_100117782 | 356 |
| 78 | 3300048915 | Ga0496112_0270713 | Ga0496112_0270713_31_1113 | 356 |
| 79 | 3300050515 | nmdc:mga0a205_38625_c1 | nmdc:mga0a205_38625_c1_1745_2827 | 356 |
| 80 | 3300046462 | Ga0495651_0272397 | Ga0495651_0272397_14_1132 | 358 |
| 81 | 3300048915 | Ga0496112_0128781 | Ga0496112_0128781_1308_2432 | 358 |
| 82 | 3300009176 | Ga0105242_10029701 | Ga0105242_100297012 | 359 |
| 83 | 3300009177 | Ga0105248_10041604 | Ga0105248_100416041 | 359 |
| 84 | 3300013296 | Ga0157374_10331326 | Ga0157374_103313262 | 359 |
| 85 | 3300013297 | Ga0157378_10005454 | Ga0157378_100054543 | 359 |
| 86 | 3300013306 | Ga0163162_10005567 | Ga0163162_100055674 | 359 |
| 87 | 3300014325 | Ga0163163_10006693 | Ga0163163_100066933 | 359 |
| 88 | 3300021361 | Ga0213872_10000182 | Ga0213872_1000018220 | 359 |
| 89 | 3300039447 | Ga0436361_0126076 | Ga0436361_0126076_29692_30807 | 359 |
| 90 | 3300005455 | Ga0070663_100175768 | Ga0070663_1001757682 | 360 |
| 91 | 3300005563 | Ga0068855_100008615 | Ga0068855_1000086159 | 360 |
| 92 | 3300006852 | Ga0075433_10022329 | Ga0075433_100223291 | 360 |
| 93 | 3300006880 | Ga0075429_100147437 | Ga0075429_1001474372 | 360 |
| 94 | 3300009147 | Ga0114129_10094958 | Ga0114129_100949584 | 360 |
| 95 | 3300025942 | Ga0207689_10157109 | Ga0207689_101571092 | 360 |
| 96 | 3300025949 | Ga0207667_10012848 | Ga0207667_100128489 | 360 |
| 97 | 3300026067 | Ga0207678_10131094 | Ga0207678_101310942 | 360 |
| 98 | 3300037418 | Ga0395900_0147356 | Ga0395900_0147356_500_1594 | 360 |
| 99 | 3300050507 | nmdc:mga05p37_151371_c1 | nmdc:mga05p37_151371_c1_897_1991 | 360 |
| 100 | 3300005616 | Ga0068852_100086989 | Ga0068852_1000869892 | 362 |
| 101 | 3300005618 | Ga0068864_100132563 | Ga0068864_1001325632 | 362 |
| 102 | 3300009093 | Ga0105240_10190007 | Ga0105240_101900072 | 362 |
| 103 | 3300009148 | Ga0105243_10138871 | Ga0105243_101388712 | 362 |
| 104 | 3300013104 | Ga0157370_10249625 | Ga0157370_102496252 | 362 |
| 105 | 3300025913 | Ga0207695_10161432 | Ga0207695_101614322 | 362 |
| 106 | 3300050515 | nmdc:mga0a205_10688_c1 | nmdc:mga0a205_10688_c1_4132_5238 | 364 |
| 107 | 3300005327 | Ga0070658_10021836 | Ga0070658_100218363 | 365 |
| 108 | 3300005327 | Ga0070658_10041318 | Ga0070658_100413182 | 365 |
| 109 | 3300005327 | Ga0070658_10328549 | Ga0070658_103285491 | 365 |
| 110 | 3300005329 | Ga0070683_100000021 | Ga0070683_10000002167 | 365 |
| 111 | 3300005336 | Ga0070680_100117884 | Ga0070680_1001178842 | 365 |
| 112 | 3300005364 | Ga0070673_100016117 | Ga0070673_1000161177 | 365 |
| 113 | 3300005439 | Ga0070711_100077664 | Ga0070711_1000776642 | 365 |
| 114 | 3300005458 | Ga0070681_10032432 | Ga0070681_100324325 | 365 |
| 115 | 3300005530 | Ga0070679_100043317 | Ga0070679_1000433173 | 365 |
| 116 | 3300005535 | Ga0070684_100000010 | Ga0070684_10000001096 | 365 |
| 117 | 3300005563 | Ga0068855_100052768 | Ga0068855_1000527683 | 365 |
| 118 | 3300005563 | Ga0068855_100395738 | Ga0068855_1003957382 | 365 |
| 119 | 3300005614 | Ga0068856_100031235 | Ga0068856_1000312353 | 365 |
| 120 | 3300005614 | Ga0068856_100100190 | Ga0068856_1001001903 | 365 |
| 121 | 3300005617 | Ga0068859_100191234 | Ga0068859_1001912343 | 365 |
| 122 | 3300005841 | Ga0068863_100124970 | Ga0068863_1001249703 | 365 |
| 123 | 3300006914 | Ga0075436_100049077 | Ga0075436_1000490772 | 365 |
| 124 | 3300006931 | Ga0097620_100191248 | Ga0097620_1001912483 | 365 |
| 125 | 3300009147 | Ga0114129_10252698 | Ga0114129_102526983 | 365 |
| 126 | 3300009545 | Ga0105237_10103450 | Ga0105237_101034502 | 365 |
| 127 | 3300009545 | Ga0105237_10162831 | Ga0105237_101628312 | 365 |
| 128 | 3300010375 | Ga0105239_10225435 | Ga0105239_102254353 | 365 |
| 129 | 3300013104 | Ga0157370_10002433 | Ga0157370_100024336 | 365 |
| 130 | 3300013104 | Ga0157370_10184820 | Ga0157370_101848202 | 365 |
| 131 | 3300013308 | Ga0157375_10056314 | Ga0157375_100563142 | 365 |
| 132 | 3300013308 | Ga0157375_10483758 | Ga0157375_104837581 | 365 |
| 133 | 3300014325 | Ga0163163_10011781 | Ga0163163_100117813 | 365 |
| 134 | 3300014325 | Ga0163163_10120077 | Ga0163163_101200773 | 365 |
| 135 | 3300014969 | Ga0157376_10081340 | Ga0157376_100813402 | 365 |
| 136 | 3300021384 | Ga0213876_10116309 | Ga0213876_101163092 | 365 |
| 137 | 3300021388 | Ga0213875_10002433 | Ga0213875_100024334 | 365 |
| 138 | 3300021388 | Ga0213875_10028154 | Ga0213875_100281542 | 365 |
| 139 | 3300025909 | Ga0207705_10039367 | Ga0207705_100393673 | 365 |
| 140 | 3300025912 | Ga0207707_10081820 | Ga0207707_100818203 | 365 |
| 141 | 3300025913 | Ga0207695_10000956 | Ga0207695_1000095616 | 365 |
| 142 | 3300025913 | Ga0207695_10175099 | Ga0207695_101750992 | 365 |
| 143 | 3300025915 | Ga0207693_10000120 | Ga0207693_1000012040 | 365 |
| 144 | 3300025921 | Ga0207652_10045909 | Ga0207652_100459093 | 365 |
| 145 | 3300025941 | Ga0207711_10254852 | Ga0207711_102548522 | 365 |
| 146 | 3300025944 | Ga0207661_10000012 | Ga0207661_10000012245 | 365 |
| 147 | 3300025949 | Ga0207667_10039208 | Ga0207667_100392085 | 365 |
| 148 | 3300025949 | Ga0207667_10311084 | Ga0207667_103110842 | 365 |
| 149 | 3300025960 | Ga0207651_10036023 | Ga0207651_100360234 | 365 |
| 150 | 3300026088 | Ga0207641_10173256 | Ga0207641_101732561 | 365 |
| 151 | 3300031242 | Ga0265329_10023513 | Ga0265329_100235132 | 365 |
| 152 | 3300031344 | Ga0265316_10012442 | Ga0265316_100124424 | 365 |
| 153 | 3300031344 | Ga0265316_10102988 | Ga0265316_101029882 | 365 |
| 154 | 3300031344 | Ga0265316_10107657 | Ga0265316_101076572 | 365 |
| 155 | 3300031344 | Ga0265316_10115600 | Ga0265316_101156002 | 365 |
| 156 | 3300035725 | Ga0373947_0134284 | Ga0373947_0134284_165_1274 | 365 |
| 157 | 3300036401 | Ga0373937_0026652 | Ga0373937_0026652_2647_3771 | 365 |
| 158 | 3300036401 | Ga0373937_0140306 | Ga0373937_0140306_878_1990 | 365 |
| 159 | 3300036401 | Ga0373937_0144233 | Ga0373937_0144233_402_1511 | 365 |
| 160 | 3300037853 | Ga0436364_0517360 | Ga0436364_0517360_9661_10773 | 365 |
| 161 | 3300039437 | Ga0436365_1793553 | Ga0436365_1793553_5228_6337 | 365 |
| 162 | 3300042005 | Ga0439448_0029165 | Ga0439448_0029165_266_1381 | 365 |
| 163 | 3300045976 | Ga0466967_0112795 | Ga0466967_0112795_134_1243 | 365 |
| 164 | 3300046454 | Ga0495592_0008047 | Ga0495592_0008047_1850_2962 | 365 |
| 165 | 3300046462 | Ga0495651_0019957 | Ga0495651_0019957_3997_5109 | 365 |
| 166 | 3300046463 | Ga0495653_0046441 | Ga0495653_0046441_339_1451 | 365 |
| 167 | 3300046477 | Ga0495664_0010701 | Ga0495664_0010701_345_1457 | 365 |
| 168 | 3300046477 | Ga0495664_0113408 | Ga0495664_0113408_139_1248 | 365 |
| 169 | 3300046516 | Ga0495628_0033135 | Ga0495628_0033135_2883_3995 | 365 |
| 170 | 3300046642 | Ga0495634_0129413 | Ga0495634_0129413_164_1276 | 365 |
| 171 | 3300047319 | Ga0495674_0114505 | Ga0495674_0114505_169_1281 | 365 |
| 172 | 3300047319 | Ga0495674_0153187 | Ga0495674_0153187_508_1617 | 365 |
| 173 | 3300047322 | Ga0495680_0009823 | Ga0495680_0009823_2946_4058 | 365 |
| 174 | 3300047444 | Ga0495675_0117237 | Ga0495675_0117237_493_1602 | 365 |
| 175 | 3300048088 | Ga0495602_0051524 | Ga0495602_0051524_2039_3151 | 365 |
| 176 | 3300050507 | nmdc:mga05p37_524231_c1 | nmdc:mga05p37_524231_c1_109_1218 | 365 |
| 177 | 3300060353 | Ga0501082_0000143 | Ga0501082_0000143_1571_2680 | 365 |
| 178 | 3300060353 | Ga0501082_0164847 | Ga0501082_0164847_398_1507 | 365 |
| 179 | 3300005327 | Ga0070658_10082218 | Ga0070658_100822183 | 366 |
| 180 | 3300005330 | Ga0070690_100139041 | Ga0070690_1001390411 | 366 |
| 181 | 3300005335 | Ga0070666_10015597 | Ga0070666_100155972 | 366 |
| 182 | 3300005336 | Ga0070680_100002897 | Ga0070680_1000028971 | 366 |
| 183 | 3300005338 | Ga0068868_100014431 | Ga0068868_1000144314 | 366 |
| 184 | 3300005338 | Ga0068868_100140825 | Ga0068868_1001408251 | 366 |
| 185 | 3300005355 | Ga0070671_100043941 | Ga0070671_1000439414 | 366 |
| 186 | 3300005367 | Ga0070667_100027179 | Ga0070667_1000271792 | 366 |
| 187 | 3300005458 | Ga0070681_10035292 | Ga0070681_100352923 | 366 |
| 188 | 3300005459 | Ga0068867_100039914 | Ga0068867_1000399142 | 366 |
| 189 | 3300005468 | Ga0070707_100098794 | Ga0070707_1000987944 | 366 |
| 190 | 3300005530 | Ga0070679_100000024 | Ga0070679_1000000247 | 366 |
| 191 | 3300005530 | Ga0070679_100022298 | Ga0070679_1000222984 | 366 |
| 192 | 3300005530 | Ga0070679_100126980 | Ga0070679_1001269802 | 366 |
| 193 | 3300005530 | Ga0070679_100145094 | Ga0070679_1001450942 | 366 |
| 194 | 3300005535 | Ga0070684_100047549 | Ga0070684_1000475491 | 366 |
| 195 | 3300005546 | Ga0070696_100044752 | Ga0070696_1000447521 | 366 |
| 196 | 3300005548 | Ga0070665_100130282 | Ga0070665_1001302822 | 366 |
| 197 | 3300005563 | Ga0068855_100006381 | Ga0068855_1000063817 | 366 |
| 198 | 3300005564 | Ga0070664_100231112 | Ga0070664_1002311122 | 366 |
| 199 | 3300005577 | Ga0068857_100004403 | Ga0068857_10000440310 | 366 |
| 200 | 3300005577 | Ga0068857_100009275 | Ga0068857_1000092752 | 366 |
| 201 | 3300005616 | Ga0068852_100117669 | Ga0068852_1001176691 | 366 |
| 202 | 3300005617 | Ga0068859_100108160 | Ga0068859_1001081602 | 366 |
| 203 | 3300005618 | Ga0068864_100171461 | Ga0068864_1001714612 | 366 |
| 204 | 3300005842 | Ga0068858_100007926 | Ga0068858_1000079268 | 366 |
| 205 | 3300005842 | Ga0068858_100036407 | Ga0068858_1000364075 | 366 |
| 206 | 3300005843 | Ga0068860_100009604 | Ga0068860_1000096048 | 366 |
| 207 | 3300006237 | Ga0097621_100005607 | Ga0097621_10000560710 | 366 |
| 208 | 3300006237 | Ga0097621_100227181 | Ga0097621_1002271812 | 366 |
| 209 | 3300006358 | Ga0068871_100007548 | Ga0068871_1000075483 | 366 |
| 210 | 3300006358 | Ga0068871_100016723 | Ga0068871_1000167237 | 366 |
| 211 | 3300006358 | Ga0068871_100193739 | Ga0068871_1001937392 | 366 |
| 212 | 3300006847 | Ga0075431_100062459 | Ga0075431_1000624593 | 366 |
| 213 | 3300006931 | Ga0097620_100108153 | Ga0097620_1001081532 | 366 |
| 214 | 3300007076 | Ga0075435_100130005 | Ga0075435_1001300051 | 366 |
| 215 | 3300009093 | Ga0105240_10001081 | Ga0105240_1000108110 | 366 |
| 216 | 3300009093 | Ga0105240_10001462 | Ga0105240_1000146220 | 366 |
| 217 | 3300009093 | Ga0105240_10024119 | Ga0105240_100241194 | 366 |
| 218 | 3300009098 | Ga0105245_10002961 | Ga0105245_100029612 | 366 |
| 219 | 3300009098 | Ga0105245_10003583 | Ga0105245_100035839 | 366 |
| 220 | 3300009098 | Ga0105245_10013874 | Ga0105245_100138743 | 366 |
| 221 | 3300009174 | Ga0105241_10023577 | Ga0105241_100235773 | 366 |
| 222 | 3300009174 | Ga0105241_10265771 | Ga0105241_102657712 | 366 |
| 223 | 3300009176 | Ga0105242_10110566 | Ga0105242_101105663 | 366 |
| 224 | 3300009176 | Ga0105242_10132819 | Ga0105242_101328192 | 366 |
| 225 | 3300009177 | Ga0105248_10021339 | Ga0105248_100213395 | 366 |
| 226 | 3300009177 | Ga0105248_10041537 | Ga0105248_100415374 | 366 |
| 227 | 3300009545 | Ga0105237_10027216 | Ga0105237_100272165 | 366 |
| 228 | 3300009551 | Ga0105238_10026874 | Ga0105238_100268744 | 366 |
| 229 | 3300009551 | Ga0105238_10068045 | Ga0105238_100680452 | 366 |
| 230 | 3300009551 | Ga0105238_10226562 | Ga0105238_102265622 | 366 |
| 231 | 3300009551 | Ga0105238_10263773 | Ga0105238_102637732 | 366 |
| 232 | 3300010375 | Ga0105239_10026006 | Ga0105239_100260062 | 366 |
| 233 | 3300010375 | Ga0105239_10146160 | Ga0105239_101461602 | 366 |
| 234 | 3300010375 | Ga0105239_10668913 | Ga0105239_106689131 | 366 |
| 235 | 3300013104 | Ga0157370_10002565 | Ga0157370_100025658 | 366 |
| 236 | 3300013104 | Ga0157370_10242189 | Ga0157370_102421892 | 366 |
| 237 | 3300013105 | Ga0157369_10163100 | Ga0157369_101631002 | 366 |
| 238 | 3300013105 | Ga0157369_10203438 | Ga0157369_102034382 | 366 |
| 239 | 3300013296 | Ga0157374_10004841 | Ga0157374_1000484111 | 366 |
| 240 | 3300013297 | Ga0157378_10002212 | Ga0157378_1000221210 | 366 |
| 241 | 3300013297 | Ga0157378_10115071 | Ga0157378_101150713 | 366 |
| 242 | 3300013306 | Ga0163162_10009410 | Ga0163162_100094109 | 366 |
| 243 | 3300013306 | Ga0163162_10025973 | Ga0163162_100259734 | 366 |
| 244 | 3300013306 | Ga0163162_10144071 | Ga0163162_101440712 | 366 |
| 245 | 3300013308 | Ga0157375_10125508 | Ga0157375_101255082 | 366 |
| 246 | 3300014325 | Ga0163163_10001650 | Ga0163163_1000165010 | 366 |
| 247 | 3300014325 | Ga0163163_10025404 | Ga0163163_100254045 | 366 |
| 248 | 3300014325 | Ga0163163_10073106 | Ga0163163_100731062 | 366 |
| 249 | 3300014325 | Ga0163163_10272026 | Ga0163163_102720262 | 366 |
| 250 | 3300014969 | Ga0157376_10067761 | Ga0157376_100677612 | 366 |
| 251 | 3300025899 | Ga0207642_10020481 | Ga0207642_100204813 | 366 |
| 252 | 3300025903 | Ga0207680_10007757 | Ga0207680_100077574 | 366 |
| 253 | 3300025912 | Ga0207707_10000188 | Ga0207707_1000018822 | 366 |
| 254 | 3300025912 | Ga0207707_10077565 | Ga0207707_100775653 | 366 |
| 255 | 3300025913 | Ga0207695_10004456 | Ga0207695_100044562 | 366 |
| 256 | 3300025913 | Ga0207695_10006735 | Ga0207695_100067353 | 366 |
| 257 | 3300025913 | Ga0207695_10006834 | Ga0207695_1000683410 | 366 |
| 258 | 3300025913 | Ga0207695_10090951 | Ga0207695_100909512 | 366 |
| 259 | 3300025913 | Ga0207695_10102144 | Ga0207695_101021443 | 366 |
| 260 | 3300025913 | Ga0207695_10352483 | Ga0207695_103524832 | 366 |
| 261 | 3300025914 | Ga0207671_10043411 | Ga0207671_100434113 | 366 |
| 262 | 3300025914 | Ga0207671_10121391 | Ga0207671_101213912 | 366 |
| 263 | 3300025917 | Ga0207660_10000403 | Ga0207660_100004031 | 366 |
| 264 | 3300025918 | Ga0207662_10020960 | Ga0207662_100209602 | 366 |
| 265 | 3300025921 | Ga0207652_10001088 | Ga0207652_100010887 | 366 |
| 266 | 3300025924 | Ga0207694_10090693 | Ga0207694_100906932 | 366 |
| 267 | 3300025927 | Ga0207687_10013347 | Ga0207687_100133473 | 366 |
| 268 | 3300025927 | Ga0207687_10016925 | Ga0207687_100169253 | 366 |
| 269 | 3300025934 | Ga0207686_10026264 | Ga0207686_100262642 | 366 |
| 270 | 3300025941 | Ga0207711_10037483 | Ga0207711_100374834 | 366 |
| 271 | 3300025941 | Ga0207711_10122997 | Ga0207711_101229972 | 366 |
| 272 | 3300025941 | Ga0207711_10211963 | Ga0207711_102119633 | 366 |
| 273 | 3300025949 | Ga0207667_10023104 | Ga0207667_100231047 | 366 |
| 274 | 3300025949 | Ga0207667_10211305 | Ga0207667_102113052 | 366 |
| 275 | 3300025986 | Ga0207658_10037802 | Ga0207658_100378024 | 366 |
| 276 | 3300026023 | Ga0207677_10017181 | Ga0207677_100171812 | 366 |
| 277 | 3300026035 | Ga0207703_10022493 | Ga0207703_100224932 | 366 |
| 278 | 3300026041 | Ga0207639_10127024 | Ga0207639_101270242 | 366 |
| 279 | 3300026067 | Ga0207678_10057538 | Ga0207678_100575383 | 366 |
| 280 | 3300026078 | Ga0207702_10136543 | Ga0207702_101365432 | 366 |
| 281 | 3300026089 | Ga0207648_10115874 | Ga0207648_101158742 | 366 |
| 282 | 3300026116 | Ga0207674_10013162 | Ga0207674_100131629 | 366 |
| 283 | 3300028379 | Ga0268266_10049494 | Ga0268266_100494943 | 366 |
| 284 | 3300028381 | Ga0268264_10064123 | Ga0268264_100641232 | 366 |
| 285 | 3300035118 | Ga0373954_0076447 | Ga0373954_0076447_278_1423 | 366 |
| 286 | 3300035170 | Ga0373943_0019944 | Ga0373943_0019944_1172_2308 | 366 |
| 287 | 3300035692 | Ga0373935_0036866 | Ga0373935_0036866_1247_2383 | 366 |
| 288 | 3300035692 | Ga0373935_0056366 | Ga0373935_0056366_1093_2208 | 366 |
| 289 | 3300035695 | Ga0373927_0003141 | Ga0373927_0003141_4688_5803 | 366 |
| 290 | 3300035695 | Ga0373927_0044038 | Ga0373927_0044038_577_1701 | 366 |
| 291 | 3300035725 | Ga0373947_0089555 | Ga0373947_0089555_307_1422 | 366 |
| 292 | 3300037068 | Ga0373925_0107697 | Ga0373925_0107697_953_2089 | 366 |
| 293 | 3300037418 | Ga0395900_0240000 | Ga0395900_0240000_574_1704 | 366 |
| 294 | 3300037466 | Ga0395898_0272982 | Ga0395898_0272982_461_1576 | 366 |
| 295 | 3300039437 | Ga0436365_0001504 | Ga0436365_0001504_84_1199 | 366 |
| 296 | 3300039437 | Ga0436365_1492531 | Ga0436365_1492531_48_1163 | 366 |
| 297 | 3300039438 | Ga0436360_1323621 | Ga0436360_1323621_265_1380 | 366 |
| 298 | 3300039450 | Ga0436363_0737069 | Ga0436363_0737069_188_1303 | 366 |
| 299 | 3300045051 | Ga0451576_0525896 | Ga0451576_0525896_43_1158 | 366 |
| 300 | 3300046476 | Ga0495662_0058736 | Ga0495662_0058736_181_1296 | 366 |
| 301 | 3300046529 | Ga0495652_0118298 | Ga0495652_0118298_503_1648 | 366 |
| 302 | 3300046678 | Ga0495599_0146449 | Ga0495599_0146449_211_1326 | 366 |
| 303 | 3300047319 | Ga0495674_0013188 | Ga0495674_0013188_340_1455 | 366 |
| 304 | 3300047319 | Ga0495674_0083076 | Ga0495674_0083076_744_1868 | 366 |
| 305 | 3300047444 | Ga0495675_0036147 | Ga0495675_0036147_305_1450 | 366 |
| 306 | 3300047471 | Ga0495684_0025144 | Ga0495684_0025144_3268_4413 | 366 |
| 307 | 3300048918 | Ga0496115_0015570 | Ga0496115_0015570_2354_3469 | 366 |
| 308 | 3300049586 | Ga0501070_0035687 | Ga0501070_0035687_1309_2424 | 366 |
| 309 | 3300049589 | Ga0501073_0094455 | Ga0501073_0094455_516_1631 | 366 |
| 310 | 3300049823 | Ga0501044_0002962 | Ga0501044_0002962_5141_6256 | 366 |
| 311 | 3300050509 | nmdc:mga0qj67_21139_c1 | nmdc:mga0qj67_21139_c1_3313_4428 | 366 |
| 312 | 3300050510 | nmdc:mga06r32_28441_c1 | nmdc:mga06r32_28441_c1_2430_3545 | 366 |
| 313 | 3300005614 | Ga0068856_100100440 | Ga0068856_1001004402 | 367 |
| 314 | 3300010375 | Ga0105239_10172080 | Ga0105239_101720802 | 367 |
| 315 | 3300025935 | Ga0207709_10083229 | Ga0207709_100832292 | 367 |
| 316 | 3300025945 | Ga0207679_10148668 | Ga0207679_101486681 | 367 |
| 317 | 3300026089 | Ga0207648_10012665 | Ga0207648_100126655 | 367 |
| 318 | 3300048911 | Ga0496108_0048914 | Ga0496108_0048914_404_1516 | 367 |
| 319 | 3300050515 | nmdc:mga0a205_286565_c1 | nmdc:mga0a205_286565_c1_58_1170 | 367 |
| 320 | 3300005339 | Ga0070660_100050185 | Ga0070660_1000501853 | 368 |
| 321 | 3300005366 | Ga0070659_100003961 | Ga0070659_1000039612 | 368 |
| 322 | 3300005366 | Ga0070659_100147990 | Ga0070659_1001479902 | 368 |
| 323 | 3300005458 | Ga0070681_10011692 | Ga0070681_100116922 | 368 |
| 324 | 3300005530 | Ga0070679_100009548 | Ga0070679_1000095485 | 368 |
| 325 | 3300005539 | Ga0068853_100006614 | Ga0068853_1000066142 | 368 |
| 326 | 3300009174 | Ga0105241_10157623 | Ga0105241_101576232 | 368 |
| 327 | 3300009177 | Ga0105248_10008484 | Ga0105248_100084845 | 368 |
| 328 | 3300013100 | Ga0157373_10009713 | Ga0157373_100097134 | 368 |
| 329 | 3300013306 | Ga0163162_10061562 | Ga0163162_100615622 | 368 |
| 330 | 3300013307 | Ga0157372_10122165 | Ga0157372_101221652 | 368 |
| 331 | 3300014325 | Ga0163163_10084927 | Ga0163163_100849272 | 368 |
| 332 | 3300025912 | Ga0207707_10154111 | Ga0207707_101541112 | 368 |
| 333 | 3300025919 | Ga0207657_10188374 | Ga0207657_101883742 | 368 |
| 334 | 3300025921 | Ga0207652_10176495 | Ga0207652_101764952 | 368 |
| 335 | 3300025932 | Ga0207690_10118328 | Ga0207690_101183281 | 368 |
| 336 | 3300025941 | Ga0207711_10035254 | Ga0207711_100352543 | 368 |
| 337 | 3300026035 | Ga0207703_10330799 | Ga0207703_103307992 | 368 |
| 338 | 3300026041 | Ga0207639_10030418 | Ga0207639_100304182 | 368 |
| 339 | 3300026116 | Ga0207674_10000258 | Ga0207674_1000025820 | 368 |
| 340 | 3300005440 | Ga0070705_100182722 | Ga0070705_1001827222 | 369 |
| 341 | 3300006852 | Ga0075433_10097983 | Ga0075433_100979833 | 369 |
| 342 | 3300006871 | Ga0075434_100176517 | Ga0075434_1001765172 | 369 |
| 343 | 3300037853 | Ga0436364_0478638 | Ga0436364_0478638_187_1332 | 369 |
| 344 | 3300039437 | Ga0436365_0576586 | Ga0436365_0576586_47094_48221 | 369 |
| 345 | 3300050512 | nmdc:mga0n895_456462_c1 | nmdc:mga0n895_456462_c1_152_1273 | 369 |
| 346 | 3300050515 | nmdc:mga0a205_30300_c1 | nmdc:mga0a205_30300_c1_3996_5117 | 369 |
| 347 | 3300005290 | Ga0065712_10071107 | Ga0065712_100711072 | 370 |
| 348 | 3300005293 | Ga0065715_10003032 | Ga0065715_100030322 | 370 |
| 349 | 3300005331 | Ga0070670_100044693 | Ga0070670_1000446932 | 370 |
| 350 | 3300005366 | Ga0070659_100077650 | Ga0070659_1000776502 | 370 |
| 351 | 3300005441 | Ga0070700_100039598 | Ga0070700_1000395982 | 370 |
| 352 | 3300005444 | Ga0070694_100036812 | Ga0070694_1000368122 | 370 |
| 353 | 3300005467 | Ga0070706_100193560 | Ga0070706_1001935602 | 370 |
| 354 | 3300005471 | Ga0070698_100012714 | Ga0070698_1000127142 | 370 |
| 355 | 3300005578 | Ga0068854_100049090 | Ga0068854_1000490902 | 370 |
| 356 | 3300005615 | Ga0070702_100117331 | Ga0070702_1001173312 | 370 |
| 357 | 3300005617 | Ga0068859_100043442 | Ga0068859_1000434422 | 370 |
| 358 | 3300005617 | Ga0068859_100094508 | Ga0068859_1000945083 | 370 |
| 359 | 3300005617 | Ga0068859_100200060 | Ga0068859_1002000601 | 370 |
| 360 | 3300005841 | Ga0068863_100192914 | Ga0068863_1001929142 | 370 |
| 361 | 3300005844 | Ga0068862_100075458 | Ga0068862_1000754582 | 370 |
| 362 | 3300006844 | Ga0075428_100311227 | Ga0075428_1003112272 | 370 |
| 363 | 3300006852 | Ga0075433_10027374 | Ga0075433_100273745 | 370 |
| 364 | 3300006931 | Ga0097620_100043449 | Ga0097620_1000434492 | 370 |
| 365 | 3300006931 | Ga0097620_100094506 | Ga0097620_1000945063 | 370 |
| 366 | 3300006931 | Ga0097620_100200057 | Ga0097620_1002000571 | 370 |
| 367 | 3300009094 | Ga0111539_10199108 | Ga0111539_101991082 | 370 |
| 368 | 3300009101 | Ga0105247_10101265 | Ga0105247_101012652 | 370 |
| 369 | 3300009147 | Ga0114129_10036974 | Ga0114129_100369743 | 370 |
| 370 | 3300009174 | Ga0105241_10021842 | Ga0105241_100218422 | 370 |
| 371 | 3300009177 | Ga0105248_10007065 | Ga0105248_100070652 | 370 |
| 372 | 3300009545 | Ga0105237_10000506 | Ga0105237_1000050613 | 370 |
| 373 | 3300009553 | Ga0105249_10054535 | Ga0105249_100545352 | 370 |
| 374 | 3300013100 | Ga0157373_10002359 | Ga0157373_1000235912 | 370 |
| 375 | 3300013306 | Ga0163162_10035653 | Ga0163162_100356532 | 370 |
| 376 | 3300014325 | Ga0163163_10002569 | Ga0163163_100025697 | 370 |
| 377 | 3300014745 | Ga0157377_10155057 | Ga0157377_101550572 | 370 |
| 378 | 3300025908 | Ga0207643_10014797 | Ga0207643_100147972 | 370 |
| 379 | 3300025941 | Ga0207711_10037421 | Ga0207711_100374212 | 370 |
| 380 | 3300026116 | Ga0207674_10357554 | Ga0207674_103575542 | 370 |
| 381 | 3300026118 | Ga0207675_100068758 | Ga0207675_1000687582 | 370 |
| 382 | 3300027907 | Ga0207428_10143737 | Ga0207428_101437372 | 370 |
| 383 | 3300028380 | Ga0268265_10080851 | Ga0268265_100808512 | 370 |
| 384 | 3300038996 | Ga0242420_014565 | Ga0242420_014565_148_1272 | 370 |
| 385 | 3300048915 | Ga0496112_0381590 | Ga0496112_0381590_78_1199 | 370 |
| 386 | 3300050507 | nmdc:mga05p37_370186_c1 | nmdc:mga05p37_370186_c1_337_1461 | 370 |
| 387 | 3300050509 | nmdc:mga0qj67_84472_c1 | nmdc:mga0qj67_84472_c1_1270_2394 | 370 |
| 388 | 3300050510 | nmdc:mga06r32_103117_c1 | nmdc:mga06r32_103117_c1_1333_2457 | 370 |
| 389 | 3300050511 | nmdc:mga08y16_94382_c1 | nmdc:mga08y16_94382_c1_287_1411 | 370 |
| 390 | 3300005293 | Ga0065715_10160211 | Ga0065715_101602111 | 371 |
| 391 | 3300005458 | Ga0070681_10002826 | Ga0070681_100028269 | 371 |
| 392 | 3300025912 | Ga0207707_10023499 | Ga0207707_100234994 | 371 |
| 393 | 3300021384 | Ga0213876_10000190 | Ga0213876_100001903 | 372 |
| 394 | 3300026095 | Ga0207676_10077850 | Ga0207676_100778502 | 372 |
| 395 | 3300005334 | Ga0068869_100042160 | Ga0068869_1000421602 | 373 |
| 396 | 3300006844 | Ga0075428_100047888 | Ga0075428_1000478882 | 373 |
| 397 | 3300025942 | Ga0207689_10023365 | Ga0207689_100233652 | 373 |
| 398 | 3300028381 | Ga0268264_10115156 | Ga0268264_101151562 | 373 |
| 399 | 3300005293 | Ga0065715_10003978 | Ga0065715_100039782 | 374 |
| 400 | 3300005338 | Ga0068868_100015298 | Ga0068868_1000152982 | 374 |
| 401 | 3300005343 | Ga0070687_100009738 | Ga0070687_1000097383 | 374 |
| 402 | 3300005353 | Ga0070669_100170916 | Ga0070669_1001709162 | 374 |
| 403 | 3300005444 | Ga0070694_100170670 | Ga0070694_1001706701 | 374 |
| 404 | 3300005468 | Ga0070707_100038528 | Ga0070707_1000385282 | 374 |
| 405 | 3300005518 | Ga0070699_100016094 | Ga0070699_1000160941 | 374 |
| 406 | 3300005547 | Ga0070693_100121652 | Ga0070693_1001216522 | 374 |
| 407 | 3300005548 | Ga0070665_100211319 | Ga0070665_1002113191 | 374 |
| 408 | 3300005549 | Ga0070704_100145136 | Ga0070704_1001451362 | 374 |
| 409 | 3300005616 | Ga0068852_100138198 | Ga0068852_1001381982 | 374 |
| 410 | 3300005617 | Ga0068859_100005492 | Ga0068859_1000054929 | 374 |
| 411 | 3300005617 | Ga0068859_100028044 | Ga0068859_1000280442 | 374 |
| 412 | 3300005617 | Ga0068859_100192611 | Ga0068859_1001926112 | 374 |
| 413 | 3300005618 | Ga0068864_100020345 | Ga0068864_1000203454 | 374 |
| 414 | 3300005719 | Ga0068861_100061865 | Ga0068861_1000618653 | 374 |
| 415 | 3300005841 | Ga0068863_100342164 | Ga0068863_1003421642 | 374 |
| 416 | 3300005842 | Ga0068858_100112772 | Ga0068858_1001127722 | 374 |
| 417 | 3300005843 | Ga0068860_100007661 | Ga0068860_1000076616 | 374 |
| 418 | 3300006237 | Ga0097621_100010726 | Ga0097621_1000107262 | 374 |
| 419 | 3300006852 | Ga0075433_10174817 | Ga0075433_101748172 | 374 |
| 420 | 3300006914 | Ga0075436_100033523 | Ga0075436_1000335231 | 374 |
| 421 | 3300006931 | Ga0097620_100005491 | Ga0097620_1000054912 | 374 |
| 422 | 3300006931 | Ga0097620_100028044 | Ga0097620_1000280442 | 374 |
| 423 | 3300006931 | Ga0097620_100192607 | Ga0097620_1001926072 | 374 |
| 424 | 3300009148 | Ga0105243_10206935 | Ga0105243_102069352 | 374 |
| 425 | 3300011119 | Ga0105246_10226480 | Ga0105246_102264801 | 374 |
| 426 | 3300013306 | Ga0163162_10033314 | Ga0163162_100333142 | 374 |
| 427 | 3300025903 | Ga0207680_10089308 | Ga0207680_100893082 | 374 |
| 428 | 3300025922 | Ga0207646_10069727 | Ga0207646_100697272 | 374 |
| 429 | 3300025941 | Ga0207711_10159506 | Ga0207711_101595062 | 374 |
| 430 | 3300025942 | Ga0207689_10005239 | Ga0207689_100052394 | 374 |
| 431 | 3300025942 | Ga0207689_10135479 | Ga0207689_101354793 | 374 |
| 432 | 3300026023 | Ga0207677_10113601 | Ga0207677_101136012 | 374 |
| 433 | 3300026089 | Ga0207648_10097066 | Ga0207648_100970662 | 374 |
| 434 | 3300026095 | Ga0207676_10108948 | Ga0207676_101089482 | 374 |
| 435 | 3300026118 | Ga0207675_100088894 | Ga0207675_1000888942 | 374 |
| 436 | 3300028381 | Ga0268264_10011513 | Ga0268264_100115135 | 374 |
| 437 | 3300050507 | nmdc:mga05p37_17568_c1 | nmdc:mga05p37_17568_c1_2213_3355 | 374 |
| 438 | 3300050514 | nmdc:mga08x19_27360_c1 | nmdc:mga08x19_27360_c1_2281_3429 | 374 |
| 439 | 3300050515 | nmdc:mga0a205_68959_c1 | nmdc:mga0a205_68959_c1_1733_2875 | 374 |
| 440 | 3300003203 | JGI25406J46586_10025006 | JGI25406J46586_100250062 | 375 |
| 441 | 3300005289 | Ga0065704_10168727 | Ga0065704_101687271 | 375 |
| 442 | 3300005290 | Ga0065712_10000115 | Ga0065712_1000011519 | 375 |
| 443 | 3300005293 | Ga0065715_10090451 | Ga0065715_100904512 | 375 |
| 444 | 3300005295 | Ga0065707_10009392 | Ga0065707_100093922 | 375 |
| 445 | 3300005331 | Ga0070670_100011220 | Ga0070670_1000112202 | 375 |
| 446 | 3300005334 | Ga0068869_100012781 | Ga0068869_1000127813 | 375 |
| 447 | 3300005334 | Ga0068869_100059823 | Ga0068869_1000598232 | 375 |
| 448 | 3300005337 | Ga0070682_100005421 | Ga0070682_1000054215 | 375 |
| 449 | 3300005340 | Ga0070689_100131574 | Ga0070689_1001315742 | 375 |
| 450 | 3300005343 | Ga0070687_100063379 | Ga0070687_1000633792 | 375 |
| 451 | 3300005343 | Ga0070687_100088464 | Ga0070687_1000884641 | 375 |
| 452 | 3300005353 | Ga0070669_100129740 | Ga0070669_1001297401 | 375 |
| 453 | 3300005354 | Ga0070675_100306827 | Ga0070675_1003068271 | 375 |
| 454 | 3300005365 | Ga0070688_100016374 | Ga0070688_1000163742 | 375 |
| 455 | 3300005440 | Ga0070705_100024816 | Ga0070705_1000248162 | 375 |
| 456 | 3300005441 | Ga0070700_100081886 | Ga0070700_1000818862 | 375 |
| 457 | 3300005441 | Ga0070700_100086660 | Ga0070700_1000866602 | 375 |
| 458 | 3300005444 | Ga0070694_100056906 | Ga0070694_1000569062 | 375 |
| 459 | 3300005445 | Ga0070708_100001518 | Ga0070708_1000015186 | 375 |
| 460 | 3300005458 | Ga0070681_10037049 | Ga0070681_100370492 | 375 |
| 461 | 3300005459 | Ga0068867_100043863 | Ga0068867_1000438632 | 375 |
| 462 | 3300005467 | Ga0070706_100000452 | Ga0070706_10000045243 | 375 |
| 463 | 3300005467 | Ga0070706_100018984 | Ga0070706_1000189842 | 375 |
| 464 | 3300005467 | Ga0070706_100105202 | Ga0070706_1001052022 | 375 |
| 465 | 3300005467 | Ga0070706_100220497 | Ga0070706_1002204971 | 375 |
| 466 | 3300005468 | Ga0070707_100022551 | Ga0070707_1000225512 | 375 |
| 467 | 3300005471 | Ga0070698_100005974 | Ga0070698_1000059747 | 375 |
| 468 | 3300005471 | Ga0070698_100023131 | Ga0070698_1000231312 | 375 |
| 469 | 3300005471 | Ga0070698_100190033 | Ga0070698_1001900332 | 375 |
| 470 | 3300005518 | Ga0070699_100024926 | Ga0070699_1000249263 | 375 |
| 471 | 3300005518 | Ga0070699_100030707 | Ga0070699_1000307073 | 375 |
| 472 | 3300005518 | Ga0070699_100030796 | Ga0070699_1000307962 | 375 |
| 473 | 3300005536 | Ga0070697_100000043 | Ga0070697_10000004322 | 375 |
| 474 | 3300005536 | Ga0070697_100000192 | Ga0070697_10000019234 | 375 |
| 475 | 3300005536 | Ga0070697_100142231 | Ga0070697_1001422312 | 375 |
| 476 | 3300005545 | Ga0070695_100033173 | Ga0070695_1000331732 | 375 |
| 477 | 3300005545 | Ga0070695_100044926 | Ga0070695_1000449263 | 375 |
| 478 | 3300005545 | Ga0070695_100188288 | Ga0070695_1001882881 | 375 |
| 479 | 3300005549 | Ga0070704_100075893 | Ga0070704_1000758932 | 375 |
| 480 | 3300005549 | Ga0070704_100090011 | Ga0070704_1000900112 | 375 |
| 481 | 3300005549 | Ga0070704_100102047 | Ga0070704_1001020473 | 375 |
| 482 | 3300005549 | Ga0070704_100284630 | Ga0070704_1002846301 | 375 |
| 483 | 3300005577 | Ga0068857_100036084 | Ga0068857_1000360843 | 375 |
| 484 | 3300005615 | Ga0070702_100003620 | Ga0070702_1000036205 | 375 |
| 485 | 3300005617 | Ga0068859_100035655 | Ga0068859_1000356554 | 375 |
| 486 | 3300005718 | Ga0068866_10010160 | Ga0068866_100101602 | 375 |
| 487 | 3300005719 | Ga0068861_100025052 | Ga0068861_1000250524 | 375 |
| 488 | 3300005834 | Ga0068851_10004072 | Ga0068851_100040722 | 375 |
| 489 | 3300005841 | Ga0068863_100018832 | Ga0068863_1000188322 | 375 |
| 490 | 3300005841 | Ga0068863_100070073 | Ga0068863_1000700732 | 375 |
| 491 | 3300005842 | Ga0068858_100059441 | Ga0068858_1000594412 | 375 |
| 492 | 3300005985 | Ga0081539_10000043 | Ga0081539_10000043228 | 375 |
| 493 | 3300005985 | Ga0081539_10007178 | Ga0081539_100071782 | 375 |
| 494 | 3300006173 | Ga0070716_100129216 | Ga0070716_1001292162 | 375 |
| 495 | 3300006237 | Ga0097621_100019452 | Ga0097621_1000194522 | 375 |
| 496 | 3300006358 | Ga0068871_100006192 | Ga0068871_1000061926 | 375 |
| 497 | 3300006847 | Ga0075431_100193511 | Ga0075431_1001935112 | 375 |
| 498 | 3300006852 | Ga0075433_10003126 | Ga0075433_100031263 | 375 |
| 499 | 3300006931 | Ga0097620_100035656 | Ga0097620_1000356564 | 375 |
| 500 | 3300009098 | Ga0105245_10084873 | Ga0105245_100848732 | 375 |
| 501 | 3300009101 | Ga0105247_10030428 | Ga0105247_100304282 | 375 |
| 502 | 3300009148 | Ga0105243_10090367 | Ga0105243_100903671 | 375 |
| 503 | 3300009553 | Ga0105249_10074532 | Ga0105249_100745323 | 375 |
| 504 | 3300009553 | Ga0105249_10242198 | Ga0105249_102421982 | 375 |
| 505 | 3300010375 | Ga0105239_10063569 | Ga0105239_100635692 | 375 |
| 506 | 3300013100 | Ga0157373_10078890 | Ga0157373_100788902 | 375 |
| 507 | 3300013296 | Ga0157374_10031059 | Ga0157374_100310592 | 375 |
| 508 | 3300013306 | Ga0163162_10071436 | Ga0163162_100714362 | 375 |
| 509 | 3300014325 | Ga0163163_10005524 | Ga0163163_100055246 | 375 |
| 510 | 3300025321 | Ga0207656_10002158 | Ga0207656_100021582 | 375 |
| 511 | 3300025885 | Ga0207653_10001251 | Ga0207653_100012512 | 375 |
| 512 | 3300025903 | Ga0207680_10041666 | Ga0207680_100416663 | 375 |
| 513 | 3300025908 | Ga0207643_10001447 | Ga0207643_1000144710 | 375 |
| 514 | 3300025908 | Ga0207643_10061646 | Ga0207643_100616462 | 375 |
| 515 | 3300025910 | Ga0207684_10000216 | Ga0207684_1000021640 | 375 |
| 516 | 3300025910 | Ga0207684_10022730 | Ga0207684_100227303 | 375 |
| 517 | 3300025914 | Ga0207671_10005190 | Ga0207671_100051902 | 375 |
| 518 | 3300025918 | Ga0207662_10002321 | Ga0207662_100023216 | 375 |
| 519 | 3300025918 | Ga0207662_10017817 | Ga0207662_100178172 | 375 |
| 520 | 3300025918 | Ga0207662_10067195 | Ga0207662_100671952 | 375 |
| 521 | 3300025925 | Ga0207650_10191154 | Ga0207650_101911542 | 375 |
| 522 | 3300025927 | Ga0207687_10059404 | Ga0207687_100594042 | 375 |
| 523 | 3300025931 | Ga0207644_10141482 | Ga0207644_101414822 | 375 |
| 524 | 3300025933 | Ga0207706_10020273 | Ga0207706_100202732 | 375 |
| 525 | 3300025935 | Ga0207709_10068805 | Ga0207709_100688051 | 375 |
| 526 | 3300025936 | Ga0207670_10005206 | Ga0207670_100052065 | 375 |
| 527 | 3300025936 | Ga0207670_10028244 | Ga0207670_100282444 | 375 |
| 528 | 3300025937 | Ga0207669_10147436 | Ga0207669_101474362 | 375 |
| 529 | 3300025939 | Ga0207665_10155987 | Ga0207665_101559872 | 375 |
| 530 | 3300025940 | Ga0207691_10001277 | Ga0207691_100012772 | 375 |
| 531 | 3300025941 | Ga0207711_10024304 | Ga0207711_100243042 | 375 |
| 532 | 3300025942 | Ga0207689_10003167 | Ga0207689_100031676 | 375 |
| 533 | 3300025942 | Ga0207689_10006129 | Ga0207689_100061296 | 375 |
| 534 | 3300025960 | Ga0207651_10025235 | Ga0207651_100252352 | 375 |
| 535 | 3300025960 | Ga0207651_10144317 | Ga0207651_101443172 | 375 |
| 536 | 3300025961 | Ga0207712_10326679 | Ga0207712_103266792 | 375 |
| 537 | 3300026035 | Ga0207703_10118070 | Ga0207703_101180701 | 375 |
| 538 | 3300026035 | Ga0207703_10135098 | Ga0207703_101350982 | 375 |
| 539 | 3300026035 | Ga0207703_10143076 | Ga0207703_101430762 | 375 |
| 540 | 3300026075 | Ga0207708_10018867 | Ga0207708_100188673 | 375 |
| 541 | 3300026075 | Ga0207708_10044449 | Ga0207708_100444492 | 375 |
| 542 | 3300026075 | Ga0207708_10119787 | Ga0207708_101197872 | 375 |
| 543 | 3300026088 | Ga0207641_10112100 | Ga0207641_101121002 | 375 |
| 544 | 3300026088 | Ga0207641_10117660 | Ga0207641_101176602 | 375 |
| 545 | 3300026089 | Ga0207648_10010987 | Ga0207648_100109873 | 375 |
| 546 | 3300026089 | Ga0207648_10014814 | Ga0207648_100148143 | 375 |
| 547 | 3300026095 | Ga0207676_10002012 | Ga0207676_100020122 | 375 |
| 548 | 3300026118 | Ga0207675_100004638 | Ga0207675_1000046387 | 375 |
| 549 | 3300026142 | Ga0207698_10119294 | Ga0207698_101192942 | 375 |
| 550 | 3300027907 | Ga0207428_10186881 | Ga0207428_101868812 | 375 |
| 551 | 3300032126 | Ga0307415_100112508 | Ga0307415_1001125082 | 375 |
| 552 | 3300038443 | Ga0395901_0133428 | Ga0395901_0133428_391_1536 | 375 |
| 553 | 3300046539 | Ga0495621_0023003 | Ga0495621_0023003_80_1225 | 375 |
| 554 | 3300050507 | nmdc:mga05p37_27645_c1 | nmdc:mga05p37_27645_c1_3684_4997 | 375 |
| 555 | 3300050510 | nmdc:mga06r32_142184_c1 | nmdc:mga06r32_142184_c1_807_2000 | 375 |
| 556 | 3300050511 | nmdc:mga08y16_375066_c1 | nmdc:mga08y16_375066_c1_187_1347 | 375 |
| 557 | 3300050515 | nmdc:mga0a205_15001_c1 | nmdc:mga0a205_15001_c1_23_1294 | 375 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7s8w-assembly1.cif.gz_A | amycolatopsis sp. t-1-60 n-succinylamino acid racemase/o-succinylbenzoate synthase r266q mutant in complex with n-succinylphenylglycine | 0.9619 | 10 | 375 |
| 4a6g-assembly1.cif.gz_A | n-acyl amino acid racemase from amycalotopsis sp. ts-1-60: g291d- f323y mutant in complex with n-acetyl methionine | 0.9609 | 10 | 374 |
| 1sja-assembly1.cif.gz_A | x-ray structure of o-succinylbenzoate synthase complexed with n-acetylmethionine | 0.9603 | 10 | 373 |
| 5fjp-assembly2.cif.gz_A | n-acyl amino acid racemase from amycolatopsis sp ts-1-60: g291d f323y i293g mutant in complex with n-acetyl naphthylalanine | 0.9601 | 10 | 374 |
| 2ggg-assembly1.cif.gz_C | the mutant a68c-d72c of deinococcus radiodurans n-acylamino acid racemase | 0.96 | 9 | 373 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wufA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9533 | 128 | 368 | 3.20.20.120 |
| 1r0mA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9514 | 127 | 356 | 3.20.20.120 |
| 1r0mA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9435 | 127 | 356 | 3.20.20.120 |
| 1wufA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9382 | 128 | 368 | 3.20.20.120 |
| 1sjaA01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9331 | 10 | 125 | 3.30.390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353CEB5-F1-model_v4 | o-succinylbenzoate synthase (EC 4.2.1.113) | 0.9786 | 127 | 375 |
GO:0009234
GO:0016836 |
| AF-A0A1B6BFA4-F1-model_v4 | O-succinylbenzoate synthase (EC 4.2.1.113) | 0.9785 | 187 | 301 |
GO:0043748
GO:0046872 |
| AF-A0A7C4KWW6-F1-model_v4 | o-succinylbenzoate synthase (EC 4.2.1.113) | 0.9784 | 10 | 374 |
GO:0009063
GO:0009234 GO:0043748 |
| AF-A0A4R6JAA8-F1-model_v4 | o-succinylbenzoate synthase (EC 4.2.1.113) | 0.9759 | 10 | 374 |
GO:0009234
GO:0043748 |
| AF-A0A523CYA9-F1-model_v4 | o-succinylbenzoate synthase (EC 4.2.1.113) | 0.9757 | 10 | 313 |
GO:0009063
GO:0009234 GO:0043748 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar