F463295

General Info

Members Datasets Scaffolds Average Seq Length
557 410 1114 122

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_101329447|Ga0070702_1013294471
Length 128
Sequence MATDKRVIRWAMTTLLKAFAWLLAAAVAFATLGPPGLRPHSGLGQDGEHALAFLLIGLAFGLAYPRRLQTVMIAVAMIGLIEVLQFWAPGRHARWSDFVVDALASCAGLALAACVAWIVGRSRVTRLS

Samples

Sample ID Description Type Environment
1 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
129 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
130 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
149 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
152 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
155 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
156 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
157 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
158 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
159 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
230 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
231 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
234 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
235 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
236 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
237 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
238 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
239 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
240 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
241 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
244 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
247 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
248 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
249 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
250 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
251 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
254 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
257 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
258 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
259 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
260 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
261 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
262 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
263 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
264 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
265 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
266 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
267 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
268 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
269 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
270 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
271 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
272 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
273 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
274 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
275 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
276 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
277 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
278 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
279 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
280 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
281 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
282 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
283 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
284 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
285 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
286 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
287 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
288 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
289 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
290 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
291 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
292 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
293 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
294 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
295 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
296 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
297 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
298 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
299 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
300 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
301 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
302 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
303 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
304 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
305 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
306 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
307 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
308 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
309 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
310 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
311 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
312 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
313 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
314 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
315 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
316 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
317 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
318 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
319 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
320 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
321 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
322 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
323 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
324 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
325 2922368715
326 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
327 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
328 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
329 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
330 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
331 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
332 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
333 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
334 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
335 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
336 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
337 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
338 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
339 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
340 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
341 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
342 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
343 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
344 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
345 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
346 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
347 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
348 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
349 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
350 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
351 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
352 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
353 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
354 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
355 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
356 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
357 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
358 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
359 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
360 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
361 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
362 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
363 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
364 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
365 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
366 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
367 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
368 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
369 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
370 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
371 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
372 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
373 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
374 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
375 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
376 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
377 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
378 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
379 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
380 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
381 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
382 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
383 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
384 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
385 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
386 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
387 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
388 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
389 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
390 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
391 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
392 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
393 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
394 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
395 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
396 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
397 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
398 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
399 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
400 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
401 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
402 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
403 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
404 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
405 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
406 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
407 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
408 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
409 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
410 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.12
Metatranscriptomes 0.18
Isolates 27.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.13
Nodule 21.9
Rhizoplane 4.85
Rhizosphere 40.93
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070702_101329447 3300005615 Bacteria 585
2 JGI25406J46586_10014623 3300003203 Bacteria 3333
3 JGI25165J46597_1043751 3300003214 Bacteria 574
4 JGI25153J46596_10013653 3300003215 Bacteria 3421
5 JGI25153J46596_10030103 3300003215 Bacteria 1853
6 rootH2_10112419 3300003320 Bacteria 1283
7 JGI25160J50197_1000826 3300003354 Bacteria 16549
8 JGI25160J50197_1007269 3300003354 Bacteria 4354
9 JGI25404J52841_10005528 3300003659 Bacteria 2609
10 Ga0055542_1011067 3300003762 Bacteria 1618
11 Ga0055526_1064528 3300003771 Bacteria 766
12 Ga0055543_1009755 3300004625 Bacteria 2043
13 Ga0065165_1000953 3300005262 Bacteria 36442
14 Ga0065165_1012983 3300005262 Bacteria 3344
15 Ga0065165_1045475 3300005262 Bacteria 1279
16 Ga0070658_10434001 3300005327 Bacteria 1131
17 Ga0070670_100387545 3300005331 Bacteria 1232
18 Ga0070666_10824193 3300005335 Bacteria 684
19 Ga0070680_101332443 3300005336 Bacteria 621
20 Ga0068868_100235002 3300005338 Bacteria 1539
21 Ga0068868_101480200 3300005338 Bacteria 635
22 Ga0070660_100457210 3300005339 Bacteria 1060
23 Ga0070660_101392815 3300005339 Bacteria 596
24 Ga0070661_100297350 3300005344 Bacteria 1256
25 Ga0070661_100334654 3300005344 Bacteria 1185
26 Ga0070668_100118610 3300005347 Bacteria 2112
27 Ga0070669_100170198 3300005353 Bacteria 1698
28 Ga0070675_100206657 3300005354 Bacteria 1706
29 Ga0070675_101391567 3300005354 Bacteria 647
30 Ga0070671_100137027 3300005355 Bacteria 2064
31 Ga0070671_100242118 3300005355 Bacteria 1531
32 Ga0070674_100067371 3300005356 Bacteria 2518
33 Ga0070659_100198493 3300005366 Bacteria 1651
34 Ga0070667_100298404 3300005367 Bacteria 1450
35 Ga0070710_10446559 3300005437 Bacteria 876
36 Ga0070711_101009889 3300005439 Bacteria 714
37 Ga0070663_100097038 3300005455 Bacteria 2193
38 Ga0070663_100581311 3300005455 Bacteria 940
39 Ga0070663_101370220 3300005455 Bacteria 626
40 Ga0070663_101415796 3300005455 Bacteria 616
41 Ga0070678_100611787 3300005456 Bacteria 974
42 Ga0070662_100348389 3300005457 Bacteria 1213
43 Ga0070662_100424910 3300005457 Bacteria 1100
44 Ga0070662_100985384 3300005457 Bacteria 721
45 Ga0068867_100883405 3300005459 Bacteria 803
46 Ga0070685_10608704 3300005466 Bacteria 787
47 Ga0070684_100661684 3300005535 Bacteria 973
48 Ga0068853_100164718 3300005539 Bacteria 2003
49 Ga0068853_100247607 3300005539 Bacteria 1635
50 Ga0070686_101967078 3300005544 Bacteria 500
51 Ga0070665_100035744 3300005548 Bacteria 4997
52 Ga0070665_100129990 3300005548 Bacteria 2520
53 Ga0070665_100155661 3300005548 Bacteria 2287
54 Ga0070665_100444775 3300005548 Bacteria 1305
55 Ga0070665_101182311 3300005548 Bacteria 776
56 Ga0070665_101504630 3300005548 Bacteria 681
57 Ga0068855_100365655 3300005563 Bacteria 1587
58 Ga0068855_100505486 3300005563 Bacteria 1313
59 Ga0068855_100808195 3300005563 Bacteria 996
60 Ga0070664_100993533 3300005564 Bacteria 789
61 Ga0068857_101601421 3300005577 Bacteria 636
62 Ga0068857_102320928 3300005577 Bacteria 527
63 Ga0068854_100490565 3300005578 Bacteria 1033
64 Ga0068856_100176554 3300005614 Bacteria 2148
65 Ga0068852_100305823 3300005616 Bacteria 1540
66 Ga0068852_100313777 3300005616 Bacteria 1521
67 Ga0068852_102805849 3300005616 Bacteria 506
68 Ga0068859_101235699 3300005617 Bacteria 823
69 Ga0068859_102738429 3300005617 Bacteria 542
70 Ga0068864_100092017 3300005618 Bacteria 2676
71 Ga0068861_101550905 3300005719 Bacteria 651
72 Ga0068851_10208740 3300005834 Bacteria 1093
73 Ga0068863_100339767 3300005841 Bacteria 1461
74 Ga0068858_100317352 3300005842 Bacteria 1489
75 Ga0068860_102047680 3300005843 Bacteria 594
76 Ga0068862_100845327 3300005844 Bacteria 897
77 Ga0081540_1009453 3300005983 Bacteria 6718
78 Ga0081540_1019708 3300005983 Bacteria 4086
79 Ga0081540_1025110 3300005983 Bacteria 3440
80 Ga0075365_10125218 3300006038 Bacteria 1775
81 Ga0075365_10356776 3300006038 Bacteria 1031
82 Ga0075365_10829228 3300006038 Bacteria 652
83 Ga0075365_10882318 3300006038 Bacteria 631
84 Ga0075365_11336525 3300006038 Bacteria 503
85 Ga0075368_10019419 3300006042 Bacteria 2565
86 Ga0075368_10324882 3300006042 Bacteria 667
87 Ga0075364_10015720 3300006051 Bacteria 4696
88 Ga0075364_10373245 3300006051 Bacteria 973
89 Ga0075364_10699818 3300006051 Bacteria 691
90 Ga0075362_10061749 3300006177 Bacteria 1696
91 Ga0075362_10766718 3300006177 Bacteria 506
92 Ga0075367_10182415 3300006178 Bacteria 1309
93 Ga0075367_10207271 3300006178 Bacteria 1225
94 Ga0075367_10312660 3300006178 Bacteria 989
95 Ga0075367_10396407 3300006178 Bacteria 873
96 Ga0075369_10131364 3300006186 Bacteria 1138
97 Ga0075366_10057846 3300006195 Bacteria 2303
98 Ga0075366_10552545 3300006195 Bacteria 713
99 Ga0075366_10635634 3300006195 Bacteria 662
100 Ga0075370_10100514 3300006353 Bacteria 1673
101 Ga0075370_10635231 3300006353 Bacteria 648
102 Ga0075370_10905973 3300006353 Bacteria 539
103 Ga0097620_101235298 3300006931 Bacteria 823
104 Ga0097620_102738953 3300006931 Bacteria 542
105 Ga0099825_1026235 3300006941 Bacteria 3130
106 Ga0105240_10337099 3300009093 Bacteria 1714
107 Ga0105245_10449630 3300009098 Bacteria 1297
108 Ga0105245_12061789 3300009098 Bacteria 624
109 Ga0105247_10138064 3300009101 Bacteria 1595
110 Ga0105243_10250946 3300009148 Bacteria 1580
111 Ga0105243_10583852 3300009148 Bacteria 1073
112 Ga0105241_10213116 3300009174 Bacteria 1619
113 Ga0105242_12043238 3300009176 Bacteria 616
114 Ga0105248_10109885 3300009177 Bacteria 3108
115 Ga0105248_10472905 3300009177 Bacteria 1413
116 Ga0105248_10917530 3300009177 Bacteria 989
117 Ga0105237_10148805 3300009545 Bacteria 2337
118 Ga0105238_11424094 3300009551 Bacteria 720
119 Ga0105249_10517714 3300009553 Bacteria 1240
120 Ga0105249_11809595 3300009553 Bacteria 683
121 Ga0105239_10100977 3300010375 Bacteria 3192
122 Ga0105239_11502674 3300010375 Bacteria 778
123 Ga0105246_10233507 3300011119 Bacteria 1450
124 Ga0105246_10281764 3300011119 Bacteria 1334
125 Ga0157313_1016438 3300012503 Bacteria 707
126 Ga0157371_10967024 3300013102 Bacteria 648
127 Ga0157374_11217344 3300013296 Bacteria 774
128 Ga0163162_10928200 3300013306 Bacteria 982
129 Ga0163162_12550516 3300013306 Bacteria 588
130 Ga0157375_10252142 3300013308 Bacteria 1926
131 Ga0163163_10153943 3300014325 Bacteria 2343
132 Ga0182008_10143427 3300014497 Bacteria 1196
133 Ga0157379_10156461 3300014968 Bacteria 2056
134 Ga0182006_1272133 3300015261 Bacteria 555
135 Ga0206353_11517155 3300020082 Bacteria 988
136 Ga0209563_103426 3300025230 Bacteria 3280
137 Ga0209677_103084 3300025253 Bacteria 5686
138 Ga0209148_1000926 3300025254 Bacteria 19432
139 Ga0209233_1029472 3300025261 Bacteria 1304
140 Ga0209233_1058845 3300025261 Bacteria 749
141 Ga0209455_1001120 3300025272 Bacteria 13049
142 Ga0209673_1079097 3300025273 Bacteria 758
143 Ga0209564_1005322 3300025295 Bacteria 7409
144 Ga0209758_1012591 3300025297 Bacteria 4716
145 Ga0209758_1012861 3300025297 Bacteria 4635
146 Ga0209758_1074824 3300025297 Bacteria 1049
147 Ga0207426_1000402 3300025302 Bacteria 72738
148 Ga0207426_1010621 3300025302 Bacteria 3562
149 Ga0207426_1139149 3300025302 Bacteria 579
150 Ga0209257_1026548 3300025304 Bacteria 1949
151 Ga0209257_1099353 3300025304 Bacteria 712
152 Ga0207656_10449420 3300025321 Bacteria 651
153 Ga0207692_10817713 3300025898 Bacteria 610
154 Ga0207710_10141679 3300025900 Bacteria 1161
155 Ga0207710_10481128 3300025900 Bacteria 643
156 Ga0207688_10148816 3300025901 Bacteria 1382
157 Ga0207680_10324771 3300025903 Bacteria 1077
158 Ga0207680_10698125 3300025903 Bacteria 727
159 Ga0207647_10126716 3300025904 Bacteria 1502
160 Ga0207645_10369732 3300025907 Bacteria 961
161 Ga0207705_10150110 3300025909 Bacteria 1746
162 Ga0207671_10495185 3300025914 Bacteria 974
163 Ga0207657_10446320 3300025919 Bacteria 1015
164 Ga0207681_10158135 3300025923 Bacteria 1705
165 Ga0207694_10720763 3300025924 Bacteria 841
166 Ga0207694_11005314 3300025924 Bacteria 706
167 Ga0207650_10217021 3300025925 Bacteria 1538
168 Ga0207644_10114953 3300025931 Bacteria 2040
169 Ga0207706_10224329 3300025933 Bacteria 1645
170 Ga0207709_10810477 3300025935 Bacteria 756
171 Ga0207669_10718033 3300025937 Bacteria 823
172 Ga0207711_10052938 3300025941 Bacteria 3480
173 Ga0207667_10281143 3300025949 Bacteria 1700
174 Ga0207667_10343979 3300025949 Bacteria 1522
175 Ga0207651_10514141 3300025960 Bacteria 1037
176 Ga0207712_11866357 3300025961 Bacteria 538
177 Ga0207668_10196433 3300025972 Bacteria 1603
178 Ga0207640_10178376 3300025981 Bacteria 1590
179 Ga0207640_10262790 3300025981 Bacteria 1346
180 Ga0207658_10254605 3300025986 Bacteria 1493
181 Ga0207677_10123419 3300026023 Bacteria 1953
182 Ga0207677_10706932 3300026023 Bacteria 895
183 Ga0207677_11224703 3300026023 Bacteria 688
184 Ga0207703_10358976 3300026035 Bacteria 1343
185 Ga0207639_10192539 3300026041 Bacteria 1743
186 Ga0207639_11068668 3300026041 Bacteria 757
187 Ga0207639_11662165 3300026041 Bacteria 599
188 Ga0207678_10065760 3300026067 Bacteria 3113
189 Ga0207678_10087943 3300026067 Bacteria 2655
190 Ga0207678_10163945 3300026067 Bacteria 1898
191 Ga0207678_10214833 3300026067 Bacteria 1646
192 Ga0207678_10433742 3300026067 Bacteria 1141
193 Ga0207678_11378021 3300026067 Bacteria 624
194 Ga0207702_10529176 3300026078 Bacteria 1151
195 Ga0207702_11317696 3300026078 Bacteria 716
196 Ga0207676_10276139 3300026095 Bacteria 1524
197 Ga0207676_10945615 3300026095 Bacteria 847
198 Ga0207674_10432097 3300026116 Bacteria 1273
199 Ga0207675_101185583 3300026118 Bacteria 784
200 Ga0207683_10342038 3300026121 Bacteria 1372
201 Ga0207698_10204105 3300026142 Bacteria 1773
202 Ga0207698_12353300 3300026142 Bacteria 544
203 Ga0209389_1000001 3300027296 Bacteria 463799
204 Ga0209489_111216 3300027361 Bacteria 9325
205 Ga0209700_100007 3300027363 Bacteria 454608
206 Ga0268266_10030476 3300028379 Bacteria 4583
207 Ga0268266_10169000 3300028379 Bacteria 1984
208 Ga0268266_10369739 3300028379 Bacteria 1350
209 Ga0268266_10980136 3300028379 Bacteria 818
210 Ga0268266_11082926 3300028379 Bacteria 775
211 Ga0268265_10372493 3300028380 Bacteria 1311
212 Ga0268264_10139324 3300028381 Bacteria 2161
213 Ga0307517_10000235 3300028786 Bacteria 93944
214 Ga0307515_10536700 3300028794 Bacteria 779
215 Ga0307408_100532674 3300031548 Bacteria 1034
216 Ga0307408_102260389 3300031548 Bacteria 526
217 Ga0307516_10009730 3300031730 Bacteria 10666
218 Ga0307516_10321226 3300031730 Bacteria 1219
219 Ga0307412_10754976 3300031911 Bacteria 840
220 Ga0307411_10915467 3300032005 Bacteria 780
221 Ga0307415_101080384 3300032126 Bacteria 750
222 Ga0307510_10074236 3300033180 Bacteria 3362
223 Ga0307510_10093590 3300033180 Bacteria 2836
224 Ga0373925_0754609 3300037068 Bacteria 802
225 Ga0395899_0125978 3300037312 Bacteria 1832
226 Ga0395900_0001517 3300037418 Bacteria 27573
227 Ga0395898_0031988 3300037466 Bacteria 5252
228 Ga0395905_0002238 3300037471 Bacteria 21782
229 Ga0395905_0057176 3300037471 Bacteria 3649
230 Ga0395905_0112742 3300037471 Bacteria 2554
231 Ga0395905_0123256 3300037471 Bacteria 2437
232 Ga0395901_0339170 3300038443 Bacteria 1553
233 Ga0451787_426626 3300041441 Bacteria 802
234 Ga0451789_0790857 3300041443 Bacteria 1369
235 Ga0451793_1657459 3300041452 Bacteria 1777
236 Ga0451795_1119167 3300041456 Bacteria 1127
237 Ga0451802_1150288 3300041460 Bacteria 696
238 Ga0451807_1085445 3300041486 Bacteria 954
239 Ga0451833_0333407 3300041491 Bacteria 744
240 Ga0451833_0871452 3300041491 Bacteria 1029
241 Ga0451839_0126534 3300041496 Bacteria 1449
242 Ga0451841_0347546 3300041498 Bacteria 1037
243 Ga0451849_0675646 3300041505 Bacteria 1063
244 Ga0451851_1120568 3300041507 Bacteria 586
245 Ga0451843_0961521 3300041509 Bacteria 1378
246 Ga0451843_1174369 3300041509 Bacteria 704
247 Ga0466972_0005563 3300044658 Bacteria 6309
248 Ga0466965_0029000 3300044683 Bacteria 2691
249 Ga0466963_0045997 3300044694 Bacteria 2876
250 Ga0466964_0034230 3300044706 Bacteria 2027
251 Ga0466968_0020419 3300044735 Bacteria 2674
252 Ga0466968_0060710 3300044735 Bacteria 1630
253 Ga0466960_0027193 3300044901 Bacteria 2606
254 Ga0466960_0430271 3300044901 Bacteria 764
255 Ga0495590_0140412 3300046457 Bacteria 872
256 Ga0495590_0436502 3300046457 Bacteria 505
257 Ga0495629_0308999 3300046459 Bacteria 1082
258 Ga0495638_0137345 3300046460 Bacteria 1430
259 Ga0495650_0054437 3300046471 Bacteria 1633
260 Ga0495582_0709521 3300046473 Bacteria 582
261 Ga0495605_0301271 3300046474 Bacteria 678
262 Ga0495584_0068928 3300046491 Bacteria 1777
263 Ga0495585_0106517 3300046492 Bacteria 1495
264 Ga0495585_0445122 3300046492 Bacteria 620
265 Ga0495606_0002171 3300046507 Bacteria 23603
266 Ga0495606_0416902 3300046507 Bacteria 695
267 Ga0495606_0650381 3300046507 Bacteria 510
268 Ga0495616_0052250 3300046513 Bacteria 2035
269 Ga0495620_0110248 3300046515 Bacteria 1091
270 Ga0495628_0178441 3300046516 Bacteria 1608
271 Ga0495643_0024156 3300046522 Bacteria 3449
272 Ga0495643_0289084 3300046522 Bacteria 751
273 Ga0495643_0289538 3300046522 Bacteria 750
274 Ga0495648_0221358 3300046524 Bacteria 933
275 Ga0495648_0292530 3300046524 Bacteria 767
276 Ga0495633_0086813 3300046558 Bacteria 1455
277 Ga0495656_0256834 3300046615 Bacteria 884
278 Ga0495668_0025284 3300046616 Bacteria 3375
279 Ga0495668_0151888 3300046616 Bacteria 1268
280 Ga0495625_0311073 3300046660 Bacteria 1005
281 Ga0495625_0585417 3300046660 Bacteria 672
282 Ga0495625_0859509 3300046660 Bacteria 523
283 Ga0495661_0177361 3300046665 Bacteria 1131
284 Ga0495588_0162239 3300046674 Bacteria 1182
285 Ga0495646_0591531 3300046680 Bacteria 564
286 Ga0495672_0017510 3300047320 Bacteria 4792
287 Ga0495672_0070005 3300047320 Bacteria 1989
288 Ga0495672_0410041 3300047320 Bacteria 618
289 Ga0495687_035102 3300047443 Bacteria 2258
290 Ga0495687_130397 3300047443 Bacteria 891
291 Ga0495687_175437 3300047443 Bacteria 705
292 Ga0495673_0038277 3300047469 Bacteria 2183
293 Ga0495673_0058951 3300047469 Bacteria 1652
294 Ga0495686_0132641 3300047472 Bacteria 1476
295 Ga0495686_0140349 3300047472 Bacteria 1426
296 Ga0495686_0220866 3300047472 Bacteria 1078
297 Ga0495686_0259713 3300047472 Bacteria 973
298 Ga0496100_1683146 3300048903 Bacteria 501
299 Ga0496101_0231296 3300048904 Bacteria 1437
300 Ga0496101_0732328 3300048904 Bacteria 780
301 Ga0496102_0396877 3300048905 Bacteria 1297
302 Ga0496103_0028653 3300048906 Bacteria 3381
303 Ga0496104_0194866 3300048907 Bacteria 1938
304 Ga0496104_1264102 3300048907 Bacteria 641
305 Ga0496105_0567697 3300048908 Bacteria 884
306 Ga0496106_0398187 3300048909 Bacteria 1107
307 Ga0496107_0027117 3300048910 Bacteria 4067
308 Ga0496108_0231040 3300048911 Bacteria 1608
309 Ga0496110_0022741 3300048913 Bacteria 5327
310 Ga0496111_0346444 3300048914 Bacteria 1100
311 Ga0496112_0130030 3300048915 Bacteria 2489
312 Ga0496113_0071330 3300048916 Bacteria 2642
313 Ga0496113_0265637 3300048916 Bacteria 1371
314 Ga0496113_0359308 3300048916 Bacteria 1168
315 Ga0496114_0023973 3300048917 Bacteria 4979
316 Ga0496114_0730111 3300048917 Bacteria 867
317 Ga0496115_0266874 3300048918 Bacteria 1407
318 Ga0496115_1462483 3300048918 Bacteria 502
319 Ga0496116_0084806 3300048919 Bacteria 1950
320 Ga0496116_0331788 3300048919 Bacteria 706
321 Ga0496117_0297007 3300048920 Bacteria 857
322 Ga0496118_0050858 3300048921 Bacteria 3175
323 Ga0496118_0104527 3300048921 Bacteria 1901
324 Ga0496118_0548308 3300048921 Bacteria 564
325 Ga0496119_0086740 3300048922 Bacteria 1788
326 Ga0496119_0102361 3300048922 Bacteria 1606
327 Ga0496119_0107737 3300048922 Bacteria 1553
328 Ga0496119_0277727 3300048922 Bacteria 834
329 Ga0496120_0067089 3300048923 Bacteria 1983
330 Ga0496121_0005119 3300048924 Bacteria 17078
331 Ga0496121_0072839 3300048924 Bacteria 2756
332 Ga0496121_0104308 3300048924 Bacteria 2179
333 Ga0496121_0123746 3300048924 Bacteria 1948
334 Ga0496121_0144167 3300048924 Bacteria 1762
335 Ga0496121_0228555 3300048924 Bacteria 1305
336 Ga0496123_0281390 3300048926 Bacteria 804
337 Ga0496124_0158503 3300048927 Bacteria 1767
338 Ga0496124_0286904 3300048927 Bacteria 1197
339 Ga0496124_0822050 3300048927 Bacteria 573
340 Ga0496125_0034687 3300048928 Bacteria 4441
341 Ga0496125_0114391 3300048928 Bacteria 1944
342 Ga0496126_0002472 3300048929 Bacteria 24884
343 Ga0496126_0195316 3300048929 Bacteria 1712
344 Ga0496126_0201205 3300048929 Bacteria 1682
345 Ga0496126_0237019 3300048929 Bacteria 1526
346 Ga0496126_0559741 3300048929 Bacteria 906
347 Ga0495682_0097592 3300049460 Bacteria 1055
348 Ga0501067_0461842 3300049583 Bacteria 709
349 nmdc:mga03683_101309_c1 3300050489 Bacteria 1266
350 nmdc:mga03n38_133442_c1 3300050490 Bacteria 1233
351 nmdc:mga00v17_318784_c1 3300050491 Bacteria 1010
352 nmdc:mga0yw44_1133267_c1 3300050492 Bacteria 528
353 nmdc:mga0yw44_221479_c1 3300050492 Bacteria 1254
354 nmdc:mga0yw44_226951_c1 3300050492 Bacteria 1239
355 nmdc:mga0k408_38729_c1 3300050493 Bacteria 2737
356 nmdc:mga0k408_586386_c1 3300050493 Bacteria 658
357 nmdc:mga06z11_259265_c1 3300050494 Bacteria 1025
358 nmdc:mga06z11_279482_c1 3300050494 Bacteria 989
359 nmdc:mga06z11_415340_c1 3300050494 Bacteria 811
360 nmdc:mga06z11_447194_c1 3300050494 Bacteria 781
361 nmdc:mga06z11_460382_c1 3300050494 Bacteria 769
362 nmdc:mga06z11_512923_c1 3300050494 Bacteria 727
363 nmdc:mga04h51_89859_c1 3300050495 Bacteria 1103
364 nmdc:mga07m45_146845_c1 3300050496 Bacteria 1367
365 nmdc:mga07m45_171133_c1 3300050496 Bacteria 1262
366 nmdc:mga0sz30_13770_c2 3300050516 Bacteria 884
367 nmdc:mga0sz30_30832_c1 3300050516 Bacteria 2217
368 nmdc:mga0sz30_455726_c1 3300050516 Bacteria 574
369 nmdc:mga0sz30_74558_c1 3300050516 Bacteria 1464
370 Ga0495601_0689300 3300053077 Unclassified 652
371 Ga0495612_0571185 3300053078 Unclassified 521
372 Ga0500635_0249102 3300053080 Bacteria 697
373 Ga0500578_0729926 3300053086 Bacteria 530
374 Ga0500647_0009669 3300053091 Bacteria 4236
375 Ga0500651_0350813 3300053093 Bacteria 837
376 Ga0500566_0000381 3300053094 Bacteria 24461
377 Ga0500566_0035630 3300053094 Bacteria 2891
378 Ga0500640_179296 3300053095 Bacteria 770
379 Ga0500557_000054 3300053105 Bacteria 50111
380 Ga0500569_004823 3300053109 Bacteria 2865
381 Ga0500595_000586 3300053119 Bacteria 21747
382 Ga0500607_273178 3300053121 Bacteria 650
383 Ga0500642_0000136 3300053130 Bacteria 32674
384 Ga0500652_077321 3300053131 Bacteria 1384
385 Ga0500655_013871 3300053133 Bacteria 1473
386 Ga0500658_0431532 3300053134 Bacteria 601
387 Ga0500559_0004858 3300053136 Bacteria 6272
388 Ga0500564_209526 3300053138 Bacteria 795
389 Ga0500568_0088787 3300053139 Bacteria 1167
390 Ga0500588_0288608 3300053146 Bacteria 620
391 Ga0500638_172467 3300053162 Bacteria 941
392 Ga0500639_233266 3300053163 Bacteria 755
393 Ga0500636_0005867 3300053177 Bacteria 7039
394 Ga0500636_0051855 3300053177 Bacteria 2411
395 Ga0500636_0113375 3300053177 Bacteria 1529
396 Ga0500576_085544 3300053725 Bacteria 1322
397 Ga0500625_000999 3300053729 Bacteria 9001
398 Ga0500645_011524 3300053730 Bacteria 2884
399 Ga0500609_004790 3300053731 Bacteria 1861
400 Ga0500661_018307 3300055283 Bacteria 1249
401 Ga0500661_023739 3300055283 Bacteria 1085
402 Ga0466962_0492586 3300061719 Bacteria 620
403 2507507898 2507262055 Bacteria 8048963
404 2508542009 2508501009 Bacteria 7784016
405 2508692447 2508501042 Bacteria 8719808
406 2511399398 2511231028 Bacteria 8046582
407 2513622482 2513237092 Bacteria 8341956
408 2513647287 2513237095 Bacteria 8976980
409 2513700107 2513237102 Bacteria 7703324
410 2513877525 2513237139 Bacteria 8737671
411 2514009669 2513237161 Bacteria 8871253
412 2515626797 2515154112 Bacteria 8294334
413 2517103897 2517093001 Bacteria 9002274
414 2528853063 2528768022 Bacteria 10457665
415 2617346564 2617270735 Bacteria 9163226
416 2617372468 2617270741 Bacteria 8201522
417 2793060877 2791355196 Bacteria 7323613
418 2805918464 2802429603 Bacteria 8777136
419 2818236325 2816332527 Bacteria 8933356
420 2824607049 2824600985 Bacteria 8488197
421 2824613486 2824609381 Bacteria 8672835
422 2824622894 2824617872 Bacteria 8814715
423 2824631955 2824626560 Bacteria 8813858
424 2824638534 2824635225 Bacteria 8785348
425 2824650689 2824644064 Bacteria 8743947
426 2824665349 2824661429 Bacteria 9877870
427 2824678058 2824671348 Bacteria 8369588
428 2824694464 2824687955 Bacteria 8360029
429 2824699687 2824696289 Bacteria 8335049
430 2824713136 2824704595 Bacteria 9667483
431 2824716188 2824714736 Bacteria 8717648
432 2824730757 2824723954 Bacteria 8758240
433 2824738599 2824732956 Bacteria 7810675
434 2824747100 2824746037 Bacteria 7911610
435 2824755716 2824753945 Bacteria 9787441
436 2824766379 2824763712 Bacteria 9792355
437 2824777310 2824773399 Bacteria 8360218
438 2838122899 2838122688 Bacteria 8803140
439 2841944817 2841941048 Bacteria 8688029
440 2841950838 2841949485 Bacteria 8680857
441 2841959949 2841957949 Bacteria 8652217
442 2841973710 2841966195 Bacteria 8673214
443 2841978600 2841974524 Bacteria 8931498
444 2841988966 2841983080 Bacteria 8395090
445 2842040419 2842038055 Bacteria 8002051
446 2842046636 2842045827 Bacteria 8006841
447 2847937120 2847930680 Bacteria 9342022
448 2847947500 2847939898 Bacteria 8606328
449 2849078624 2849076700 Bacteria 7039503
450 2857513010 2857509624 Bacteria 7472071
451 2874599001 2874590934 Bacteria 8299676
452 2874622319 2874620515 Bacteria 8290088
453 2874635246 2874628541 Bacteria 8630250
454 2874650552 2874645413 Bacteria 8214782
455 2876764247 2876761206 Bacteria 10111113
456 2876779040 2876771140 Bacteria 8287509
457 2876822644 2876818435 Bacteria 8274608
458 2879082833 2879074833 Bacteria 8279565
459 2879089215 2879083081 Bacteria 8587928
460 2879102851 2879099564 Bacteria 10442239
461 2879133102 2879127579 Bacteria 8294491
462 2879149389 2879142872 Bacteria 8267021
463 2881364699 2881364244 Bacteria 7710352
464 2885409786 2885409591 Bacteria 9235467
465 2888385220 2888378607 Bacteria 9652610
466 2888393019 2888388044 Bacteria 7304136
467 2888425363 2888419890 Bacteria 7857137
468 2904667930 2904666416 Bacteria 8226587
469 2904712230 2904711408 Bacteria 9771557
470 2906650421 2906643746 Bacteria 8722424
471 2908780914 2908775508 Bacteria 8092255
472 2922372673
473 2929620485 2929615660 Bacteria 9193770
474 2929626378 2929624759 Bacteria 9339455
475 2932784749 2932784394 Bacteria 9704911
476 2932809729 2932809354 Bacteria 9135765
477 2932818526 2932818245 Bacteria 9955613
478 2932828532 2932828146 Bacteria 9745859
479 2933582403 2933577622 Bacteria 9116884
480 2935609611 2935608549 Bacteria 8203142
481 2935617490 2935616580 Bacteria 9032984
482 2935639028 2935638405 Bacteria 10015038
483 2935652242 2935648319 Bacteria 8801166
484 2935660824 2935656913 Bacteria 8965014
485 2935666120 2935665750 Bacteria 9571747
486 2935675768 2935675223 Bacteria 9928132
487 2935685222 2935684952 Bacteria 9590419
488 2935694912 2935694250 Bacteria 9291695
489 2935704035 2935703347 Bacteria 10242284
490 2935713775 2935713505 Bacteria 9608509
491 2935724394 2935722832 Bacteria 9608746
492 2935733248 2935732158 Bacteria 9706831
493 2935742627 2935741537 Bacteria 9707219
494 2935751187 2935750917 Bacteria 9590372
495 2935760289 2935760218 Bacteria 9817913
496 2935770002 2935769743 Bacteria 7878163
497 2935784777 2935777560 Bacteria 8077691
498 2935785756 2935785616 Bacteria 7962367
499 2935794316 2935793552 Bacteria 8012592
500 2935802118 2935801545 Bacteria 9301974
501 2935810940 2935810662 Bacteria 9401221
502 2935822773 2935819856 Bacteria 8261050
503 2935828523 2935827899 Bacteria 10038562
504 2935839899 2935837841 Bacteria 9454360
505 2935848355 2935847175 Bacteria 8228321
506 2935856115 2935855204 Bacteria 9035059
507 2935865941 2935864058 Bacteria 9784707
508 2935877734 2935873716 Bacteria 9632195
509 2935909842 2935908558 Bacteria 8568796
510 2935917566 2935916978 Bacteria 9113783
511 2935927322 2935926038 Bacteria 8601059
512 2935936833 2935934488 Bacteria 8602579
513 2935944864 2935942939 Bacteria 8599779
514 2935953301 2935951376 Bacteria 8602333
515 2935961198 2935959822 Bacteria 7869783
516 2935970141 2935967501 Bacteria 8603075
517 2935980442 2935975950 Bacteria 8347125
518 2935986709 2935984226 Bacteria 8302647
519 2935992679 2935992306 Bacteria 9802711
520 2936002551 2936002035 Bacteria 9362176
521 2936014880 2936011229 Bacteria 8801034
522 2936022139 2936019824 Bacteria 8804134
523 2936032827 2936028420 Bacteria 8965941
524 2936037640 2936037263 Bacteria 9446081
525 2936050621 2936046547 Bacteria 8903709
526 2936059603 2936055302 Bacteria 8785755
527 2940558011 2940556831 Bacteria 9590747
528 2941540761 2941538514 Bacteria 9402094
529 3005485012 3005483717 Bacteria 7877331
530 3005587293 3005587118 Bacteria 7794411
531 8016520975 8016511872 Bacteria 9921665
532 8016528911 8016522445 Bacteria 8156687
533 8016534104 8016530956 Bacteria 8155261
534 8016547337 8016539877 Bacteria 8155419
535 8016563173 8016557553 Bacteria 8154380
536 8016572447 8016566248 Bacteria 8158151
537 8016576614 8016575299 Bacteria 8154085
538 8016600929 8016595262 Bacteria 8149947
539 8016609541 8016603502 Bacteria 8731218
540 8016625838 8016622563 Bacteria 7999408
541 8016639421 8016630954 Bacteria 9217207
542 8017064626 8017057580 Bacteria 10023680
543 8019533873 8019530166 Bacteria 8155624
544 8019545797 8019538911 Bacteria 7872763
545 8019552925 8019547302 Bacteria 7996444
546 8019583992 8019576017 Bacteria 10049540
547 8019591799 8019586578 Bacteria 10212056
548 8019599539 8019597564 Bacteria 10041141
549 8019619562 8019619141 Bacteria 9218857
550 8019633551 8019629233 Bacteria 8687553
551 8019646346 8019638758 Bacteria 9062356
552 8019661433 8019659431 Bacteria 8577854
553 8019670974 8019668869 Bacteria 8791617
554 8019685222 8019678201 Bacteria 8863603
555 8019690831 8019687851 Bacteria 8712826
556 8055745347 8055742211 Bacteria 9226248
557 8056968800 8056967851 Bacteria 9038162
558 Ga0070702_101329447
559 JGI25406J46586_10014623
560 JGI25165J46597_1043751
561 JGI25153J46596_10013653
562 JGI25153J46596_10030103
563 rootH2_10112419
564 JGI25160J50197_1000826
565 JGI25160J50197_1007269
566 JGI25404J52841_10005528
567 Ga0055542_1011067
568 Ga0055526_1064528
569 Ga0055543_1009755
570 Ga0065165_1000953
571 Ga0065165_1012983
572 Ga0065165_1045475
573 Ga0070658_10434001
574 Ga0070670_100387545
575 Ga0070666_10824193
576 Ga0070680_101332443
577 Ga0068868_100235002
578 Ga0068868_101480200
579 Ga0070660_100457210
580 Ga0070660_101392815
581 Ga0070661_100297350
582 Ga0070661_100334654
583 Ga0070668_100118610
584 Ga0070669_100170198
585 Ga0070675_100206657
586 Ga0070675_101391567
587 Ga0070671_100137027
588 Ga0070671_100242118
589 Ga0070674_100067371
590 Ga0070659_100198493
591 Ga0070667_100298404
592 Ga0070710_10446559
593 Ga0070711_101009889
594 Ga0070663_100097038
595 Ga0070663_100581311
596 Ga0070663_101370220
597 Ga0070663_101415796
598 Ga0070678_100611787
599 Ga0070662_100348389
600 Ga0070662_100424910
601 Ga0070662_100985384
602 Ga0068867_100883405
603 Ga0070685_10608704
604 Ga0070684_100661684
605 Ga0068853_100164718
606 Ga0068853_100247607
607 Ga0070686_101967078
608 Ga0070665_100035744
609 Ga0070665_100129990
610 Ga0070665_100155661
611 Ga0070665_100444775
612 Ga0070665_101182311
613 Ga0070665_101504630
614 Ga0068855_100365655
615 Ga0068855_100505486
616 Ga0068855_100808195
617 Ga0070664_100993533
618 Ga0068857_101601421
619 Ga0068857_102320928
620 Ga0068854_100490565
621 Ga0068856_100176554
622 Ga0068852_100305823
623 Ga0068852_100313777
624 Ga0068852_102805849
625 Ga0068859_101235699
626 Ga0068859_102738429
627 Ga0068864_100092017
628 Ga0068861_101550905
629 Ga0068851_10208740
630 Ga0068863_100339767
631 Ga0068858_100317352
632 Ga0068860_102047680
633 Ga0068862_100845327
634 Ga0081540_1009453
635 Ga0081540_1019708
636 Ga0081540_1025110
637 Ga0075365_10125218
638 Ga0075365_10356776
639 Ga0075365_10829228
640 Ga0075365_10882318
641 Ga0075365_11336525
642 Ga0075368_10019419
643 Ga0075368_10324882
644 Ga0075364_10015720
645 Ga0075364_10373245
646 Ga0075364_10699818
647 Ga0075362_10061749
648 Ga0075362_10766718
649 Ga0075367_10182415
650 Ga0075367_10207271
651 Ga0075367_10312660
652 Ga0075367_10396407
653 Ga0075369_10131364
654 Ga0075366_10057846
655 Ga0075366_10552545
656 Ga0075366_10635634
657 Ga0075370_10100514
658 Ga0075370_10635231
659 Ga0075370_10905973
660 Ga0097620_101235298
661 Ga0097620_102738953
662 Ga0099825_1026235
663 Ga0105240_10337099
664 Ga0105245_10449630
665 Ga0105245_12061789
666 Ga0105247_10138064
667 Ga0105243_10250946
668 Ga0105243_10583852
669 Ga0105241_10213116
670 Ga0105242_12043238
671 Ga0105248_10109885
672 Ga0105248_10472905
673 Ga0105248_10917530
674 Ga0105237_10148805
675 Ga0105238_11424094
676 Ga0105249_10517714
677 Ga0105249_11809595
678 Ga0105239_10100977
679 Ga0105239_11502674
680 Ga0105246_10233507
681 Ga0105246_10281764
682 Ga0157313_1016438
683 Ga0157371_10967024
684 Ga0157374_11217344
685 Ga0163162_10928200
686 Ga0163162_12550516
687 Ga0157375_10252142
688 Ga0163163_10153943
689 Ga0182008_10143427
690 Ga0157379_10156461
691 Ga0182006_1272133
692 Ga0206353_11517155
693 Ga0209563_103426
694 Ga0209677_103084
695 Ga0209148_1000926
696 Ga0209233_1029472
697 Ga0209233_1058845
698 Ga0209455_1001120
699 Ga0209673_1079097
700 Ga0209564_1005322
701 Ga0209758_1012591
702 Ga0209758_1012861
703 Ga0209758_1074824
704 Ga0207426_1000402
705 Ga0207426_1010621
706 Ga0207426_1139149
707 Ga0209257_1026548
708 Ga0209257_1099353
709 Ga0207656_10449420
710 Ga0207692_10817713
711 Ga0207710_10141679
712 Ga0207710_10481128
713 Ga0207688_10148816
714 Ga0207680_10324771
715 Ga0207680_10698125
716 Ga0207647_10126716
717 Ga0207645_10369732
718 Ga0207705_10150110
719 Ga0207671_10495185
720 Ga0207657_10446320
721 Ga0207681_10158135
722 Ga0207694_10720763
723 Ga0207694_11005314
724 Ga0207650_10217021
725 Ga0207644_10114953
726 Ga0207706_10224329
727 Ga0207709_10810477
728 Ga0207669_10718033
729 Ga0207711_10052938
730 Ga0207667_10281143
731 Ga0207667_10343979
732 Ga0207651_10514141
733 Ga0207712_11866357
734 Ga0207668_10196433
735 Ga0207640_10178376
736 Ga0207640_10262790
737 Ga0207658_10254605
738 Ga0207677_10123419
739 Ga0207677_10706932
740 Ga0207677_11224703
741 Ga0207703_10358976
742 Ga0207639_10192539
743 Ga0207639_11068668
744 Ga0207639_11662165
745 Ga0207678_10065760
746 Ga0207678_10087943
747 Ga0207678_10163945
748 Ga0207678_10214833
749 Ga0207678_10433742
750 Ga0207678_11378021
751 Ga0207702_10529176
752 Ga0207702_11317696
753 Ga0207676_10276139
754 Ga0207676_10945615
755 Ga0207674_10432097
756 Ga0207675_101185583
757 Ga0207683_10342038
758 Ga0207698_10204105
759 Ga0207698_12353300
760 Ga0209389_1000001
761 Ga0209489_111216
762 Ga0209700_100007
763 Ga0268266_10030476
764 Ga0268266_10169000
765 Ga0268266_10369739
766 Ga0268266_10980136
767 Ga0268266_11082926
768 Ga0268265_10372493
769 Ga0268264_10139324
770 Ga0307517_10000235
771 Ga0307515_10536700
772 Ga0307408_100532674
773 Ga0307408_102260389
774 Ga0307516_10009730
775 Ga0307516_10321226
776 Ga0307412_10754976
777 Ga0307411_10915467
778 Ga0307415_101080384
779 Ga0307510_10074236
780 Ga0307510_10093590
781 Ga0373925_0754609
782 Ga0395899_0125978
783 Ga0395900_0001517
784 Ga0395898_0031988
785 Ga0395905_0002238
786 Ga0395905_0057176
787 Ga0395905_0112742
788 Ga0395905_0123256
789 Ga0395901_0339170
790 Ga0451787_426626
791 Ga0451789_0790857
792 Ga0451793_1657459
793 Ga0451795_1119167
794 Ga0451802_1150288
795 Ga0451807_1085445
796 Ga0451833_0333407
797 Ga0451833_0871452
798 Ga0451839_0126534
799 Ga0451841_0347546
800 Ga0451849_0675646
801 Ga0451851_1120568
802 Ga0451843_0961521
803 Ga0451843_1174369
804 Ga0466972_0005563
805 Ga0466965_0029000
806 Ga0466963_0045997
807 Ga0466964_0034230
808 Ga0466968_0020419
809 Ga0466968_0060710
810 Ga0466960_0027193
811 Ga0466960_0430271
812 Ga0495590_0140412
813 Ga0495590_0436502
814 Ga0495629_0308999
815 Ga0495638_0137345
816 Ga0495650_0054437
817 Ga0495582_0709521
818 Ga0495605_0301271
819 Ga0495584_0068928
820 Ga0495585_0106517
821 Ga0495585_0445122
822 Ga0495606_0002171
823 Ga0495606_0416902
824 Ga0495606_0650381
825 Ga0495616_0052250
826 Ga0495620_0110248
827 Ga0495628_0178441
828 Ga0495643_0024156
829 Ga0495643_0289084
830 Ga0495643_0289538
831 Ga0495648_0221358
832 Ga0495648_0292530
833 Ga0495633_0086813
834 Ga0495656_0256834
835 Ga0495668_0025284
836 Ga0495668_0151888
837 Ga0495625_0311073
838 Ga0495625_0585417
839 Ga0495625_0859509
840 Ga0495661_0177361
841 Ga0495588_0162239
842 Ga0495646_0591531
843 Ga0495672_0017510
844 Ga0495672_0070005
845 Ga0495672_0410041
846 Ga0495687_035102
847 Ga0495687_130397
848 Ga0495687_175437
849 Ga0495673_0038277
850 Ga0495673_0058951
851 Ga0495686_0132641
852 Ga0495686_0140349
853 Ga0495686_0220866
854 Ga0495686_0259713
855 Ga0496100_1683146
856 Ga0496101_0231296
857 Ga0496101_0732328
858 Ga0496102_0396877
859 Ga0496103_0028653
860 Ga0496104_0194866
861 Ga0496104_1264102
862 Ga0496105_0567697
863 Ga0496106_0398187
864 Ga0496107_0027117
865 Ga0496108_0231040
866 Ga0496110_0022741
867 Ga0496111_0346444
868 Ga0496112_0130030
869 Ga0496113_0071330
870 Ga0496113_0265637
871 Ga0496113_0359308
872 Ga0496114_0023973
873 Ga0496114_0730111
874 Ga0496115_0266874
875 Ga0496115_1462483
876 Ga0496116_0084806
877 Ga0496116_0331788
878 Ga0496117_0297007
879 Ga0496118_0050858
880 Ga0496118_0104527
881 Ga0496118_0548308
882 Ga0496119_0086740
883 Ga0496119_0102361
884 Ga0496119_0107737
885 Ga0496119_0277727
886 Ga0496120_0067089
887 Ga0496121_0005119
888 Ga0496121_0072839
889 Ga0496121_0104308
890 Ga0496121_0123746
891 Ga0496121_0144167
892 Ga0496121_0228555
893 Ga0496123_0281390
894 Ga0496124_0158503
895 Ga0496124_0286904
896 Ga0496124_0822050
897 Ga0496125_0034687
898 Ga0496125_0114391
899 Ga0496126_0002472
900 Ga0496126_0195316
901 Ga0496126_0201205
902 Ga0496126_0237019
903 Ga0496126_0559741
904 Ga0495682_0097592
905 Ga0501067_0461842
906 nmdc:mga03683_101309_c1
907 nmdc:mga03n38_133442_c1
908 nmdc:mga00v17_318784_c1
909 nmdc:mga0yw44_1133267_c1
910 nmdc:mga0yw44_221479_c1
911 nmdc:mga0yw44_226951_c1
912 nmdc:mga0k408_38729_c1
913 nmdc:mga0k408_586386_c1
914 nmdc:mga06z11_259265_c1
915 nmdc:mga06z11_279482_c1
916 nmdc:mga06z11_415340_c1
917 nmdc:mga06z11_447194_c1
918 nmdc:mga06z11_460382_c1
919 nmdc:mga06z11_512923_c1
920 nmdc:mga04h51_89859_c1
921 nmdc:mga07m45_146845_c1
922 nmdc:mga07m45_171133_c1
923 nmdc:mga0sz30_13770_c2
924 nmdc:mga0sz30_30832_c1
925 nmdc:mga0sz30_455726_c1
926 nmdc:mga0sz30_74558_c1
927 Ga0495601_0689300
928 Ga0495612_0571185
929 Ga0500635_0249102
930 Ga0500578_0729926
931 Ga0500647_0009669
932 Ga0500651_0350813
933 Ga0500566_0000381
934 Ga0500566_0035630
935 Ga0500640_179296
936 Ga0500557_000054
937 Ga0500569_004823
938 Ga0500595_000586
939 Ga0500607_273178
940 Ga0500642_0000136
941 Ga0500652_077321
942 Ga0500655_013871
943 Ga0500658_0431532
944 Ga0500559_0004858
945 Ga0500564_209526
946 Ga0500568_0088787
947 Ga0500588_0288608
948 Ga0500638_172467
949 Ga0500639_233266
950 Ga0500636_0005867
951 Ga0500636_0051855
952 Ga0500636_0113375
953 Ga0500576_085544
954 Ga0500625_000999
955 Ga0500645_011524
956 Ga0500609_004790
957 Ga0500661_018307
958 Ga0500661_023739
959 Ga0466962_0492586
960 2507507898
961 2508542009
962 2508692447
963 2511399398
964 2513622482
965 2513647287
966 2513700107
967 2513877525
968 2514009669
969 2515626797
970 2517103897
971 2528853063
972 2617346564
973 2617372468
974 2793060877
975 2805918464
976 2818236325
977 2824607049
978 2824613486
979 2824622894
980 2824631955
981 2824638534
982 2824650689
983 2824665349
984 2824678058
985 2824694464
986 2824699687
987 2824713136
988 2824716188
989 2824730757
990 2824738599
991 2824747100
992 2824755716
993 2824766379
994 2824777310
995 2838122899
996 2841944817
997 2841950838
998 2841959949
999 2841973710
1000 2841978600
1001 2841988966
1002 2842040419
1003 2842046636
1004 2847937120
1005 2847947500
1006 2849078624
1007 2857513010
1008 2874599001
1009 2874622319
1010 2874635246
1011 2874650552
1012 2876764247
1013 2876779040
1014 2876822644
1015 2879082833
1016 2879089215
1017 2879102851
1018 2879133102
1019 2879149389
1020 2881364699
1021 2885409786
1022 2888385220
1023 2888393019
1024 2888425363
1025 2904667930
1026 2904712230
1027 2906650421
1028 2908780914
1029 2922372673
1030 2929620485
1031 2929626378
1032 2932784749
1033 2932809729
1034 2932818526
1035 2932828532
1036 2933582403
1037 2935609611
1038 2935617490
1039 2935639028
1040 2935652242
1041 2935660824
1042 2935666120
1043 2935675768
1044 2935685222
1045 2935694912
1046 2935704035
1047 2935713775
1048 2935724394
1049 2935733248
1050 2935742627
1051 2935751187
1052 2935760289
1053 2935770002
1054 2935784777
1055 2935785756
1056 2935794316
1057 2935802118
1058 2935810940
1059 2935822773
1060 2935828523
1061 2935839899
1062 2935848355
1063 2935856115
1064 2935865941
1065 2935877734
1066 2935909842
1067 2935917566
1068 2935927322
1069 2935936833
1070 2935944864
1071 2935953301
1072 2935961198
1073 2935970141
1074 2935980442
1075 2935986709
1076 2935992679
1077 2936002551
1078 2936014880
1079 2936022139
1080 2936032827
1081 2936037640
1082 2936050621
1083 2936059603
1084 2940558011
1085 2941540761
1086 3005485012
1087 3005587293
1088 8016520975
1089 8016528911
1090 8016534104
1091 8016547337
1092 8016563173
1093 8016572447
1094 8016576614
1095 8016600929
1096 8016609541
1097 8016625838
1098 8016639421
1099 8017064626
1100 8019533873
1101 8019545797
1102 8019552925
1103 8019583992
1104 8019591799
1105 8019599539
1106 8019619562
1107 8019633551
1108 8019646346
1109 8019661433
1110 8019670974
1111 8019685222
1112 8019690831
1113 8055745347
1114 8056968800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vhb-assembly1.cif.gz_B bacterial dimeric hemoglobin from vitreoscilla stercoraria 0.5541 33 115
7q3g-assembly1.cif.gz_B pentameric ligand-gated ion channel, declic at ph 7 with 10 mm ca2+ 0.5317 41 110
6v4s-assembly1.cif.gz_B a closed pore conformation of a pentameic ligand-gated ion channel with additional n-terminal domain 0.5209 41 110
6v4s-assembly1.cif.gz_C a closed pore conformation of a pentameic ligand-gated ion channel with additional n-terminal domain 0.5197 41 110
6e6t-assembly1.cif.gz_A dieckmann cyclase, ncmc, bound to cerulenin 0.5158 7 104
ID Description Score Start End Superfamily
af_O13689_1_162_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.6527 5 119 1.20.1270.60
af_A4I4M5_183_278_1.10.506.10 Mainly Alpha;Orthogonal Bundle;GTPase Activation - p120GAP; domain 1;GTPase Activation - p120gap; domain 1 0.6171 37 112 1.10.506.10
af_O13689_1_162_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.6158 5 119 1.20.1270.60
af_P64439_3_118_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6156 11 111 1.10.1760.20
af_B6EU62_104_262_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.5603 41 109 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A4Q8XQU1-F1-model_v4 VanZ family protein 0.9681 1 114 GO:0016020
AF-A0A504UBU4-F1-model_v4 VanZ family protein 0.9594 4 116 GO:0016020
AF-A0A6G8ZZA4-F1-model_v4 VanZ family protein 0.9547 4 114 GO:0016020
AF-A0A420D299-F1-model_v4 VanZ like protein 0.9521 1 113 GO:0016020
AF-A0A2A6F9J5-F1-model_v4 VanZ family protein 0.952 4 109 GO:0016020

Map