F463302

General Info

Members Datasets Scaffolds Average Seq Length
557 228 557 372

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100193511|Ga0075431_1001935112
Length 424
Sequence VQPLCSLCLCGEEIHGTTTTETQRTQRLYREELKLGHYTLEGSLNTTSFAVHESIGVKRIVLHRVRVPFLEPFRISNGVVAEKDAILIEITTDQGIVGWGEASPMSGSFYSADTPDSSWTVLKDEMVPALLSLRRVDGDEVHEFLRQQPGDAFSRAGIEGALWDAYANARGIALCELFGIEWRAVPSGVAIGIFETTDELIERVRRYVGEGYQRVKIKIQPGWDLEPVEFVRKQFPHLRLMVDANAAYTLRDLQVFRELDQFELMMIEQPLAASAIEEAGELQAQLKTPLCADESAESLASLEQIINNAAARIINIKVQRVGGLSAALVMLERTRSAGLQCWVGTMPELGIASAQGLHLAMHSGFSFPTDIEASSRWYVDDLVEPPLRIDEAGFIQVPRALGTGFKVVREKIDRYTTAVESFCL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
218 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.9
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10025006 3300003203 Bacteria 2327
2 Ga0065704_10168727 3300005289 Bacteria 1305
3 Ga0065704_10179851 3300005289 Bacteria 1243
4 Ga0065712_10000115 3300005290 Bacteria 144502
5 Ga0065712_10071107 3300005290 Bacteria 5480
6 Ga0065715_10003032 3300005293 Bacteria 5905
7 Ga0065715_10003978 3300005293 Unclassified 4025
8 Ga0065715_10090451 3300005293 Bacteria 6980
9 Ga0065715_10160211 3300005293 Bacteria 1637
10 Ga0065707_10009392 3300005295 Bacteria 2395
11 Ga0070658_10021836 3300005327 Bacteria 5131
12 Ga0070658_10041318 3300005327 Bacteria 3720
13 Ga0070658_10082218 3300005327 Bacteria 2646
14 Ga0070658_10328549 3300005327 Bacteria 1306
15 Ga0070683_100000021 3300005329 Bacteria 183486
16 Ga0070690_100004947 3300005330 Bacteria 7451
17 Ga0070690_100139041 3300005330 Bacteria 1647
18 Ga0070670_100011220 3300005331 Bacteria 7659
19 Ga0070670_100044693 3300005331 Bacteria 3808
20 Ga0068869_100012781 3300005334 Bacteria 5554
21 Ga0068869_100042160 3300005334 Unclassified 3271
22 Ga0068869_100059823 3300005334 Bacteria 2790
23 Ga0068869_100186165 3300005334 Unclassified 1630
24 Ga0070666_10015597 3300005335 Bacteria 4849
25 Ga0070680_100002897 3300005336 Bacteria 12745
26 Ga0070680_100117884 3300005336 Bacteria 2214
27 Ga0070682_100005421 3300005337 Bacteria 7105
28 Ga0070682_100021210 3300005337 Unclassified 3830
29 Ga0068868_100014431 3300005338 Bacteria 5822
30 Ga0068868_100015298 3300005338 Bacteria 5672
31 Ga0068868_100140825 3300005338 Bacteria 1980
32 Ga0070660_100050185 3300005339 Unclassified 3210
33 Ga0070689_100131574 3300005340 Bacteria 2006
34 Ga0070687_100009738 3300005343 Bacteria 4130
35 Ga0070687_100063379 3300005343 Unclassified 1960
36 Ga0070687_100088464 3300005343 Bacteria 1708
37 Ga0070669_100129740 3300005353 Bacteria 1932
38 Ga0070669_100170916 3300005353 Bacteria 1694
39 Ga0070675_100306827 3300005354 Bacteria 1399
40 Ga0070671_100043941 3300005355 Bacteria 3713
41 Ga0070673_100016117 3300005364 Bacteria 5274
42 Ga0070688_100016374 3300005365 Bacteria 4238
43 Ga0070659_100003961 3300005366 Bacteria 10538
44 Ga0070659_100077650 3300005366 Bacteria 2649
45 Ga0070659_100147990 3300005366 Unclassified 1914
46 Ga0070667_100027179 3300005367 Bacteria 4761
47 Ga0070711_100000931 3300005439 Bacteria 15461
48 Ga0070711_100077664 3300005439 Bacteria 2357
49 Ga0070705_100024816 3300005440 Bacteria 3241
50 Ga0070705_100033954 3300005440 Unclassified 2848
51 Ga0070705_100182722 3300005440 Unclassified 1422
52 Ga0070700_100039598 3300005441 Bacteria 2880
53 Ga0070700_100081886 3300005441 Bacteria 2086
54 Ga0070700_100086660 3300005441 Bacteria 2034
55 Ga0070694_100023010 3300005444 Bacteria 4001
56 Ga0070694_100036812 3300005444 Bacteria 3243
57 Ga0070694_100056906 3300005444 Unclassified 2657
58 Ga0070694_100170670 3300005444 Unclassified 1602
59 Ga0070708_100001518 3300005445 Bacteria 17724
60 Ga0070663_100175768 3300005455 Bacteria 1658
61 Ga0070681_10002826 3300005458 Bacteria 16033
62 Ga0070681_10011692 3300005458 Bacteria 8695
63 Ga0070681_10032432 3300005458 Bacteria 5242
64 Ga0070681_10035292 3300005458 Bacteria 5024
65 Ga0070681_10037049 3300005458 Bacteria 4895
66 Ga0068867_100039914 3300005459 Bacteria 3423
67 Ga0068867_100043863 3300005459 Bacteria 3275
68 Ga0070706_100000452 3300005467 Bacteria 49138
69 Ga0070706_100018984 3300005467 Bacteria 6342
70 Ga0070706_100020539 3300005467 Bacteria 6086
71 Ga0070706_100105202 3300005467 Bacteria 2626
72 Ga0070706_100193560 3300005467 Bacteria 1900
73 Ga0070706_100220497 3300005467 Bacteria 1770
74 Ga0070707_100001233 3300005468 Bacteria 25094
75 Ga0070707_100022551 3300005468 Bacteria 5953
76 Ga0070707_100038528 3300005468 Bacteria 4566
77 Ga0070707_100098794 3300005468 Bacteria 2827
78 Ga0070698_100005974 3300005471 Bacteria 13272
79 Ga0070698_100012714 3300005471 Bacteria 8913
80 Ga0070698_100023131 3300005471 Bacteria 6498
81 Ga0070698_100190033 3300005471 Unclassified 1991
82 Ga0070699_100016094 3300005518 Bacteria 6420
83 Ga0070699_100024926 3300005518 Bacteria 5157
84 Ga0070699_100030707 3300005518 Unclassified 4640
85 Ga0070699_100030796 3300005518 Bacteria 4632
86 Ga0070679_100000024 3300005530 Bacteria 121394
87 Ga0070679_100009548 3300005530 Bacteria 9177
88 Ga0070679_100022298 3300005530 Bacteria 6188
89 Ga0070679_100043317 3300005530 Bacteria 4483
90 Ga0070679_100126980 3300005530 Bacteria 2532
91 Ga0070679_100145094 3300005530 Bacteria 2351
92 Ga0070684_100000010 3300005535 Bacteria 183486
93 Ga0070684_100047549 3300005535 Bacteria 3718
94 Ga0070697_100000043 3300005536 Bacteria 93782
95 Ga0070697_100000192 3300005536 Bacteria 49825
96 Ga0070697_100000695 3300005536 Bacteria 25189
97 Ga0070697_100127036 3300005536 Bacteria 2136
98 Ga0070697_100142231 3300005536 Unclassified 2018
99 Ga0068853_100006614 3300005539 Bacteria 9229
100 Ga0070686_100014687 3300005544 Unclassified 4519
101 Ga0070695_100033173 3300005545 Bacteria 3230
102 Ga0070695_100044926 3300005545 Bacteria 2814
103 Ga0070695_100188288 3300005545 Bacteria 1467
104 Ga0070696_100044752 3300005546 Bacteria 3065
105 Ga0070693_100121652 3300005547 Bacteria 1620
106 Ga0070665_100130282 3300005548 Bacteria 2517
107 Ga0070665_100211319 3300005548 Bacteria 1941
108 Ga0070704_100075893 3300005549 Bacteria 2457
109 Ga0070704_100090011 3300005549 Bacteria 2284
110 Ga0070704_100102047 3300005549 Bacteria 2164
111 Ga0070704_100145136 3300005549 Unclassified 1858
112 Ga0070704_100284630 3300005549 Bacteria 1371
113 Ga0068855_100006381 3300005563 Bacteria 14369
114 Ga0068855_100008615 3300005563 Bacteria 12324
115 Ga0068855_100052768 3300005563 Bacteria 4786
116 Ga0068855_100395738 3300005563 Bacteria 1515
117 Ga0070664_100231112 3300005564 Unclassified 1658
118 Ga0068857_100004403 3300005577 Bacteria 11905
119 Ga0068857_100009275 3300005577 Bacteria 8537
120 Ga0068857_100036084 3300005577 Bacteria 4380
121 Ga0068854_100049090 3300005578 Bacteria 3013
122 Ga0068856_100031235 3300005614 Bacteria 5211
123 Ga0068856_100036669 3300005614 Bacteria 4808
124 Ga0068856_100100190 3300005614 Bacteria 2889
125 Ga0068856_100100440 3300005614 Bacteria 2885
126 Ga0070702_100003620 3300005615 Bacteria 6948
127 Ga0070702_100117331 3300005615 Bacteria 1660
128 Ga0068852_100086989 3300005616 Bacteria 2787
129 Ga0068852_100117669 3300005616 Bacteria 2427
130 Ga0068852_100138198 3300005616 Bacteria 2252
131 Ga0068859_100005492 3300005617 Bacteria 12908
132 Ga0068859_100028044 3300005617 Bacteria 5647
133 Ga0068859_100035655 3300005617 Bacteria 4991
134 Ga0068859_100043442 3300005617 Bacteria 4516
135 Ga0068859_100094508 3300005617 Bacteria 3042
136 Ga0068859_100108160 3300005617 Unclassified 2842
137 Ga0068859_100191234 3300005617 Bacteria 2131
138 Ga0068859_100192611 3300005617 Bacteria 2123
139 Ga0068859_100200060 3300005617 Bacteria 2082
140 Ga0068864_100020345 3300005618 Bacteria 5552
141 Ga0068864_100132563 3300005618 Unclassified 2240
142 Ga0068864_100171461 3300005618 Bacteria 1978
143 Ga0068866_10010160 3300005718 Bacteria 4025
144 Ga0068861_100025052 3300005719 Bacteria 4321
145 Ga0068861_100061865 3300005719 Bacteria 2874
146 Ga0068851_10004072 3300005834 Bacteria 6564
147 Ga0068863_100018832 3300005841 Bacteria 6606
148 Ga0068863_100070073 3300005841 Bacteria 3316
149 Ga0068863_100124970 3300005841 Unclassified 2454
150 Ga0068863_100192914 3300005841 Bacteria 1958
151 Ga0068863_100342164 3300005841 Bacteria 1455
152 Ga0068858_100007926 3300005842 Bacteria 10236
153 Ga0068858_100036407 3300005842 Bacteria 4563
154 Ga0068858_100040084 3300005842 Unclassified 4343
155 Ga0068858_100059441 3300005842 Bacteria 3533
156 Ga0068858_100112772 3300005842 Bacteria 2539
157 Ga0068860_100007661 3300005843 Bacteria 10800
158 Ga0068860_100009604 3300005843 Bacteria 9613
159 Ga0068862_100075458 3300005844 Bacteria 2916
160 Ga0081539_10000043 3300005985 Bacteria 288108
161 Ga0081539_10007178 3300005985 Bacteria 10269
162 Ga0081539_10042197 3300005985 Unclassified 2659
163 Ga0070715_10021916 3300006163 Bacteria 2484
164 Ga0070716_100009299 3300006173 Bacteria 4898
165 Ga0070716_100129216 3300006173 Unclassified 1594
166 Ga0070712_100000445 3300006175 Bacteria 23661
167 Ga0097621_100003224 3300006237 Bacteria 11213
168 Ga0097621_100005607 3300006237 Bacteria 8852
169 Ga0097621_100010726 3300006237 Bacteria 6718
170 Ga0097621_100019452 3300006237 Bacteria 5211
171 Ga0097621_100227181 3300006237 Bacteria 1629
172 Ga0068871_100006192 3300006358 Bacteria 8436
173 Ga0068871_100007548 3300006358 Bacteria 7779
174 Ga0068871_100016723 3300006358 Bacteria 5534
175 Ga0068871_100193739 3300006358 Bacteria 1752
176 Ga0075428_100047888 3300006844 Unclassified 4694
177 Ga0075428_100311227 3300006844 Bacteria 1693
178 Ga0075431_100062459 3300006847 Bacteria 3844
179 Ga0075431_100193511 3300006847 Bacteria 2083
180 Ga0075433_10003126 3300006852 Bacteria 12751
181 Ga0075433_10022329 3300006852 Bacteria 5311
182 Ga0075433_10027374 3300006852 Bacteria 4835
183 Ga0075433_10097983 3300006852 Bacteria 2595
184 Ga0075433_10174817 3300006852 Bacteria 1911
185 Ga0075434_100176517 3300006871 Bacteria 2156
186 Ga0075429_100147437 3300006880 Bacteria 2060
187 Ga0075436_100033523 3300006914 Bacteria 3540
188 Ga0075436_100049077 3300006914 Bacteria 2912
189 Ga0097620_100005491 3300006931 Bacteria 12908
190 Ga0097620_100028044 3300006931 Bacteria 5647
191 Ga0097620_100035656 3300006931 Bacteria 4991
192 Ga0097620_100043449 3300006931 Bacteria 4516
193 Ga0097620_100094506 3300006931 Bacteria 3042
194 Ga0097620_100108153 3300006931 Unclassified 2842
195 Ga0097620_100191248 3300006931 Bacteria 2131
196 Ga0097620_100192607 3300006931 Bacteria 2123
197 Ga0097620_100200057 3300006931 Bacteria 2082
198 Ga0075435_100130005 3300007076 Bacteria 2107
199 Ga0105240_10001081 3300009093 Bacteria 48105
200 Ga0105240_10001462 3300009093 Bacteria 40375
201 Ga0105240_10024119 3300009093 Bacteria 8029
202 Ga0105240_10190007 3300009093 Bacteria 2416
203 Ga0111539_10134232 3300009094 Bacteria 2898
204 Ga0111539_10199108 3300009094 Bacteria 2336
205 Ga0105245_10002961 3300009098 Bacteria 15229
206 Ga0105245_10003583 3300009098 Bacteria 13862
207 Ga0105245_10013874 3300009098 Bacteria 7020
208 Ga0105245_10084873 3300009098 Bacteria 2902
209 Ga0105247_10030428 3300009101 Bacteria 3273
210 Ga0105247_10101265 3300009101 Bacteria 1842
211 Ga0114129_10036974 3300009147 Bacteria 6894
212 Ga0114129_10074352 3300009147 Unclassified 4733
213 Ga0114129_10094958 3300009147 Unclassified 4130
214 Ga0114129_10252698 3300009147 Bacteria 2366
215 Ga0114129_10523764 3300009147 Bacteria 1545
216 Ga0105243_10048803 3300009148 Bacteria 3338
217 Ga0105243_10090367 3300009148 Bacteria 2520
218 Ga0105243_10138871 3300009148 Unclassified 2071
219 Ga0105243_10206935 3300009148 Bacteria 1725
220 Ga0105241_10021842 3300009174 Bacteria 4737
221 Ga0105241_10023577 3300009174 Bacteria 4564
222 Ga0105241_10059875 3300009174 Bacteria 2929
223 Ga0105241_10157623 3300009174 Bacteria 1863
224 Ga0105241_10160393 3300009174 Bacteria 1848
225 Ga0105241_10265771 3300009174 Bacteria 1459
226 Ga0105242_10029701 3300009176 Bacteria 4360
227 Ga0105242_10110566 3300009176 Bacteria 2341
228 Ga0105242_10132819 3300009176 Bacteria 2151
229 Ga0105248_10007065 3300009177 Bacteria 12300
230 Ga0105248_10008484 3300009177 Bacteria 11279
231 Ga0105248_10021339 3300009177 Bacteria 7177
232 Ga0105248_10025877 3300009177 Bacteria 6527
233 Ga0105248_10041537 3300009177 Bacteria 5156
234 Ga0105248_10041604 3300009177 Bacteria 5152
235 Ga0105248_10224934 3300009177 Bacteria 2112
236 Ga0105237_10000506 3300009545 Bacteria 55083
237 Ga0105237_10027216 3300009545 Bacteria 5838
238 Ga0105237_10103450 3300009545 Unclassified 2840
239 Ga0105237_10162831 3300009545 Bacteria 2229
240 Ga0105238_10026874 3300009551 Bacteria 5866
241 Ga0105238_10068045 3300009551 Bacteria 3562
242 Ga0105238_10122670 3300009551 Bacteria 2578
243 Ga0105238_10226562 3300009551 Bacteria 1846
244 Ga0105238_10263773 3300009551 Bacteria 1702
245 Ga0105249_10054535 3300009553 Bacteria 3656
246 Ga0105249_10074532 3300009553 Bacteria 3141
247 Ga0105249_10242198 3300009553 Bacteria 1784
248 Ga0105249_10693125 3300009553 Unclassified 1078
249 Ga0105239_10026006 3300010375 Bacteria 6444
250 Ga0105239_10063569 3300010375 Bacteria 4053
251 Ga0105239_10146160 3300010375 Bacteria 2637
252 Ga0105239_10172080 3300010375 Bacteria 2422
253 Ga0105239_10225435 3300010375 Bacteria 2102
254 Ga0105239_10668913 3300010375 Bacteria 1186
255 Ga0105246_10226480 3300011119 Bacteria 1469
256 Ga0157373_10002359 3300013100 Bacteria 14329
257 Ga0157373_10009713 3300013100 Bacteria 7101
258 Ga0157373_10078890 3300013100 Bacteria 2322
259 Ga0157370_10002433 3300013104 Bacteria 22448
260 Ga0157370_10002565 3300013104 Bacteria 21805
261 Ga0157370_10014337 3300013104 Bacteria 8110
262 Ga0157370_10184820 3300013104 Bacteria 1936
263 Ga0157370_10242189 3300013104 Bacteria 1669
264 Ga0157370_10249625 3300013104 Bacteria 1641
265 Ga0157369_10163100 3300013105 Bacteria 2352
266 Ga0157369_10203438 3300013105 Bacteria 2078
267 Ga0157374_10004841 3300013296 Bacteria 11302
268 Ga0157374_10031059 3300013296 Bacteria 4851
269 Ga0157374_10331326 3300013296 Unclassified 1510
270 Ga0157378_10002212 3300013297 Bacteria 17253
271 Ga0157378_10005454 3300013297 Bacteria 11140
272 Ga0157378_10007890 3300013297 Bacteria 9292
273 Ga0157378_10115071 3300013297 Bacteria 2471
274 Ga0163162_10005567 3300013306 Bacteria 12188
275 Ga0163162_10009410 3300013306 Bacteria 9504
276 Ga0163162_10025973 3300013306 Bacteria 5788
277 Ga0163162_10033314 3300013306 Bacteria 5119
278 Ga0163162_10035653 3300013306 Bacteria 4956
279 Ga0163162_10061562 3300013306 Unclassified 3791
280 Ga0163162_10071436 3300013306 Unclassified 3524
281 Ga0163162_10144071 3300013306 Bacteria 2497
282 Ga0163162_10186559 3300013306 Bacteria 2201
283 Ga0157372_10122165 3300013307 Bacteria 2992
284 Ga0157372_10359528 3300013307 Bacteria 1696
285 Ga0157375_10056314 3300013308 Bacteria 3881
286 Ga0157375_10125508 3300013308 Bacteria 2681
287 Ga0157375_10145427 3300013308 Bacteria 2501
288 Ga0157375_10483758 3300013308 Bacteria 1403
289 Ga0163163_10001650 3300014325 Bacteria 18789
290 Ga0163163_10002569 3300014325 Bacteria 15365
291 Ga0163163_10005524 3300014325 Bacteria 10945
292 Ga0163163_10006693 3300014325 Bacteria 10098
293 Ga0163163_10011781 3300014325 Bacteria 7949
294 Ga0163163_10025404 3300014325 Bacteria 5647
295 Ga0163163_10073106 3300014325 Bacteria 3419
296 Ga0163163_10084927 3300014325 Bacteria 3173
297 Ga0163163_10120077 3300014325 Bacteria 2662
298 Ga0163163_10233577 3300014325 Bacteria 1888
299 Ga0163163_10272026 3300014325 Bacteria 1745
300 Ga0157380_10011778 3300014326 Bacteria 6324
301 Ga0157377_10155057 3300014745 Bacteria 1419
302 Ga0157376_10001577 3300014969 Bacteria 15067
303 Ga0157376_10067761 3300014969 Bacteria 3019
304 Ga0157376_10081340 3300014969 Bacteria 2781
305 Ga0213872_10000182 3300021361 Bacteria 56427
306 Ga0213876_10000190 3300021384 Bacteria 64067
307 Ga0213876_10116309 3300021384 Bacteria 1419
308 Ga0213875_10000002 3300021388 Bacteria 921066
309 Ga0213875_10002433 3300021388 Bacteria 11139
310 Ga0213875_10028154 3300021388 Bacteria 2671
311 Ga0207656_10002158 3300025321 Bacteria 6573
312 Ga0207653_10001251 3300025885 Bacteria 8300
313 Ga0207642_10020481 3300025899 Bacteria 2583
314 Ga0207680_10007757 3300025903 Bacteria 5244
315 Ga0207680_10041666 3300025903 Bacteria 2681
316 Ga0207680_10089308 3300025903 Bacteria 1956
317 Ga0207643_10001447 3300025908 Bacteria 13632
318 Ga0207643_10014797 3300025908 Bacteria 4243
319 Ga0207643_10061646 3300025908 Bacteria 2142
320 Ga0207705_10039367 3300025909 Bacteria 3388
321 Ga0207684_10000216 3300025910 Bacteria 89242
322 Ga0207684_10008212 3300025910 Bacteria 9296
323 Ga0207684_10022730 3300025910 Bacteria 5354
324 Ga0207684_10234475 3300025910 Unclassified 1583
325 Ga0207707_10000188 3300025912 Bacteria 65222
326 Ga0207707_10023499 3300025912 Bacteria 5392
327 Ga0207707_10077565 3300025912 Bacteria 2900
328 Ga0207707_10081820 3300025912 Bacteria 2819
329 Ga0207707_10154111 3300025912 Bacteria 2009
330 Ga0207695_10000956 3300025913 Bacteria 51440
331 Ga0207695_10004456 3300025913 Bacteria 19085
332 Ga0207695_10006735 3300025913 Bacteria 14829
333 Ga0207695_10006834 3300025913 Bacteria 14691
334 Ga0207695_10090951 3300025913 Bacteria 3066
335 Ga0207695_10102144 3300025913 Bacteria 2861
336 Ga0207695_10161432 3300025913 Bacteria 2172
337 Ga0207695_10175099 3300025913 Unclassified 2068
338 Ga0207695_10352483 3300025913 Bacteria 1359
339 Ga0207671_10005190 3300025914 Bacteria 12106
340 Ga0207671_10043411 3300025914 Bacteria 3325
341 Ga0207671_10121391 3300025914 Bacteria 1997
342 Ga0207693_10000120 3300025915 Bacteria 69565
343 Ga0207663_10003410 3300025916 Bacteria 7773
344 Ga0207660_10000403 3300025917 Bacteria 28503
345 Ga0207662_10002321 3300025918 Bacteria 9530
346 Ga0207662_10017817 3300025918 Bacteria 4021
347 Ga0207662_10020960 3300025918 Bacteria 3731
348 Ga0207662_10067195 3300025918 Unclassified 2162
349 Ga0207657_10188374 3300025919 Bacteria 1666
350 Ga0207652_10001088 3300025921 Bacteria 24610
351 Ga0207652_10045909 3300025921 Bacteria 3726
352 Ga0207652_10176495 3300025921 Bacteria 1919
353 Ga0207646_10016348 3300025922 Bacteria 6963
354 Ga0207646_10069727 3300025922 Bacteria 3140
355 Ga0207694_10090693 3300025924 Bacteria 2411
356 Ga0207650_10191154 3300025925 Bacteria 1635
357 Ga0207687_10013347 3300025927 Bacteria 5363
358 Ga0207687_10016925 3300025927 Bacteria 4792
359 Ga0207687_10059404 3300025927 Bacteria 2694
360 Ga0207644_10000697 3300025931 Bacteria 21261
361 Ga0207644_10141482 3300025931 Bacteria 1853
362 Ga0207690_10118328 3300025932 Unclassified 1920
363 Ga0207706_10020273 3300025933 Bacteria 5976
364 Ga0207686_10026264 3300025934 Bacteria 3396
365 Ga0207709_10068805 3300025935 Bacteria 2239
366 Ga0207709_10083229 3300025935 Unclassified 2068
367 Ga0207670_10005206 3300025936 Bacteria 7113
368 Ga0207670_10028244 3300025936 Bacteria 3559
369 Ga0207669_10147436 3300025937 Bacteria 1643
370 Ga0207665_10000030 3300025939 Bacteria 94900
371 Ga0207665_10155987 3300025939 Unclassified 1638
372 Ga0207691_10001277 3300025940 Bacteria 25156
373 Ga0207711_10024304 3300025941 Bacteria 5074
374 Ga0207711_10035254 3300025941 Bacteria 4240
375 Ga0207711_10037421 3300025941 Bacteria 4121
376 Ga0207711_10037483 3300025941 Bacteria 4119
377 Ga0207711_10122997 3300025941 Bacteria 2318
378 Ga0207711_10159506 3300025941 Bacteria 2040
379 Ga0207711_10211963 3300025941 Unclassified 1769
380 Ga0207711_10254852 3300025941 Unclassified 1612
381 Ga0207689_10003167 3300025942 Bacteria 15083
382 Ga0207689_10005239 3300025942 Bacteria 11629
383 Ga0207689_10006129 3300025942 Bacteria 10639
384 Ga0207689_10023365 3300025942 Bacteria 5190
385 Ga0207689_10135479 3300025942 Bacteria 2028
386 Ga0207689_10157109 3300025942 Unclassified 1874
387 Ga0207661_10000012 3300025944 Bacteria 354345
388 Ga0207679_10148668 3300025945 Bacteria 1903
389 Ga0207667_10012848 3300025949 Bacteria 9622
390 Ga0207667_10023104 3300025949 Bacteria 6850
391 Ga0207667_10039208 3300025949 Bacteria 5051
392 Ga0207667_10211305 3300025949 Bacteria 1989
393 Ga0207667_10311084 3300025949 Bacteria 1609
394 Ga0207651_10025235 3300025960 Bacteria 3693
395 Ga0207651_10036023 3300025960 Bacteria 3225
396 Ga0207651_10144317 3300025960 Bacteria 1843
397 Ga0207712_10326679 3300025961 Bacteria 1268
398 Ga0207658_10037802 3300025986 Bacteria 3472
399 Ga0207677_10017181 3300026023 Bacteria 4306
400 Ga0207677_10113601 3300026023 Bacteria 2022
401 Ga0207703_10022493 3300026035 Bacteria 4946
402 Ga0207703_10067362 3300026035 Unclassified 2946
403 Ga0207703_10118070 3300026035 Bacteria 2273
404 Ga0207703_10135098 3300026035 Bacteria 2134
405 Ga0207703_10143076 3300026035 Bacteria 2077
406 Ga0207703_10330799 3300026035 Unclassified 1397
407 Ga0207639_10030418 3300026041 Bacteria 3959
408 Ga0207639_10127024 3300026041 Bacteria 2105
409 Ga0207678_10057538 3300026067 Bacteria 3346
410 Ga0207678_10131094 3300026067 Bacteria 2138
411 Ga0207708_10018867 3300026075 Bacteria 5195
412 Ga0207708_10044077 3300026075 Unclassified 3399
413 Ga0207708_10044449 3300026075 Bacteria 3384
414 Ga0207708_10119787 3300026075 Bacteria 2050
415 Ga0207702_10136543 3300026078 Bacteria 2213
416 Ga0207641_10112100 3300026088 Bacteria 2420
417 Ga0207641_10117660 3300026088 Bacteria 2366
418 Ga0207641_10173256 3300026088 Unclassified 1971
419 Ga0207648_10010987 3300026089 Bacteria 8552
420 Ga0207648_10012665 3300026089 Bacteria 7885
421 Ga0207648_10014814 3300026089 Bacteria 7194
422 Ga0207648_10097066 3300026089 Bacteria 2579
423 Ga0207648_10115874 3300026089 Bacteria 2355
424 Ga0207676_10002012 3300026095 Bacteria 14807
425 Ga0207676_10077850 3300026095 Bacteria 2684
426 Ga0207676_10108948 3300026095 Bacteria 2313
427 Ga0207674_10000258 3300026116 Bacteria 66186
428 Ga0207674_10013162 3300026116 Bacteria 9207
429 Ga0207674_10357554 3300026116 Unclassified 1412
430 Ga0207675_100004638 3300026118 Bacteria 13243
431 Ga0207675_100068758 3300026118 Unclassified 3310
432 Ga0207675_100088894 3300026118 Bacteria 2902
433 Ga0207698_10119294 3300026142 Bacteria 2229
434 Ga0209588_1000854 3300027671 Bacteria 7775
435 Ga0207428_10143737 3300027907 Bacteria 1819
436 Ga0207428_10186881 3300027907 Unclassified 1563
437 Ga0268266_10001048 3300028379 Bacteria 34678
438 Ga0268266_10049494 3300028379 Bacteria 3604
439 Ga0268265_10080851 3300028380 Bacteria 2564
440 Ga0268264_10011513 3300028381 Bacteria 7307
441 Ga0268264_10064123 3300028381 Bacteria 3091
442 Ga0268264_10115156 3300028381 Bacteria 2361
443 Ga0265323_10002725 3300028653 Bacteria 7964
444 Ga0265329_10023513 3300031242 Bacteria 2052
445 Ga0265316_10010253 3300031344 Bacteria 8551
446 Ga0265316_10012442 3300031344 Bacteria 7630
447 Ga0265316_10102988 3300031344 Bacteria 2168
448 Ga0265316_10107657 3300031344 Bacteria 2113
449 Ga0265316_10115600 3300031344 Bacteria 2028
450 Ga0307415_100112508 3300032126 Bacteria 2023
451 Ga0373954_0076447 3300035118 Bacteria 1596
452 Ga0373943_0019944 3300035170 Bacteria 3088
453 Ga0373935_0036866 3300035692 Bacteria 3059
454 Ga0373935_0056366 3300035692 Bacteria 2505
455 Ga0373927_0003141 3300035695 Bacteria 11935
456 Ga0373927_0044038 3300035695 Bacteria 2888
457 Ga0373947_0089555 3300035725 Bacteria 1917
458 Ga0373947_0134284 3300035725 Bacteria 1582
459 Ga0373937_0026652 3300036401 Bacteria 5222
460 Ga0373937_0140306 3300036401 Bacteria 2261
461 Ga0373937_0144233 3300036401 Bacteria 2228
462 Ga0373925_0015405 3300037068 Bacteria 5528
463 Ga0373925_0107697 3300037068 Bacteria 2150
464 Ga0373925_0324829 3300037068 Bacteria 1246
465 Ga0395900_0147356 3300037418 Bacteria 2407
466 Ga0395900_0240000 3300037418 Bacteria 1819
467 Ga0395898_0272982 3300037466 Bacteria 1613
468 Ga0436364_0478638 3300037853 Unclassified 3096
469 Ga0436364_0517360 3300037853 Bacteria 13526
470 Ga0436364_0919396 3300037853 Bacteria 13386
471 Ga0395901_0133428 3300038443 Bacteria 2610
472 Ga0242420_014565 3300038996 Bacteria 1351
473 Ga0436365_0001504 3300039437 Bacteria 2646
474 Ga0436365_0576586 3300039437 Bacteria 106320
475 Ga0436365_1492531 3300039437 Bacteria 5639
476 Ga0436365_1793553 3300039437 Bacteria 7084
477 Ga0436360_1323621 3300039438 Bacteria 1903
478 Ga0436361_0126076 3300039447 Bacteria 97470
479 Ga0436363_0737069 3300039450 Bacteria 2125
480 Ga0439448_0029165 3300042005 Bacteria 1746
481 Ga0439455_0043303 3300042012 Bacteria 1158
482 Ga0451577_0161665 3300042876 Bacteria 2017
483 Ga0466957_0263213 3300044842 Bacteria 1150
484 Ga0451576_0525896 3300045051 Unclassified 1243
485 Ga0466967_0112795 3300045976 Bacteria 2500
486 Ga0495592_0008047 3300046454 Bacteria 7918
487 Ga0495651_0019957 3300046462 Bacteria 5199
488 Ga0495651_0272397 3300046462 Bacteria 1147
489 Ga0495653_0046441 3300046463 Bacteria 3363
490 Ga0495639_0028109 3300046475 Bacteria 2492
491 Ga0495662_0058736 3300046476 Bacteria 1858
492 Ga0495664_0010701 3300046477 Bacteria 5153
493 Ga0495664_0113408 3300046477 Bacteria 1637
494 Ga0495594_0112244 3300046499 Bacteria 1537
495 Ga0495628_0033135 3300046516 Bacteria 4165
496 Ga0495652_0118298 3300046529 Bacteria 2118
497 Ga0495621_0023003 3300046539 Bacteria 2071
498 Ga0495634_0129413 3300046642 Bacteria 1610
499 Ga0495599_0146449 3300046678 Bacteria 1464
500 Ga0495623_0198969 3300046679 Bacteria 1153
501 Ga0495658_0166147 3300046683 Bacteria 1363
502 Ga0495613_0060230 3300046689 Bacteria 2781
503 Ga0495674_0013188 3300047319 Bacteria 7769
504 Ga0495674_0083076 3300047319 Bacteria 2746
505 Ga0495674_0114505 3300047319 Bacteria 2283
506 Ga0495674_0123573 3300047319 Bacteria 2185
507 Ga0495674_0153187 3300047319 Bacteria 1932
508 Ga0495680_0009823 3300047322 Bacteria 8580
509 Ga0495675_0036147 3300047444 Bacteria 3152
510 Ga0495675_0117237 3300047444 Bacteria 1660
511 Ga0495684_0025144 3300047471 Bacteria 4579
512 Ga0495602_0051524 3300048088 Bacteria 3665
513 Ga0495614_0010864 3300048089 Bacteria 4010
514 Ga0496108_0048914 3300048911 Bacteria 3536
515 Ga0496112_0128781 3300048915 Unclassified 2502
516 Ga0496112_0270713 3300048915 Bacteria 1647
517 Ga0496112_0381590 3300048915 Bacteria 1350
518 Ga0496115_0015570 3300048918 Bacteria 5772
519 Ga0501034_0009063 3300049571 Bacteria 10451
520 Ga0501037_0022707 3300049573 Bacteria 4639
521 Ga0501038_0179013 3300049574 Unclassified 1712
522 Ga0501043_0035939 3300049579 Bacteria 3897
523 Ga0501047_0004792 3300049581 Bacteria 12731
524 Ga0501070_0030266 3300049586 Bacteria 4536
525 Ga0501070_0035687 3300049586 Bacteria 4153
526 Ga0501073_0010061 3300049589 Bacteria 6955
527 Ga0501073_0094455 3300049589 Unclassified 2077
528 Ga0501249_002297 3300049679 Bacteria 3870
529 Ga0501268_009875 3300049765 Unclassified 1475
530 Ga0501035_0004621 3300049822 Bacteria 13052
531 Ga0501044_0001767 3300049823 Bacteria 25271
532 Ga0501044_0002962 3300049823 Bacteria 19309
533 nmdc:mga05p37_151371_c1 3300050507 Unclassified 2837
534 nmdc:mga05p37_17568_c1 3300050507 Bacteria 8636
535 nmdc:mga05p37_27645_c1 3300050507 Bacteria 6909
536 nmdc:mga05p37_370186_c1 3300050507 Bacteria 1682
537 nmdc:mga05p37_387094_c1 3300050507 Bacteria 1636
538 nmdc:mga05p37_524231_c1 3300050507 Bacteria 1354
539 nmdc:mga0qj67_21139_c1 3300050509 Bacteria 4990
540 nmdc:mga0qj67_84472_c1 3300050509 Bacteria 2546
541 nmdc:mga06r32_103117_c1 3300050510 Bacteria 2801
542 nmdc:mga06r32_142184_c1 3300050510 Bacteria 2376
543 nmdc:mga06r32_28441_c1 3300050510 Bacteria 5230
544 nmdc:mga08y16_1416_c1 3300050511 Bacteria 24064
545 nmdc:mga08y16_375066_c1 3300050511 Bacteria 1459
546 nmdc:mga08y16_94382_c1 3300050511 Unclassified 3116
547 nmdc:mga0n895_329363_c1 3300050512 Unclassified 1547
548 nmdc:mga0n895_456462_c1 3300050512 Bacteria 1290
549 nmdc:mga08x19_27360_c1 3300050514 Bacteria 3566
550 nmdc:mga0a205_10688_c1 3300050515 Bacteria 8438
551 nmdc:mga0a205_15001_c1 3300050515 Bacteria 7232
552 nmdc:mga0a205_286565_c1 3300050515 Bacteria 1522
553 nmdc:mga0a205_30300_c1 3300050515 Bacteria 5179
554 nmdc:mga0a205_38625_c1 3300050515 Unclassified 4593
555 nmdc:mga0a205_68959_c1 3300050515 Unclassified 3415
556 Ga0501082_0000143 3300060353 Bacteria 59481
557 Ga0501082_0164847 3300060353 Bacteria 1926

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0324829 Ga0373925_0324829_84_992 278
2 3300046679 Ga0495623_0198969 Ga0495623_0198969_220_1140 301
3 3300042012 Ga0439455_0043303 Ga0439455_0043303_142_1095 311
4 3300005439 Ga0070711_100000931 Ga0070711_1000009314 316
5 3300025931 Ga0207644_10000697 Ga0207644_1000069710 316
6 3300044842 Ga0466957_0263213 Ga0466957_0263213_160_1131 319
7 3300009553 Ga0105249_10693125 Ga0105249_106931251 330
8 3300050512 nmdc:mga0n895_329363_c1 nmdc:mga0n895_329363_c1_39_1145 341
9 3300005467 Ga0070706_100020539 Ga0070706_1000205393 342
10 3300005468 Ga0070707_100001233 Ga0070707_10000123314 342
11 3300005536 Ga0070697_100127036 Ga0070697_1001270362 342
12 3300025910 Ga0207684_10008212 Ga0207684_100082127 342
13 3300025922 Ga0207646_10016348 Ga0207646_100163487 342
14 3300005536 Ga0070697_100000695 Ga0070697_10000069512 343
15 3300006163 Ga0070715_10021916 Ga0070715_100219162 344
16 3300025910 Ga0207684_10234475 Ga0207684_102344751 344
17 3300046475 Ga0495639_0028109 Ga0495639_0028109_1247_2353 344
18 3300046499 Ga0495594_0112244 Ga0495594_0112244_308_1414 344
19 3300046683 Ga0495658_0166147 Ga0495658_0166147_71_1177 344
20 3300046689 Ga0495613_0060230 Ga0495613_0060230_1226_2332 344
21 3300047319 Ga0495674_0123573 Ga0495674_0123573_461_1567 344
22 3300048089 Ga0495614_0010864 Ga0495614_0010864_2202_3308 344
23 3300028379 Ga0268266_10001048 Ga0268266_1000104824 345
24 3300005334 Ga0068869_100186165 Ga0068869_1001861652 350
25 3300005985 Ga0081539_10042197 Ga0081539_100421972 350
26 3300006173 Ga0070716_100009299 Ga0070716_1000092992 350
27 3300025939 Ga0207665_10000030 Ga0207665_100000307 350
28 3300028653 Ga0265323_10002725 Ga0265323_100027254 350
29 3300006175 Ga0070712_100000445 Ga0070712_10000044514 351
30 3300009147 Ga0114129_10523764 Ga0114129_105237642 351
31 3300009148 Ga0105243_10048803 Ga0105243_100488031 351
32 3300009174 Ga0105241_10059875 Ga0105241_100598752 351
33 3300009177 Ga0105248_10025877 Ga0105248_100258775 351
34 3300013297 Ga0157378_10007890 Ga0157378_100078902 351
35 3300013306 Ga0163162_10186559 Ga0163162_101865592 351
36 3300014325 Ga0163163_10233577 Ga0163163_102335771 351
37 3300014969 Ga0157376_10001577 Ga0157376_100015776 351
38 3300025916 Ga0207663_10003410 Ga0207663_100034104 351
39 3300027671 Ga0209588_1000854 Ga0209588_10008542 352
40 3300049573 Ga0501037_0022707 Ga0501037_0022707_3317_4387 352
41 3300049574 Ga0501038_0179013 Ga0501038_0179013_497_1567 352
42 3300049579 Ga0501043_0035939 Ga0501043_0035939_1574_2644 352
43 3300049589 Ga0501073_0010061 Ga0501073_0010061_4046_5116 352
44 3300005614 Ga0068856_100036669 Ga0068856_1000366694 353
45 3300013104 Ga0157370_10014337 Ga0157370_100143373 353
46 3300013307 Ga0157372_10359528 Ga0157372_103595282 353
47 3300021388 Ga0213875_10000002 Ga0213875_10000002115 353
48 3300031344 Ga0265316_10010253 Ga0265316_100102535 353
49 3300037068 Ga0373925_0015405 Ga0373925_0015405_4429_5502 353
50 3300037853 Ga0436364_0919396 Ga0436364_0919396_3616_4689 353
51 3300042876 Ga0451577_0161665 Ga0451577_0161665_231_1304 353
52 3300049571 Ga0501034_0009063 Ga0501034_0009063_6584_7702 353
53 3300049581 Ga0501047_0004792 Ga0501047_0004792_6907_8025 353
54 3300049586 Ga0501070_0030266 Ga0501070_0030266_249_1367 353
55 3300049679 Ga0501249_002297 Ga0501249_002297_734_1810 353
56 3300049765 Ga0501268_009875 Ga0501268_009875_43_1119 353
57 3300049822 Ga0501035_0004621 Ga0501035_0004621_11313_12431 353
58 3300049823 Ga0501044_0001767 Ga0501044_0001767_10506_11579 353
59 3300050507 nmdc:mga05p37_387094_c1 nmdc:mga05p37_387094_c1_561_1622 353
60 3300005289 Ga0065704_10179851 Ga0065704_101798511 354
61 3300005330 Ga0070690_100004947 Ga0070690_1000049474 354
62 3300005544 Ga0070686_100014687 Ga0070686_1000146871 354
63 3300009094 Ga0111539_10134232 Ga0111539_101342322 354
64 3300050511 nmdc:mga08y16_1416_c1 nmdc:mga08y16_1416_c1_22873_23949 354
65 3300005337 Ga0070682_100021210 Ga0070682_1000212103 355
66 3300005440 Ga0070705_100033954 Ga0070705_1000339542 355
67 3300005842 Ga0068858_100040084 Ga0068858_1000400844 355
68 3300006237 Ga0097621_100003224 Ga0097621_1000032245 355
69 3300009147 Ga0114129_10074352 Ga0114129_100743523 355
70 3300009551 Ga0105238_10122670 Ga0105238_101226701 355
71 3300026035 Ga0207703_10067362 Ga0207703_100673623 355
72 3300026075 Ga0207708_10044077 Ga0207708_100440773 355
73 3300005444 Ga0070694_100023010 Ga0070694_1000230102 356
74 3300009174 Ga0105241_10160393 Ga0105241_101603932 356
75 3300009177 Ga0105248_10224934 Ga0105248_102249342 356
76 3300013308 Ga0157375_10145427 Ga0157375_101454271 356
77 3300014326 Ga0157380_10011778 Ga0157380_100117782 356
78 3300048915 Ga0496112_0270713 Ga0496112_0270713_31_1113 356
79 3300050515 nmdc:mga0a205_38625_c1 nmdc:mga0a205_38625_c1_1745_2827 356
80 3300046462 Ga0495651_0272397 Ga0495651_0272397_14_1132 358
81 3300048915 Ga0496112_0128781 Ga0496112_0128781_1308_2432 358
82 3300009176 Ga0105242_10029701 Ga0105242_100297012 359
83 3300009177 Ga0105248_10041604 Ga0105248_100416041 359
84 3300013296 Ga0157374_10331326 Ga0157374_103313262 359
85 3300013297 Ga0157378_10005454 Ga0157378_100054543 359
86 3300013306 Ga0163162_10005567 Ga0163162_100055674 359
87 3300014325 Ga0163163_10006693 Ga0163163_100066933 359
88 3300021361 Ga0213872_10000182 Ga0213872_1000018220 359
89 3300039447 Ga0436361_0126076 Ga0436361_0126076_29692_30807 359
90 3300005455 Ga0070663_100175768 Ga0070663_1001757682 360
91 3300005563 Ga0068855_100008615 Ga0068855_1000086159 360
92 3300006852 Ga0075433_10022329 Ga0075433_100223291 360
93 3300006880 Ga0075429_100147437 Ga0075429_1001474372 360
94 3300009147 Ga0114129_10094958 Ga0114129_100949584 360
95 3300025942 Ga0207689_10157109 Ga0207689_101571092 360
96 3300025949 Ga0207667_10012848 Ga0207667_100128489 360
97 3300026067 Ga0207678_10131094 Ga0207678_101310942 360
98 3300037418 Ga0395900_0147356 Ga0395900_0147356_500_1594 360
99 3300050507 nmdc:mga05p37_151371_c1 nmdc:mga05p37_151371_c1_897_1991 360
100 3300005616 Ga0068852_100086989 Ga0068852_1000869892 362
101 3300005618 Ga0068864_100132563 Ga0068864_1001325632 362
102 3300009093 Ga0105240_10190007 Ga0105240_101900072 362
103 3300009148 Ga0105243_10138871 Ga0105243_101388712 362
104 3300013104 Ga0157370_10249625 Ga0157370_102496252 362
105 3300025913 Ga0207695_10161432 Ga0207695_101614322 362
106 3300050515 nmdc:mga0a205_10688_c1 nmdc:mga0a205_10688_c1_4132_5238 364
107 3300005327 Ga0070658_10021836 Ga0070658_100218363 365
108 3300005327 Ga0070658_10041318 Ga0070658_100413182 365
109 3300005327 Ga0070658_10328549 Ga0070658_103285491 365
110 3300005329 Ga0070683_100000021 Ga0070683_10000002167 365
111 3300005336 Ga0070680_100117884 Ga0070680_1001178842 365
112 3300005364 Ga0070673_100016117 Ga0070673_1000161177 365
113 3300005439 Ga0070711_100077664 Ga0070711_1000776642 365
114 3300005458 Ga0070681_10032432 Ga0070681_100324325 365
115 3300005530 Ga0070679_100043317 Ga0070679_1000433173 365
116 3300005535 Ga0070684_100000010 Ga0070684_10000001096 365
117 3300005563 Ga0068855_100052768 Ga0068855_1000527683 365
118 3300005563 Ga0068855_100395738 Ga0068855_1003957382 365
119 3300005614 Ga0068856_100031235 Ga0068856_1000312353 365
120 3300005614 Ga0068856_100100190 Ga0068856_1001001903 365
121 3300005617 Ga0068859_100191234 Ga0068859_1001912343 365
122 3300005841 Ga0068863_100124970 Ga0068863_1001249703 365
123 3300006914 Ga0075436_100049077 Ga0075436_1000490772 365
124 3300006931 Ga0097620_100191248 Ga0097620_1001912483 365
125 3300009147 Ga0114129_10252698 Ga0114129_102526983 365
126 3300009545 Ga0105237_10103450 Ga0105237_101034502 365
127 3300009545 Ga0105237_10162831 Ga0105237_101628312 365
128 3300010375 Ga0105239_10225435 Ga0105239_102254353 365
129 3300013104 Ga0157370_10002433 Ga0157370_100024336 365
130 3300013104 Ga0157370_10184820 Ga0157370_101848202 365
131 3300013308 Ga0157375_10056314 Ga0157375_100563142 365
132 3300013308 Ga0157375_10483758 Ga0157375_104837581 365
133 3300014325 Ga0163163_10011781 Ga0163163_100117813 365
134 3300014325 Ga0163163_10120077 Ga0163163_101200773 365
135 3300014969 Ga0157376_10081340 Ga0157376_100813402 365
136 3300021384 Ga0213876_10116309 Ga0213876_101163092 365
137 3300021388 Ga0213875_10002433 Ga0213875_100024334 365
138 3300021388 Ga0213875_10028154 Ga0213875_100281542 365
139 3300025909 Ga0207705_10039367 Ga0207705_100393673 365
140 3300025912 Ga0207707_10081820 Ga0207707_100818203 365
141 3300025913 Ga0207695_10000956 Ga0207695_1000095616 365
142 3300025913 Ga0207695_10175099 Ga0207695_101750992 365
143 3300025915 Ga0207693_10000120 Ga0207693_1000012040 365
144 3300025921 Ga0207652_10045909 Ga0207652_100459093 365
145 3300025941 Ga0207711_10254852 Ga0207711_102548522 365
146 3300025944 Ga0207661_10000012 Ga0207661_10000012245 365
147 3300025949 Ga0207667_10039208 Ga0207667_100392085 365
148 3300025949 Ga0207667_10311084 Ga0207667_103110842 365
149 3300025960 Ga0207651_10036023 Ga0207651_100360234 365
150 3300026088 Ga0207641_10173256 Ga0207641_101732561 365
151 3300031242 Ga0265329_10023513 Ga0265329_100235132 365
152 3300031344 Ga0265316_10012442 Ga0265316_100124424 365
153 3300031344 Ga0265316_10102988 Ga0265316_101029882 365
154 3300031344 Ga0265316_10107657 Ga0265316_101076572 365
155 3300031344 Ga0265316_10115600 Ga0265316_101156002 365
156 3300035725 Ga0373947_0134284 Ga0373947_0134284_165_1274 365
157 3300036401 Ga0373937_0026652 Ga0373937_0026652_2647_3771 365
158 3300036401 Ga0373937_0140306 Ga0373937_0140306_878_1990 365
159 3300036401 Ga0373937_0144233 Ga0373937_0144233_402_1511 365
160 3300037853 Ga0436364_0517360 Ga0436364_0517360_9661_10773 365
161 3300039437 Ga0436365_1793553 Ga0436365_1793553_5228_6337 365
162 3300042005 Ga0439448_0029165 Ga0439448_0029165_266_1381 365
163 3300045976 Ga0466967_0112795 Ga0466967_0112795_134_1243 365
164 3300046454 Ga0495592_0008047 Ga0495592_0008047_1850_2962 365
165 3300046462 Ga0495651_0019957 Ga0495651_0019957_3997_5109 365
166 3300046463 Ga0495653_0046441 Ga0495653_0046441_339_1451 365
167 3300046477 Ga0495664_0010701 Ga0495664_0010701_345_1457 365
168 3300046477 Ga0495664_0113408 Ga0495664_0113408_139_1248 365
169 3300046516 Ga0495628_0033135 Ga0495628_0033135_2883_3995 365
170 3300046642 Ga0495634_0129413 Ga0495634_0129413_164_1276 365
171 3300047319 Ga0495674_0114505 Ga0495674_0114505_169_1281 365
172 3300047319 Ga0495674_0153187 Ga0495674_0153187_508_1617 365
173 3300047322 Ga0495680_0009823 Ga0495680_0009823_2946_4058 365
174 3300047444 Ga0495675_0117237 Ga0495675_0117237_493_1602 365
175 3300048088 Ga0495602_0051524 Ga0495602_0051524_2039_3151 365
176 3300050507 nmdc:mga05p37_524231_c1 nmdc:mga05p37_524231_c1_109_1218 365
177 3300060353 Ga0501082_0000143 Ga0501082_0000143_1571_2680 365
178 3300060353 Ga0501082_0164847 Ga0501082_0164847_398_1507 365
179 3300005327 Ga0070658_10082218 Ga0070658_100822183 366
180 3300005330 Ga0070690_100139041 Ga0070690_1001390411 366
181 3300005335 Ga0070666_10015597 Ga0070666_100155972 366
182 3300005336 Ga0070680_100002897 Ga0070680_1000028971 366
183 3300005338 Ga0068868_100014431 Ga0068868_1000144314 366
184 3300005338 Ga0068868_100140825 Ga0068868_1001408251 366
185 3300005355 Ga0070671_100043941 Ga0070671_1000439414 366
186 3300005367 Ga0070667_100027179 Ga0070667_1000271792 366
187 3300005458 Ga0070681_10035292 Ga0070681_100352923 366
188 3300005459 Ga0068867_100039914 Ga0068867_1000399142 366
189 3300005468 Ga0070707_100098794 Ga0070707_1000987944 366
190 3300005530 Ga0070679_100000024 Ga0070679_1000000247 366
191 3300005530 Ga0070679_100022298 Ga0070679_1000222984 366
192 3300005530 Ga0070679_100126980 Ga0070679_1001269802 366
193 3300005530 Ga0070679_100145094 Ga0070679_1001450942 366
194 3300005535 Ga0070684_100047549 Ga0070684_1000475491 366
195 3300005546 Ga0070696_100044752 Ga0070696_1000447521 366
196 3300005548 Ga0070665_100130282 Ga0070665_1001302822 366
197 3300005563 Ga0068855_100006381 Ga0068855_1000063817 366
198 3300005564 Ga0070664_100231112 Ga0070664_1002311122 366
199 3300005577 Ga0068857_100004403 Ga0068857_10000440310 366
200 3300005577 Ga0068857_100009275 Ga0068857_1000092752 366
201 3300005616 Ga0068852_100117669 Ga0068852_1001176691 366
202 3300005617 Ga0068859_100108160 Ga0068859_1001081602 366
203 3300005618 Ga0068864_100171461 Ga0068864_1001714612 366
204 3300005842 Ga0068858_100007926 Ga0068858_1000079268 366
205 3300005842 Ga0068858_100036407 Ga0068858_1000364075 366
206 3300005843 Ga0068860_100009604 Ga0068860_1000096048 366
207 3300006237 Ga0097621_100005607 Ga0097621_10000560710 366
208 3300006237 Ga0097621_100227181 Ga0097621_1002271812 366
209 3300006358 Ga0068871_100007548 Ga0068871_1000075483 366
210 3300006358 Ga0068871_100016723 Ga0068871_1000167237 366
211 3300006358 Ga0068871_100193739 Ga0068871_1001937392 366
212 3300006847 Ga0075431_100062459 Ga0075431_1000624593 366
213 3300006931 Ga0097620_100108153 Ga0097620_1001081532 366
214 3300007076 Ga0075435_100130005 Ga0075435_1001300051 366
215 3300009093 Ga0105240_10001081 Ga0105240_1000108110 366
216 3300009093 Ga0105240_10001462 Ga0105240_1000146220 366
217 3300009093 Ga0105240_10024119 Ga0105240_100241194 366
218 3300009098 Ga0105245_10002961 Ga0105245_100029612 366
219 3300009098 Ga0105245_10003583 Ga0105245_100035839 366
220 3300009098 Ga0105245_10013874 Ga0105245_100138743 366
221 3300009174 Ga0105241_10023577 Ga0105241_100235773 366
222 3300009174 Ga0105241_10265771 Ga0105241_102657712 366
223 3300009176 Ga0105242_10110566 Ga0105242_101105663 366
224 3300009176 Ga0105242_10132819 Ga0105242_101328192 366
225 3300009177 Ga0105248_10021339 Ga0105248_100213395 366
226 3300009177 Ga0105248_10041537 Ga0105248_100415374 366
227 3300009545 Ga0105237_10027216 Ga0105237_100272165 366
228 3300009551 Ga0105238_10026874 Ga0105238_100268744 366
229 3300009551 Ga0105238_10068045 Ga0105238_100680452 366
230 3300009551 Ga0105238_10226562 Ga0105238_102265622 366
231 3300009551 Ga0105238_10263773 Ga0105238_102637732 366
232 3300010375 Ga0105239_10026006 Ga0105239_100260062 366
233 3300010375 Ga0105239_10146160 Ga0105239_101461602 366
234 3300010375 Ga0105239_10668913 Ga0105239_106689131 366
235 3300013104 Ga0157370_10002565 Ga0157370_100025658 366
236 3300013104 Ga0157370_10242189 Ga0157370_102421892 366
237 3300013105 Ga0157369_10163100 Ga0157369_101631002 366
238 3300013105 Ga0157369_10203438 Ga0157369_102034382 366
239 3300013296 Ga0157374_10004841 Ga0157374_1000484111 366
240 3300013297 Ga0157378_10002212 Ga0157378_1000221210 366
241 3300013297 Ga0157378_10115071 Ga0157378_101150713 366
242 3300013306 Ga0163162_10009410 Ga0163162_100094109 366
243 3300013306 Ga0163162_10025973 Ga0163162_100259734 366
244 3300013306 Ga0163162_10144071 Ga0163162_101440712 366
245 3300013308 Ga0157375_10125508 Ga0157375_101255082 366
246 3300014325 Ga0163163_10001650 Ga0163163_1000165010 366
247 3300014325 Ga0163163_10025404 Ga0163163_100254045 366
248 3300014325 Ga0163163_10073106 Ga0163163_100731062 366
249 3300014325 Ga0163163_10272026 Ga0163163_102720262 366
250 3300014969 Ga0157376_10067761 Ga0157376_100677612 366
251 3300025899 Ga0207642_10020481 Ga0207642_100204813 366
252 3300025903 Ga0207680_10007757 Ga0207680_100077574 366
253 3300025912 Ga0207707_10000188 Ga0207707_1000018822 366
254 3300025912 Ga0207707_10077565 Ga0207707_100775653 366
255 3300025913 Ga0207695_10004456 Ga0207695_100044562 366
256 3300025913 Ga0207695_10006735 Ga0207695_100067353 366
257 3300025913 Ga0207695_10006834 Ga0207695_1000683410 366
258 3300025913 Ga0207695_10090951 Ga0207695_100909512 366
259 3300025913 Ga0207695_10102144 Ga0207695_101021443 366
260 3300025913 Ga0207695_10352483 Ga0207695_103524832 366
261 3300025914 Ga0207671_10043411 Ga0207671_100434113 366
262 3300025914 Ga0207671_10121391 Ga0207671_101213912 366
263 3300025917 Ga0207660_10000403 Ga0207660_100004031 366
264 3300025918 Ga0207662_10020960 Ga0207662_100209602 366
265 3300025921 Ga0207652_10001088 Ga0207652_100010887 366
266 3300025924 Ga0207694_10090693 Ga0207694_100906932 366
267 3300025927 Ga0207687_10013347 Ga0207687_100133473 366
268 3300025927 Ga0207687_10016925 Ga0207687_100169253 366
269 3300025934 Ga0207686_10026264 Ga0207686_100262642 366
270 3300025941 Ga0207711_10037483 Ga0207711_100374834 366
271 3300025941 Ga0207711_10122997 Ga0207711_101229972 366
272 3300025941 Ga0207711_10211963 Ga0207711_102119633 366
273 3300025949 Ga0207667_10023104 Ga0207667_100231047 366
274 3300025949 Ga0207667_10211305 Ga0207667_102113052 366
275 3300025986 Ga0207658_10037802 Ga0207658_100378024 366
276 3300026023 Ga0207677_10017181 Ga0207677_100171812 366
277 3300026035 Ga0207703_10022493 Ga0207703_100224932 366
278 3300026041 Ga0207639_10127024 Ga0207639_101270242 366
279 3300026067 Ga0207678_10057538 Ga0207678_100575383 366
280 3300026078 Ga0207702_10136543 Ga0207702_101365432 366
281 3300026089 Ga0207648_10115874 Ga0207648_101158742 366
282 3300026116 Ga0207674_10013162 Ga0207674_100131629 366
283 3300028379 Ga0268266_10049494 Ga0268266_100494943 366
284 3300028381 Ga0268264_10064123 Ga0268264_100641232 366
285 3300035118 Ga0373954_0076447 Ga0373954_0076447_278_1423 366
286 3300035170 Ga0373943_0019944 Ga0373943_0019944_1172_2308 366
287 3300035692 Ga0373935_0036866 Ga0373935_0036866_1247_2383 366
288 3300035692 Ga0373935_0056366 Ga0373935_0056366_1093_2208 366
289 3300035695 Ga0373927_0003141 Ga0373927_0003141_4688_5803 366
290 3300035695 Ga0373927_0044038 Ga0373927_0044038_577_1701 366
291 3300035725 Ga0373947_0089555 Ga0373947_0089555_307_1422 366
292 3300037068 Ga0373925_0107697 Ga0373925_0107697_953_2089 366
293 3300037418 Ga0395900_0240000 Ga0395900_0240000_574_1704 366
294 3300037466 Ga0395898_0272982 Ga0395898_0272982_461_1576 366
295 3300039437 Ga0436365_0001504 Ga0436365_0001504_84_1199 366
296 3300039437 Ga0436365_1492531 Ga0436365_1492531_48_1163 366
297 3300039438 Ga0436360_1323621 Ga0436360_1323621_265_1380 366
298 3300039450 Ga0436363_0737069 Ga0436363_0737069_188_1303 366
299 3300045051 Ga0451576_0525896 Ga0451576_0525896_43_1158 366
300 3300046476 Ga0495662_0058736 Ga0495662_0058736_181_1296 366
301 3300046529 Ga0495652_0118298 Ga0495652_0118298_503_1648 366
302 3300046678 Ga0495599_0146449 Ga0495599_0146449_211_1326 366
303 3300047319 Ga0495674_0013188 Ga0495674_0013188_340_1455 366
304 3300047319 Ga0495674_0083076 Ga0495674_0083076_744_1868 366
305 3300047444 Ga0495675_0036147 Ga0495675_0036147_305_1450 366
306 3300047471 Ga0495684_0025144 Ga0495684_0025144_3268_4413 366
307 3300048918 Ga0496115_0015570 Ga0496115_0015570_2354_3469 366
308 3300049586 Ga0501070_0035687 Ga0501070_0035687_1309_2424 366
309 3300049589 Ga0501073_0094455 Ga0501073_0094455_516_1631 366
310 3300049823 Ga0501044_0002962 Ga0501044_0002962_5141_6256 366
311 3300050509 nmdc:mga0qj67_21139_c1 nmdc:mga0qj67_21139_c1_3313_4428 366
312 3300050510 nmdc:mga06r32_28441_c1 nmdc:mga06r32_28441_c1_2430_3545 366
313 3300005614 Ga0068856_100100440 Ga0068856_1001004402 367
314 3300010375 Ga0105239_10172080 Ga0105239_101720802 367
315 3300025935 Ga0207709_10083229 Ga0207709_100832292 367
316 3300025945 Ga0207679_10148668 Ga0207679_101486681 367
317 3300026089 Ga0207648_10012665 Ga0207648_100126655 367
318 3300048911 Ga0496108_0048914 Ga0496108_0048914_404_1516 367
319 3300050515 nmdc:mga0a205_286565_c1 nmdc:mga0a205_286565_c1_58_1170 367
320 3300005339 Ga0070660_100050185 Ga0070660_1000501853 368
321 3300005366 Ga0070659_100003961 Ga0070659_1000039612 368
322 3300005366 Ga0070659_100147990 Ga0070659_1001479902 368
323 3300005458 Ga0070681_10011692 Ga0070681_100116922 368
324 3300005530 Ga0070679_100009548 Ga0070679_1000095485 368
325 3300005539 Ga0068853_100006614 Ga0068853_1000066142 368
326 3300009174 Ga0105241_10157623 Ga0105241_101576232 368
327 3300009177 Ga0105248_10008484 Ga0105248_100084845 368
328 3300013100 Ga0157373_10009713 Ga0157373_100097134 368
329 3300013306 Ga0163162_10061562 Ga0163162_100615622 368
330 3300013307 Ga0157372_10122165 Ga0157372_101221652 368
331 3300014325 Ga0163163_10084927 Ga0163163_100849272 368
332 3300025912 Ga0207707_10154111 Ga0207707_101541112 368
333 3300025919 Ga0207657_10188374 Ga0207657_101883742 368
334 3300025921 Ga0207652_10176495 Ga0207652_101764952 368
335 3300025932 Ga0207690_10118328 Ga0207690_101183281 368
336 3300025941 Ga0207711_10035254 Ga0207711_100352543 368
337 3300026035 Ga0207703_10330799 Ga0207703_103307992 368
338 3300026041 Ga0207639_10030418 Ga0207639_100304182 368
339 3300026116 Ga0207674_10000258 Ga0207674_1000025820 368
340 3300005440 Ga0070705_100182722 Ga0070705_1001827222 369
341 3300006852 Ga0075433_10097983 Ga0075433_100979833 369
342 3300006871 Ga0075434_100176517 Ga0075434_1001765172 369
343 3300037853 Ga0436364_0478638 Ga0436364_0478638_187_1332 369
344 3300039437 Ga0436365_0576586 Ga0436365_0576586_47094_48221 369
345 3300050512 nmdc:mga0n895_456462_c1 nmdc:mga0n895_456462_c1_152_1273 369
346 3300050515 nmdc:mga0a205_30300_c1 nmdc:mga0a205_30300_c1_3996_5117 369
347 3300005290 Ga0065712_10071107 Ga0065712_100711072 370
348 3300005293 Ga0065715_10003032 Ga0065715_100030322 370
349 3300005331 Ga0070670_100044693 Ga0070670_1000446932 370
350 3300005366 Ga0070659_100077650 Ga0070659_1000776502 370
351 3300005441 Ga0070700_100039598 Ga0070700_1000395982 370
352 3300005444 Ga0070694_100036812 Ga0070694_1000368122 370
353 3300005467 Ga0070706_100193560 Ga0070706_1001935602 370
354 3300005471 Ga0070698_100012714 Ga0070698_1000127142 370
355 3300005578 Ga0068854_100049090 Ga0068854_1000490902 370
356 3300005615 Ga0070702_100117331 Ga0070702_1001173312 370
357 3300005617 Ga0068859_100043442 Ga0068859_1000434422 370
358 3300005617 Ga0068859_100094508 Ga0068859_1000945083 370
359 3300005617 Ga0068859_100200060 Ga0068859_1002000601 370
360 3300005841 Ga0068863_100192914 Ga0068863_1001929142 370
361 3300005844 Ga0068862_100075458 Ga0068862_1000754582 370
362 3300006844 Ga0075428_100311227 Ga0075428_1003112272 370
363 3300006852 Ga0075433_10027374 Ga0075433_100273745 370
364 3300006931 Ga0097620_100043449 Ga0097620_1000434492 370
365 3300006931 Ga0097620_100094506 Ga0097620_1000945063 370
366 3300006931 Ga0097620_100200057 Ga0097620_1002000571 370
367 3300009094 Ga0111539_10199108 Ga0111539_101991082 370
368 3300009101 Ga0105247_10101265 Ga0105247_101012652 370
369 3300009147 Ga0114129_10036974 Ga0114129_100369743 370
370 3300009174 Ga0105241_10021842 Ga0105241_100218422 370
371 3300009177 Ga0105248_10007065 Ga0105248_100070652 370
372 3300009545 Ga0105237_10000506 Ga0105237_1000050613 370
373 3300009553 Ga0105249_10054535 Ga0105249_100545352 370
374 3300013100 Ga0157373_10002359 Ga0157373_1000235912 370
375 3300013306 Ga0163162_10035653 Ga0163162_100356532 370
376 3300014325 Ga0163163_10002569 Ga0163163_100025697 370
377 3300014745 Ga0157377_10155057 Ga0157377_101550572 370
378 3300025908 Ga0207643_10014797 Ga0207643_100147972 370
379 3300025941 Ga0207711_10037421 Ga0207711_100374212 370
380 3300026116 Ga0207674_10357554 Ga0207674_103575542 370
381 3300026118 Ga0207675_100068758 Ga0207675_1000687582 370
382 3300027907 Ga0207428_10143737 Ga0207428_101437372 370
383 3300028380 Ga0268265_10080851 Ga0268265_100808512 370
384 3300038996 Ga0242420_014565 Ga0242420_014565_148_1272 370
385 3300048915 Ga0496112_0381590 Ga0496112_0381590_78_1199 370
386 3300050507 nmdc:mga05p37_370186_c1 nmdc:mga05p37_370186_c1_337_1461 370
387 3300050509 nmdc:mga0qj67_84472_c1 nmdc:mga0qj67_84472_c1_1270_2394 370
388 3300050510 nmdc:mga06r32_103117_c1 nmdc:mga06r32_103117_c1_1333_2457 370
389 3300050511 nmdc:mga08y16_94382_c1 nmdc:mga08y16_94382_c1_287_1411 370
390 3300005293 Ga0065715_10160211 Ga0065715_101602111 371
391 3300005458 Ga0070681_10002826 Ga0070681_100028269 371
392 3300025912 Ga0207707_10023499 Ga0207707_100234994 371
393 3300021384 Ga0213876_10000190 Ga0213876_100001903 372
394 3300026095 Ga0207676_10077850 Ga0207676_100778502 372
395 3300005334 Ga0068869_100042160 Ga0068869_1000421602 373
396 3300006844 Ga0075428_100047888 Ga0075428_1000478882 373
397 3300025942 Ga0207689_10023365 Ga0207689_100233652 373
398 3300028381 Ga0268264_10115156 Ga0268264_101151562 373
399 3300005293 Ga0065715_10003978 Ga0065715_100039782 374
400 3300005338 Ga0068868_100015298 Ga0068868_1000152982 374
401 3300005343 Ga0070687_100009738 Ga0070687_1000097383 374
402 3300005353 Ga0070669_100170916 Ga0070669_1001709162 374
403 3300005444 Ga0070694_100170670 Ga0070694_1001706701 374
404 3300005468 Ga0070707_100038528 Ga0070707_1000385282 374
405 3300005518 Ga0070699_100016094 Ga0070699_1000160941 374
406 3300005547 Ga0070693_100121652 Ga0070693_1001216522 374
407 3300005548 Ga0070665_100211319 Ga0070665_1002113191 374
408 3300005549 Ga0070704_100145136 Ga0070704_1001451362 374
409 3300005616 Ga0068852_100138198 Ga0068852_1001381982 374
410 3300005617 Ga0068859_100005492 Ga0068859_1000054929 374
411 3300005617 Ga0068859_100028044 Ga0068859_1000280442 374
412 3300005617 Ga0068859_100192611 Ga0068859_1001926112 374
413 3300005618 Ga0068864_100020345 Ga0068864_1000203454 374
414 3300005719 Ga0068861_100061865 Ga0068861_1000618653 374
415 3300005841 Ga0068863_100342164 Ga0068863_1003421642 374
416 3300005842 Ga0068858_100112772 Ga0068858_1001127722 374
417 3300005843 Ga0068860_100007661 Ga0068860_1000076616 374
418 3300006237 Ga0097621_100010726 Ga0097621_1000107262 374
419 3300006852 Ga0075433_10174817 Ga0075433_101748172 374
420 3300006914 Ga0075436_100033523 Ga0075436_1000335231 374
421 3300006931 Ga0097620_100005491 Ga0097620_1000054912 374
422 3300006931 Ga0097620_100028044 Ga0097620_1000280442 374
423 3300006931 Ga0097620_100192607 Ga0097620_1001926072 374
424 3300009148 Ga0105243_10206935 Ga0105243_102069352 374
425 3300011119 Ga0105246_10226480 Ga0105246_102264801 374
426 3300013306 Ga0163162_10033314 Ga0163162_100333142 374
427 3300025903 Ga0207680_10089308 Ga0207680_100893082 374
428 3300025922 Ga0207646_10069727 Ga0207646_100697272 374
429 3300025941 Ga0207711_10159506 Ga0207711_101595062 374
430 3300025942 Ga0207689_10005239 Ga0207689_100052394 374
431 3300025942 Ga0207689_10135479 Ga0207689_101354793 374
432 3300026023 Ga0207677_10113601 Ga0207677_101136012 374
433 3300026089 Ga0207648_10097066 Ga0207648_100970662 374
434 3300026095 Ga0207676_10108948 Ga0207676_101089482 374
435 3300026118 Ga0207675_100088894 Ga0207675_1000888942 374
436 3300028381 Ga0268264_10011513 Ga0268264_100115135 374
437 3300050507 nmdc:mga05p37_17568_c1 nmdc:mga05p37_17568_c1_2213_3355 374
438 3300050514 nmdc:mga08x19_27360_c1 nmdc:mga08x19_27360_c1_2281_3429 374
439 3300050515 nmdc:mga0a205_68959_c1 nmdc:mga0a205_68959_c1_1733_2875 374
440 3300003203 JGI25406J46586_10025006 JGI25406J46586_100250062 375
441 3300005289 Ga0065704_10168727 Ga0065704_101687271 375
442 3300005290 Ga0065712_10000115 Ga0065712_1000011519 375
443 3300005293 Ga0065715_10090451 Ga0065715_100904512 375
444 3300005295 Ga0065707_10009392 Ga0065707_100093922 375
445 3300005331 Ga0070670_100011220 Ga0070670_1000112202 375
446 3300005334 Ga0068869_100012781 Ga0068869_1000127813 375
447 3300005334 Ga0068869_100059823 Ga0068869_1000598232 375
448 3300005337 Ga0070682_100005421 Ga0070682_1000054215 375
449 3300005340 Ga0070689_100131574 Ga0070689_1001315742 375
450 3300005343 Ga0070687_100063379 Ga0070687_1000633792 375
451 3300005343 Ga0070687_100088464 Ga0070687_1000884641 375
452 3300005353 Ga0070669_100129740 Ga0070669_1001297401 375
453 3300005354 Ga0070675_100306827 Ga0070675_1003068271 375
454 3300005365 Ga0070688_100016374 Ga0070688_1000163742 375
455 3300005440 Ga0070705_100024816 Ga0070705_1000248162 375
456 3300005441 Ga0070700_100081886 Ga0070700_1000818862 375
457 3300005441 Ga0070700_100086660 Ga0070700_1000866602 375
458 3300005444 Ga0070694_100056906 Ga0070694_1000569062 375
459 3300005445 Ga0070708_100001518 Ga0070708_1000015186 375
460 3300005458 Ga0070681_10037049 Ga0070681_100370492 375
461 3300005459 Ga0068867_100043863 Ga0068867_1000438632 375
462 3300005467 Ga0070706_100000452 Ga0070706_10000045243 375
463 3300005467 Ga0070706_100018984 Ga0070706_1000189842 375
464 3300005467 Ga0070706_100105202 Ga0070706_1001052022 375
465 3300005467 Ga0070706_100220497 Ga0070706_1002204971 375
466 3300005468 Ga0070707_100022551 Ga0070707_1000225512 375
467 3300005471 Ga0070698_100005974 Ga0070698_1000059747 375
468 3300005471 Ga0070698_100023131 Ga0070698_1000231312 375
469 3300005471 Ga0070698_100190033 Ga0070698_1001900332 375
470 3300005518 Ga0070699_100024926 Ga0070699_1000249263 375
471 3300005518 Ga0070699_100030707 Ga0070699_1000307073 375
472 3300005518 Ga0070699_100030796 Ga0070699_1000307962 375
473 3300005536 Ga0070697_100000043 Ga0070697_10000004322 375
474 3300005536 Ga0070697_100000192 Ga0070697_10000019234 375
475 3300005536 Ga0070697_100142231 Ga0070697_1001422312 375
476 3300005545 Ga0070695_100033173 Ga0070695_1000331732 375
477 3300005545 Ga0070695_100044926 Ga0070695_1000449263 375
478 3300005545 Ga0070695_100188288 Ga0070695_1001882881 375
479 3300005549 Ga0070704_100075893 Ga0070704_1000758932 375
480 3300005549 Ga0070704_100090011 Ga0070704_1000900112 375
481 3300005549 Ga0070704_100102047 Ga0070704_1001020473 375
482 3300005549 Ga0070704_100284630 Ga0070704_1002846301 375
483 3300005577 Ga0068857_100036084 Ga0068857_1000360843 375
484 3300005615 Ga0070702_100003620 Ga0070702_1000036205 375
485 3300005617 Ga0068859_100035655 Ga0068859_1000356554 375
486 3300005718 Ga0068866_10010160 Ga0068866_100101602 375
487 3300005719 Ga0068861_100025052 Ga0068861_1000250524 375
488 3300005834 Ga0068851_10004072 Ga0068851_100040722 375
489 3300005841 Ga0068863_100018832 Ga0068863_1000188322 375
490 3300005841 Ga0068863_100070073 Ga0068863_1000700732 375
491 3300005842 Ga0068858_100059441 Ga0068858_1000594412 375
492 3300005985 Ga0081539_10000043 Ga0081539_10000043228 375
493 3300005985 Ga0081539_10007178 Ga0081539_100071782 375
494 3300006173 Ga0070716_100129216 Ga0070716_1001292162 375
495 3300006237 Ga0097621_100019452 Ga0097621_1000194522 375
496 3300006358 Ga0068871_100006192 Ga0068871_1000061926 375
497 3300006847 Ga0075431_100193511 Ga0075431_1001935112 375
498 3300006852 Ga0075433_10003126 Ga0075433_100031263 375
499 3300006931 Ga0097620_100035656 Ga0097620_1000356564 375
500 3300009098 Ga0105245_10084873 Ga0105245_100848732 375
501 3300009101 Ga0105247_10030428 Ga0105247_100304282 375
502 3300009148 Ga0105243_10090367 Ga0105243_100903671 375
503 3300009553 Ga0105249_10074532 Ga0105249_100745323 375
504 3300009553 Ga0105249_10242198 Ga0105249_102421982 375
505 3300010375 Ga0105239_10063569 Ga0105239_100635692 375
506 3300013100 Ga0157373_10078890 Ga0157373_100788902 375
507 3300013296 Ga0157374_10031059 Ga0157374_100310592 375
508 3300013306 Ga0163162_10071436 Ga0163162_100714362 375
509 3300014325 Ga0163163_10005524 Ga0163163_100055246 375
510 3300025321 Ga0207656_10002158 Ga0207656_100021582 375
511 3300025885 Ga0207653_10001251 Ga0207653_100012512 375
512 3300025903 Ga0207680_10041666 Ga0207680_100416663 375
513 3300025908 Ga0207643_10001447 Ga0207643_1000144710 375
514 3300025908 Ga0207643_10061646 Ga0207643_100616462 375
515 3300025910 Ga0207684_10000216 Ga0207684_1000021640 375
516 3300025910 Ga0207684_10022730 Ga0207684_100227303 375
517 3300025914 Ga0207671_10005190 Ga0207671_100051902 375
518 3300025918 Ga0207662_10002321 Ga0207662_100023216 375
519 3300025918 Ga0207662_10017817 Ga0207662_100178172 375
520 3300025918 Ga0207662_10067195 Ga0207662_100671952 375
521 3300025925 Ga0207650_10191154 Ga0207650_101911542 375
522 3300025927 Ga0207687_10059404 Ga0207687_100594042 375
523 3300025931 Ga0207644_10141482 Ga0207644_101414822 375
524 3300025933 Ga0207706_10020273 Ga0207706_100202732 375
525 3300025935 Ga0207709_10068805 Ga0207709_100688051 375
526 3300025936 Ga0207670_10005206 Ga0207670_100052065 375
527 3300025936 Ga0207670_10028244 Ga0207670_100282444 375
528 3300025937 Ga0207669_10147436 Ga0207669_101474362 375
529 3300025939 Ga0207665_10155987 Ga0207665_101559872 375
530 3300025940 Ga0207691_10001277 Ga0207691_100012772 375
531 3300025941 Ga0207711_10024304 Ga0207711_100243042 375
532 3300025942 Ga0207689_10003167 Ga0207689_100031676 375
533 3300025942 Ga0207689_10006129 Ga0207689_100061296 375
534 3300025960 Ga0207651_10025235 Ga0207651_100252352 375
535 3300025960 Ga0207651_10144317 Ga0207651_101443172 375
536 3300025961 Ga0207712_10326679 Ga0207712_103266792 375
537 3300026035 Ga0207703_10118070 Ga0207703_101180701 375
538 3300026035 Ga0207703_10135098 Ga0207703_101350982 375
539 3300026035 Ga0207703_10143076 Ga0207703_101430762 375
540 3300026075 Ga0207708_10018867 Ga0207708_100188673 375
541 3300026075 Ga0207708_10044449 Ga0207708_100444492 375
542 3300026075 Ga0207708_10119787 Ga0207708_101197872 375
543 3300026088 Ga0207641_10112100 Ga0207641_101121002 375
544 3300026088 Ga0207641_10117660 Ga0207641_101176602 375
545 3300026089 Ga0207648_10010987 Ga0207648_100109873 375
546 3300026089 Ga0207648_10014814 Ga0207648_100148143 375
547 3300026095 Ga0207676_10002012 Ga0207676_100020122 375
548 3300026118 Ga0207675_100004638 Ga0207675_1000046387 375
549 3300026142 Ga0207698_10119294 Ga0207698_101192942 375
550 3300027907 Ga0207428_10186881 Ga0207428_101868812 375
551 3300032126 Ga0307415_100112508 Ga0307415_1001125082 375
552 3300038443 Ga0395901_0133428 Ga0395901_0133428_391_1536 375
553 3300046539 Ga0495621_0023003 Ga0495621_0023003_80_1225 375
554 3300050507 nmdc:mga05p37_27645_c1 nmdc:mga05p37_27645_c1_3684_4997 375
555 3300050510 nmdc:mga06r32_142184_c1 nmdc:mga06r32_142184_c1_807_2000 375
556 3300050511 nmdc:mga08y16_375066_c1 nmdc:mga08y16_375066_c1_187_1347 375
557 3300050515 nmdc:mga0a205_15001_c1 nmdc:mga0a205_15001_c1_23_1294 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

199

411

0.92

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

58

179

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s8w-assembly1.cif.gz_A amycolatopsis sp. t-1-60 n-succinylamino acid racemase/o-succinylbenzoate synthase r266q mutant in complex with n-succinylphenylglycine 0.9619 10 375
4a6g-assembly1.cif.gz_A n-acyl amino acid racemase from amycalotopsis sp. ts-1-60: g291d- f323y mutant in complex with n-acetyl methionine 0.9609 10 374
1sja-assembly1.cif.gz_A x-ray structure of o-succinylbenzoate synthase complexed with n-acetylmethionine 0.9603 10 373
5fjp-assembly2.cif.gz_A n-acyl amino acid racemase from amycolatopsis sp ts-1-60: g291d f323y i293g mutant in complex with n-acetyl naphthylalanine 0.9601 10 374
2ggg-assembly1.cif.gz_C the mutant a68c-d72c of deinococcus radiodurans n-acylamino acid racemase 0.96 9 373
ID Description Score Start End Superfamily
1wufA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9533 128 368 3.20.20.120
1r0mA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9514 127 356 3.20.20.120
1r0mA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9435 127 356 3.20.20.120
1wufA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9382 128 368 3.20.20.120
1sjaA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9331 10 125 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A353CEB5-F1-model_v4 o-succinylbenzoate synthase (EC 4.2.1.113) 0.9786 127 375 GO:0009234
GO:0016836
AF-A0A1B6BFA4-F1-model_v4 O-succinylbenzoate synthase (EC 4.2.1.113) 0.9785 187 301 GO:0043748
GO:0046872
AF-A0A7C4KWW6-F1-model_v4 o-succinylbenzoate synthase (EC 4.2.1.113) 0.9784 10 374 GO:0009063
GO:0009234
GO:0043748
AF-A0A4R6JAA8-F1-model_v4 o-succinylbenzoate synthase (EC 4.2.1.113) 0.9759 10 374 GO:0009234
GO:0043748
AF-A0A523CYA9-F1-model_v4 o-succinylbenzoate synthase (EC 4.2.1.113) 0.9757 10 313 GO:0009063
GO:0009234
GO:0043748

Feature Viewer

pLDDT pTM Quality
94.84 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map