F463230

General Info

Members Datasets Scaffolds Average Seq Length
556 171 1112 96

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_1232521|Ga0395898_1232521_301_627
Length 108
Sequence LAEEIVITVTAPLQLWTGDNGSWHMFVIPEEQSDEIRAHCLMSMRGFKSSRVEATIDDPSAGSGRAVTWRTSVFPMRSGGYFLPVKAEVRRKAGIAAGDEVRVELELL

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
164 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
165 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
166 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
167 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
168 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 1.98
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 21.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_1232521 3300037466 Bacteria 679
2 JGI24737J22298_10001575 3300001990 Bacteria 8119
3 JGI24737J22298_10019523 3300001990 Bacteria 2167
4 JGI24735J21928_10002236 3300002067 Bacteria 6784
5 JGI24735J21928_10129712 3300002067 Unclassified 727
6 JGI24735J21928_10261684 3300002067 Unclassified 505
7 Ga0065712_10096574 3300005290 Unclassified 2179
8 Ga0065712_10113449 3300005290 Bacteria 1783
9 Ga0065712_10553627 3300005290 Unclassified 616
10 Ga0070658_10012752 3300005327 Bacteria 6742
11 Ga0070658_10189451 3300005327 Bacteria 1733
12 Ga0070658_10191800 3300005327 Bacteria 1722
13 Ga0070658_10231347 3300005327 Bacteria 1565
14 Ga0070658_10337627 3300005327 Bacteria 1288
15 Ga0070658_10611156 3300005327 Bacteria 945
16 Ga0070658_10808745 3300005327 Bacteria 814
17 Ga0070658_11053345 3300005327 Bacteria 707
18 Ga0070658_11524916 3300005327 Unclassified 579
19 Ga0070658_11717340 3300005327 Bacteria 543
20 Ga0070676_10117978 3300005328 Bacteria 1662
21 Ga0070683_100735730 3300005329 Bacteria 945
22 Ga0070683_101436331 3300005329 Bacteria 663
23 Ga0070670_100191284 3300005331 Bacteria 1777
24 Ga0070677_10726652 3300005333 Unclassified 561
25 Ga0070666_10214401 3300005335 Bacteria 1357
26 Ga0070666_10840646 3300005335 Bacteria 677
27 Ga0070680_100003480 3300005336 Bacteria 11753
28 Ga0070680_100116386 3300005336 Bacteria 2228
29 Ga0070680_100648444 3300005336 Bacteria 907
30 Ga0070680_101195561 3300005336 Bacteria 658
31 Ga0070680_101775185 3300005336 Bacteria 535
32 Ga0070660_100008669 3300005339 Bacteria 7123
33 Ga0070660_100016613 3300005339 Bacteria 5346
34 Ga0070660_100042768 3300005339 Bacteria 3459
35 Ga0070660_100075831 3300005339 Bacteria 2633
36 Ga0070660_100082235 3300005339 Bacteria 2529
37 Ga0070660_100083787 3300005339 Bacteria 2505
38 Ga0070660_100115027 3300005339 Bacteria 2144
39 Ga0070660_100214836 3300005339 Bacteria 1562
40 Ga0070660_100455536 3300005339 Unclassified 1062
41 Ga0070660_100666271 3300005339 Unclassified 872
42 Ga0070660_101290609 3300005339 Unclassified 619
43 Ga0070660_101294533 3300005339 Bacteria 618
44 Ga0070691_10094889 3300005341 Bacteria 1475
45 Ga0070661_100037223 3300005344 Bacteria 3539
46 Ga0070661_100052842 3300005344 Bacteria 2973
47 Ga0070661_100059594 3300005344 Bacteria 2800
48 Ga0070661_100490974 3300005344 Bacteria 982
49 Ga0070661_100530941 3300005344 Archaea 945
50 Ga0070661_100860544 3300005344 Bacteria 746
51 Ga0070661_100973325 3300005344 Bacteria 703
52 Ga0070661_101437723 3300005344 Bacteria 581
53 Ga0070669_100899222 3300005353 Bacteria 756
54 Ga0070675_100056756 3300005354 Bacteria 3227
55 Ga0070675_101303950 3300005354 Unclassified 669
56 Ga0070671_100030940 3300005355 Bacteria 4418
57 Ga0070671_101550634 3300005355 Unclassified 587
58 Ga0070674_100812453 3300005356 Bacteria 808
59 Ga0070673_100043457 3300005364 Bacteria 3472
60 Ga0070673_100150510 3300005364 Bacteria 1971
61 Ga0070659_100008998 3300005366 Bacteria 7321
62 Ga0070659_100013270 3300005366 Bacteria 6127
63 Ga0070659_100016995 3300005366 Bacteria 5469
64 Ga0070659_100065911 3300005366 Unclassified 2869
65 Ga0070659_100222788 3300005366 Unclassified 1557
66 Ga0070659_100307501 3300005366 Bacteria 1323
67 Ga0070659_100356817 3300005366 Unclassified 1227
68 Ga0070667_100222685 3300005367 Bacteria 1680
69 Ga0070667_100894157 3300005367 Unclassified 826
70 Ga0070714_100030736 3300005435 Bacteria 4474
71 Ga0070714_100034632 3300005435 Bacteria 4229
72 Ga0070714_100197800 3300005435 Bacteria 1838
73 Ga0070714_100271787 3300005435 Bacteria 1572
74 Ga0070714_100339602 3300005435 Bacteria 1408
75 Ga0070714_100514967 3300005435 Unclassified 1142
76 Ga0070713_100070609 3300005436 Bacteria 2949
77 Ga0070663_100208908 3300005455 Unclassified 1528
78 Ga0070663_102157022 3300005455 Unclassified 503
79 Ga0070662_100157398 3300005457 Bacteria 1774
80 Ga0070662_100222079 3300005457 Bacteria 1508
81 Ga0070681_10347890 3300005458 Bacteria 1392
82 Ga0070681_10727363 3300005458 Bacteria 909
83 Ga0070681_10847960 3300005458 Bacteria 831
84 Ga0070679_100088865 3300005530 Bacteria 3076
85 Ga0070679_100154753 3300005530 Bacteria 2268
86 Ga0070679_100244208 3300005530 Bacteria 1752
87 Ga0070679_100606597 3300005530 Bacteria 1038
88 Ga0070679_101058690 3300005530 Unclassified 755
89 Ga0070684_100003533 3300005535 Bacteria 11754
90 Ga0068853_100155229 3300005539 Unclassified 2062
91 Ga0068853_100389701 3300005539 Bacteria 1302
92 Ga0068853_101398707 3300005539 Bacteria 677
93 Ga0070693_100004690 3300005547 Bacteria 6495
94 Ga0070693_100111465 3300005547 Bacteria 1684
95 Ga0068855_100036408 3300005563 Bacteria 5857
96 Ga0068855_100398086 3300005563 Bacteria 1509
97 Ga0068855_100443594 3300005563 Unclassified 1417
98 Ga0068855_100579722 3300005563 Unclassified 1212
99 Ga0068855_100626618 3300005563 Bacteria 1157
100 Ga0068855_100699806 3300005563 Bacteria 1084
101 Ga0068855_101329969 3300005563 Bacteria 743
102 Ga0068855_102277950 3300005563 Bacteria 542
103 Ga0068855_102394227 3300005563 Unclassified 527
104 Ga0070664_100002025 3300005564 Bacteria 16245
105 Ga0070664_100088789 3300005564 Bacteria 2673
106 Ga0070664_100109554 3300005564 Bacteria 2409
107 Ga0070664_100202889 3300005564 Bacteria 1770
108 Ga0068857_100079764 3300005577 Bacteria 2922
109 Ga0068857_100262626 3300005577 Bacteria 1585
110 Ga0068857_101176798 3300005577 Bacteria 742
111 Ga0068854_100004561 3300005578 Bacteria 8735
112 Ga0068854_100012831 3300005578 Bacteria 5487
113 Ga0068854_100087915 3300005578 Bacteria 2306
114 Ga0068854_100222635 3300005578 Bacteria 1493
115 Ga0068854_100312542 3300005578 Unclassified 1275
116 Ga0068854_100907081 3300005578 Bacteria 775
117 Ga0068856_100261352 3300005614 Bacteria 1746
118 Ga0068856_100575828 3300005614 Unclassified 1147
119 Ga0068856_100949388 3300005614 Bacteria 878
120 Ga0068856_101004370 3300005614 Bacteria 853
121 Ga0068856_101173269 3300005614 Bacteria 784
122 Ga0068852_100001084 3300005616 Bacteria 17991
123 Ga0068852_100003900 3300005616 Bacteria 10481
124 Ga0068852_100027787 3300005616 Bacteria 4617
125 Ga0068852_100044484 3300005616 Bacteria 3771
126 Ga0068852_100099039 3300005616 Bacteria 2627
127 Ga0068852_100654007 3300005616 Unclassified 1059
128 Ga0068852_100890245 3300005616 Bacteria 907
129 Ga0068852_101653342 3300005616 Unclassified 663
130 Ga0068852_101653535 3300005616 Unclassified 663
131 Ga0068859_102773636 3300005617 Unclassified 538
132 Ga0068851_10051466 3300005834 Bacteria 2093
133 Ga0068851_10111486 3300005834 Bacteria 1461
134 Ga0068851_10257252 3300005834 Bacteria 992
135 Ga0068863_100020819 3300005841 Bacteria 6263
136 Ga0068858_100120929 3300005842 Bacteria 2449
137 Ga0068858_102421989 3300005842 Unclassified 519
138 Ga0068860_100205794 3300005843 Bacteria 1908
139 Ga0068860_100982525 3300005843 Bacteria 862
140 Ga0068862_100016900 3300005844 Bacteria 6073
141 Ga0068862_100065039 3300005844 Bacteria 3141
142 Ga0068862_100301632 3300005844 Bacteria 1474
143 Ga0070717_10377559 3300006028 Bacteria 1271
144 Ga0075364_10677139 3300006051 Bacteria 704
145 Ga0070716_101300764 3300006173 Bacteria 588
146 Ga0075362_10095446 3300006177 Bacteria 1385
147 Ga0097621_100034847 3300006237 Bacteria 4017
148 Ga0068871_100280730 3300006358 Unclassified 1457
149 Ga0068871_102262844 3300006358 Unclassified 518
150 Ga0097620_101309757 3300006931 Unclassified 798
151 Ga0097620_102773003 3300006931 Unclassified 538
152 Ga0105240_10106306 3300009093 Bacteria 3404
153 Ga0105240_10263468 3300009093 Bacteria 1987
154 Ga0105240_10300580 3300009093 Bacteria 1836
155 Ga0105240_12527753 3300009093 Unclassified 531
156 Ga0111539_10518905 3300009094 Unclassified 1388
157 Ga0105245_10952697 3300009098 Unclassified 901
158 Ga0105241_10108337 3300009174 Bacteria 2220
159 Ga0105242_10575586 3300009176 Bacteria 1084
160 Ga0105248_10037901 3300009177 Bacteria 5393
161 Ga0105248_10058620 3300009177 Bacteria 4324
162 Ga0105248_10335462 3300009177 Bacteria 1703
163 Ga0105248_12356045 3300009177 Bacteria 606
164 Ga0105237_10042787 3300009545 Bacteria 4565
165 Ga0105237_10397313 3300009545 Unclassified 1383
166 Ga0105237_10440897 3300009545 Bacteria 1308
167 Ga0105238_10011411 3300009551 Bacteria 8948
168 Ga0105238_10128425 3300009551 Bacteria 2513
169 Ga0105238_10368997 3300009551 Bacteria 1426
170 Ga0105238_10652260 3300009551 Bacteria 1063
171 Ga0105238_10949358 3300009551 Unclassified 880
172 Ga0105238_10970306 3300009551 Bacteria 870
173 Ga0105249_10839267 3300009553 Unclassified 984
174 Ga0105239_10615295 3300010375 Bacteria 1239
175 Ga0105239_13249474 3300010375 Unclassified 529
176 Ga0105246_12077961 3300011119 Unclassified 550
177 Ga0157373_10016979 3300013100 Bacteria 5301
178 Ga0157373_10018070 3300013100 Bacteria 5135
179 Ga0157373_10079709 3300013100 Bacteria 2310
180 Ga0157373_10132953 3300013100 Bacteria 1749
181 Ga0157373_10362927 3300013100 Bacteria 1034
182 Ga0157373_10522218 3300013100 Bacteria 859
183 Ga0157373_11507943 3300013100 Bacteria 513
184 Ga0157371_10039815 3300013102 Bacteria 3361
185 Ga0157371_10055096 3300013102 Bacteria 2822
186 Ga0157371_10288003 3300013102 Bacteria 1187
187 Ga0157371_11161730 3300013102 Unclassified 594
188 Ga0157371_11400106 3300013102 Unclassified 543
189 Ga0157370_10024880 3300013104 Bacteria 5928
190 Ga0157370_10079937 3300013104 Bacteria 3079
191 Ga0157370_10108498 3300013104 Bacteria 2596
192 Ga0157370_10143012 3300013104 Bacteria 2228
193 Ga0157370_10502832 3300013104 Bacteria 1113
194 Ga0157370_10551485 3300013104 Unclassified 1057
195 Ga0157369_10029036 3300013105 Bacteria 6115
196 Ga0157369_10072724 3300013105 Bacteria 3690
197 Ga0157369_10134883 3300013105 Unclassified 2614
198 Ga0157369_10140550 3300013105 Bacteria 2555
199 Ga0157369_10603489 3300013105 Unclassified 1133
200 Ga0157369_10623207 3300013105 Bacteria 1113
201 Ga0157369_11442365 3300013105 Bacteria 700
202 Ga0157369_11504434 3300013105 Bacteria 685
203 Ga0157369_11795430 3300013105 Bacteria 623
204 Ga0157378_10163077 3300013297 Bacteria 2086
205 Ga0157378_10261010 3300013297 Bacteria 1662
206 Ga0163162_10122982 3300013306 Bacteria 2700
207 Ga0163162_11015771 3300013306 Unclassified 938
208 Ga0157372_10020397 3300013307 Bacteria 7150
209 Ga0157372_10126419 3300013307 Unclassified 2939
210 Ga0157372_10184819 3300013307 Bacteria 2414
211 Ga0157372_10315804 3300013307 Bacteria 1819
212 Ga0157372_10901049 3300013307 Unclassified 1026
213 Ga0157372_10930764 3300013307 Unclassified 1008
214 Ga0157372_11098953 3300013307 Bacteria 920
215 Ga0157372_11161453 3300013307 Bacteria 893
216 Ga0157372_11692703 3300013307 Unclassified 728
217 Ga0157372_12550530 3300013307 Unclassified 587
218 Ga0157375_10164317 3300013308 Bacteria 2364
219 Ga0163163_10002880 3300014325 Bacteria 14548
220 Ga0157379_10066732 3300014968 Bacteria 3217
221 Ga0163161_10494564 3300017792 Unclassified 995
222 Ga0206355_1307932 3300020076 Bacteria 885
223 Ga0224712_10550460 3300022467 Bacteria 561
224 Ga0207697_10066836 3300025315 Unclassified 1502
225 Ga0207688_10110624 3300025901 Unclassified 1594
226 Ga0207688_10260858 3300025901 Bacteria 1051
227 Ga0207680_10009596 3300025903 Bacteria 4807
228 Ga0207647_10000793 3300025904 Bacteria 24512
229 Ga0207647_10008797 3300025904 Bacteria 7208
230 Ga0207647_10030406 3300025904 Bacteria 3485
231 Ga0207647_10068030 3300025904 Bacteria 2156
232 Ga0207647_10333370 3300025904 Bacteria 860
233 Ga0207699_10444052 3300025906 Bacteria 930
234 Ga0207705_10008131 3300025909 Bacteria 7682
235 Ga0207705_10031389 3300025909 Bacteria 3792
236 Ga0207705_10109876 3300025909 Bacteria 2036
237 Ga0207705_10132855 3300025909 Bacteria 1853
238 Ga0207705_10184986 3300025909 Bacteria 1574
239 Ga0207705_10417062 3300025909 Bacteria 1039
240 Ga0207705_10825324 3300025909 Bacteria 719
241 Ga0207707_10070780 3300025912 Bacteria 3039
242 Ga0207707_10085313 3300025912 Bacteria 2759
243 Ga0207707_10482692 3300025912 Bacteria 1058
244 Ga0207707_10820532 3300025912 Bacteria 774
245 Ga0207695_10029480 3300025913 Bacteria 6061
246 Ga0207695_10442097 3300025913 Bacteria 1184
247 Ga0207695_11470940 3300025913 Unclassified 562
248 Ga0207671_10033125 3300025914 Bacteria 3845
249 Ga0207671_10657693 3300025914 Bacteria 834
250 Ga0207693_10019195 3300025915 Bacteria 5441
251 Ga0207660_10009147 3300025917 Bacteria 6415
252 Ga0207660_10086354 3300025917 Bacteria 2316
253 Ga0207660_10268305 3300025917 Bacteria 1351
254 Ga0207660_10819495 3300025917 Bacteria 760
255 Ga0207660_11225113 3300025917 Bacteria 610
256 Ga0207657_10016509 3300025919 Bacteria 7120
257 Ga0207657_10029503 3300025919 Bacteria 4992
258 Ga0207657_10055019 3300025919 Bacteria 3438
259 Ga0207657_10118370 3300025919 Unclassified 2181
260 Ga0207657_10140011 3300025919 Bacteria 1977
261 Ga0207657_10142680 3300025919 Unclassified 1956
262 Ga0207657_10158669 3300025919 Bacteria 1838
263 Ga0207657_10164934 3300025919 Unclassified 1798
264 Ga0207657_10404397 3300025919 Bacteria 1074
265 Ga0207657_10556147 3300025919 Bacteria 897
266 Ga0207657_11330306 3300025919 Unclassified 542
267 Ga0207649_10061732 3300025920 Unclassified 2360
268 Ga0207649_10187145 3300025920 Unclassified 1453
269 Ga0207649_10196240 3300025920 Bacteria 1423
270 Ga0207649_10213997 3300025920 Bacteria 1369
271 Ga0207649_10389964 3300025920 Bacteria 1040
272 Ga0207652_10123309 3300025921 Bacteria 2307
273 Ga0207652_10145852 3300025921 Bacteria 2118
274 Ga0207652_10159014 3300025921 Bacteria 2025
275 Ga0207652_10243474 3300025921 Bacteria 1621
276 Ga0207652_10569441 3300025921 Bacteria 1017
277 Ga0207681_10023793 3300025923 Bacteria 3923
278 Ga0207681_10447957 3300025923 Bacteria 1050
279 Ga0207694_10052253 3300025924 Bacteria 3168
280 Ga0207694_10853193 3300025924 Unclassified 770
281 Ga0207650_10055753 3300025925 Bacteria 2934
282 Ga0207659_10020922 3300025926 Bacteria 4333
283 Ga0207700_10208594 3300025928 Bacteria 1650
284 Ga0207700_10276364 3300025928 Bacteria 1443
285 Ga0207664_10005643 3300025929 Bacteria 8553
286 Ga0207664_10154193 3300025929 Bacteria 1954
287 Ga0207664_10289316 3300025929 Unclassified 1439
288 Ga0207664_10383206 3300025929 Bacteria 1248
289 Ga0207664_10593551 3300025929 Bacteria 994
290 Ga0207664_10656029 3300025929 Bacteria 943
291 Ga0207690_10009490 3300025932 Bacteria 5780
292 Ga0207690_10027652 3300025932 Bacteria 3586
293 Ga0207690_10042454 3300025932 Unclassified 2987
294 Ga0207690_10103845 3300025932 Bacteria 2035
295 Ga0207690_10126628 3300025932 Bacteria 1863
296 Ga0207690_10258731 3300025932 Bacteria 1348
297 Ga0207690_10330054 3300025932 Bacteria 1201
298 Ga0207690_10597947 3300025932 Bacteria 900
299 Ga0207690_10629372 3300025932 Unclassified 878
300 Ga0207706_10050943 3300025933 Bacteria 3657
301 Ga0207706_10187916 3300025933 Bacteria 1814
302 Ga0207706_10435554 3300025933 Bacteria 1135
303 Ga0207706_11320762 3300025933 Bacteria 595
304 Ga0207686_10378883 3300025934 Bacteria 1072
305 Ga0207669_10759832 3300025937 Unclassified 801
306 Ga0207665_10055310 3300025939 Bacteria 2677
307 Ga0207691_10299378 3300025940 Unclassified 1382
308 Ga0207711_10007866 3300025941 Bacteria 8916
309 Ga0207711_10071871 3300025941 Bacteria 3004
310 Ga0207661_10012188 3300025944 Bacteria 6243
311 Ga0207661_10236008 3300025944 Bacteria 1621
312 Ga0207679_10055927 3300025945 Bacteria 2911
313 Ga0207679_10070638 3300025945 Bacteria 2631
314 Ga0207679_10715351 3300025945 Bacteria 909
315 Ga0207679_10747487 3300025945 Unclassified 889
316 Ga0207667_10088595 3300025949 Bacteria 3200
317 Ga0207667_10288668 3300025949 Bacteria 1676
318 Ga0207667_10344141 3300025949 Bacteria 1521
319 Ga0207667_10461195 3300025949 Bacteria 1291
320 Ga0207667_10718400 3300025949 Bacteria 1000
321 Ga0207651_10068233 3300025960 Bacteria 2506
322 Ga0207651_10169297 3300025960 Bacteria 1721
323 Ga0207651_12056223 3300025960 Unclassified 513
324 Ga0207712_10493733 3300025961 Unclassified 1045
325 Ga0207640_10047745 3300025981 Bacteria 2763
326 Ga0207640_10147465 3300025981 Bacteria 1724
327 Ga0207640_10234116 3300025981 Bacteria 1415
328 Ga0207640_10385710 3300025981 Bacteria 1137
329 Ga0207640_10401756 3300025981 Bacteria 1116
330 Ga0207658_10194560 3300025986 Bacteria 1688
331 Ga0207658_10646691 3300025986 Unclassified 953
332 Ga0207677_11999635 3300026023 Unclassified 539
333 Ga0207703_10352264 3300026035 Unclassified 1356
334 Ga0207639_10000758 3300026041 Bacteria 21974
335 Ga0207639_10036070 3300026041 Bacteria 3662
336 Ga0207639_10750813 3300026041 Unclassified 907
337 Ga0207639_10857008 3300026041 Bacteria 848
338 Ga0207678_10296605 3300026067 Bacteria 1389
339 Ga0207678_10518944 3300026067 Bacteria 1040
340 Ga0207702_10037868 3300026078 Bacteria 4039
341 Ga0207702_10040349 3300026078 Bacteria 3914
342 Ga0207702_10092168 3300026078 Bacteria 2655
343 Ga0207702_10425497 3300026078 Bacteria 1285
344 Ga0207702_10631338 3300026078 Bacteria 1053
345 Ga0207702_11359710 3300026078 Bacteria 704
346 Ga0207702_11501891 3300026078 Bacteria 667
347 Ga0207641_10008764 3300026088 Bacteria 8356
348 Ga0207674_10000139 3300026116 Bacteria 84273
349 Ga0207674_10002906 3300026116 Bacteria 21279
350 Ga0207674_10076919 3300026116 Bacteria 3344
351 Ga0207674_10995790 3300026116 Bacteria 807
352 Ga0207674_11848155 3300026116 Unclassified 571
353 Ga0207698_10002174 3300026142 Bacteria 11585
354 Ga0207698_10005655 3300026142 Bacteria 7741
355 Ga0207698_10081885 3300026142 Bacteria 2607
356 Ga0207698_10102256 3300026142 Bacteria 2378
357 Ga0207698_10131597 3300026142 Bacteria 2139
358 Ga0207698_10566935 3300026142 Bacteria 1115
359 Ga0207698_11502292 3300026142 Unclassified 689
360 Ga0207698_11691591 3300026142 Bacteria 648
361 Ga0207698_12116001 3300026142 Bacteria 576
362 Ga0268266_10313665 3300028379 Bacteria 1466
363 Ga0268265_10032517 3300028380 Bacteria 3782
364 Ga0268265_10096222 3300028380 Unclassified 2379
365 Ga0268264_11528611 3300028381 Unclassified 678
366 Ga0307408_100008336 3300031548 Bacteria 6844
367 Ga0307408_100046027 3300031548 Bacteria 3119
368 Ga0307408_100165830 3300031548 Unclassified 1759
369 Ga0307408_100458167 3300031548 Unclassified 1108
370 Ga0307408_101081063 3300031548 Bacteria 743
371 Ga0307405_10001662 3300031731 Bacteria 9471
372 Ga0307405_10565570 3300031731 Bacteria 922
373 Ga0307413_10002064 3300031824 Bacteria 8023
374 Ga0307413_10079709 3300031824 Bacteria 2094
375 Ga0307413_11078694 3300031824 Bacteria 692
376 Ga0307413_11281018 3300031824 Unclassified 640
377 Ga0307410_10001371 3300031852 Bacteria 10950
378 Ga0307410_10195912 3300031852 Unclassified 1539
379 Ga0307410_10643651 3300031852 Bacteria 888
380 Ga0307406_10007289 3300031901 Bacteria 6125
381 Ga0307406_11033318 3300031901 Bacteria 706
382 Ga0307406_11630342 3300031901 Bacteria 570
383 Ga0307407_10004949 3300031903 Bacteria 5728
384 Ga0307407_10069156 3300031903 Bacteria 2095
385 Ga0307407_10753675 3300031903 Bacteria 737
386 Ga0307412_10014449 3300031911 Bacteria 4657
387 Ga0307412_10146496 3300031911 Unclassified 1736
388 Ga0307412_10587616 3300031911 Unclassified 941
389 Ga0307409_100024517 3300031995 Bacteria 4209
390 Ga0307409_100029115 3300031995 Bacteria 3947
391 Ga0307409_100454071 3300031995 Unclassified 1237
392 Ga0307416_100384697 3300032002 Unclassified 1434
393 Ga0307416_101053863 3300032002 Unclassified 917
394 Ga0307416_101383637 3300032002 Bacteria 809
395 Ga0307416_103138748 3300032002 Bacteria 553
396 Ga0307414_10002497 3300032004 Bacteria 9643
397 Ga0307414_10218181 3300032004 Bacteria 1564
398 Ga0307414_10290772 3300032004 Bacteria 1377
399 Ga0307411_10092196 3300032005 Bacteria 2118
400 Ga0307411_10498907 3300032005 Bacteria 1028
401 Ga0307415_100002401 3300032126 Bacteria 9339
402 Ga0307415_101569818 3300032126 Bacteria 631
403 Ga0373936_0521112 3300035113 Unclassified 554
404 Ga0373943_0724357 3300035170 Unclassified 590
405 Ga0373931_0234155 3300035691 Bacteria 1111
406 Ga0373935_0094015 3300035692 Bacteria 1967
407 Ga0373935_0327891 3300035692 Unclassified 1088
408 Ga0395899_0011734 3300037312 Bacteria 6707
409 Ga0395899_0018998 3300037312 Bacteria 5222
410 Ga0395899_0026734 3300037312 Bacteria 4353
411 Ga0395899_0031356 3300037312 Bacteria 3994
412 Ga0395899_0064206 3300037312 Bacteria 2700
413 Ga0395899_0113038 3300037312 Bacteria 1951
414 Ga0395899_0119489 3300037312 Bacteria 1889
415 Ga0395899_0182404 3300037312 Bacteria 1473
416 Ga0395899_0198690 3300037312 Bacteria 1399
417 Ga0395899_0224018 3300037312 Bacteria 1301
418 Ga0395899_0366700 3300037312 Unclassified 960
419 Ga0395899_0480437 3300037312 Bacteria 809
420 Ga0395899_0808775 3300037312 Unclassified 578
421 Ga0395900_0002685 3300037418 Bacteria 19451
422 Ga0395900_0002834 3300037418 Bacteria 18925
423 Ga0395900_0011916 3300037418 Bacteria 8888
424 Ga0395900_0028490 3300037418 Bacteria 5722
425 Ga0395900_0041090 3300037418 Bacteria 4769
426 Ga0395900_0057657 3300037418 Bacteria 3998
427 Ga0395900_0096122 3300037418 Bacteria 3044
428 Ga0395900_0167107 3300037418 Bacteria 2241
429 Ga0395900_0173774 3300037418 Bacteria 2192
430 Ga0395900_0177721 3300037418 Bacteria 2164
431 Ga0395900_0330856 3300037418 Bacteria 1501
432 Ga0395900_0448860 3300037418 Bacteria 1246
433 Ga0395900_0498502 3300037418 Bacteria 1168
434 Ga0395900_0519600 3300037418 Bacteria 1139
435 Ga0395900_0781960 3300037418 Bacteria 883
436 Ga0395900_0970809 3300037418 Bacteria 770
437 Ga0395900_1003880 3300037418 Bacteria 754
438 Ga0395900_1050690 3300037418 Bacteria 733
439 Ga0395900_1055974 3300037418 Bacteria 731
440 Ga0395900_1536163 3300037418 Bacteria 577
441 Ga0395900_1566129 3300037418 Unclassified 570
442 Ga0395898_0033511 3300037466 Bacteria 5124
443 Ga0395898_0052918 3300037466 Bacteria 3965
444 Ga0395898_0089868 3300037466 Bacteria 2955
445 Ga0395898_0113523 3300037466 Bacteria 2596
446 Ga0395898_0203290 3300037466 Bacteria 1890
447 Ga0395898_0232592 3300037466 Bacteria 1758
448 Ga0395898_0264027 3300037466 Bacteria 1642
449 Ga0395898_0308713 3300037466 Bacteria 1509
450 Ga0395898_0328330 3300037466 Bacteria 1459
451 Ga0395898_0722808 3300037466 Bacteria 937
452 Ga0395898_1031631 3300037466 Unclassified 757
453 Ga0395898_1040578 3300037466 Bacteria 753
454 Ga0395898_1678355 3300037466 Unclassified 558
455 Ga0395898_1716657 3300037466 Bacteria 550
456 Ga0395898_1744948 3300037466 Bacteria 544
457 Ga0395905_0002952 3300037471 Bacteria 18478
458 Ga0395905_0003329 3300037471 Bacteria 17249
459 Ga0395905_0003665 3300037471 Bacteria 16294
460 Ga0395905_0008128 3300037471 Bacteria 10365
461 Ga0395905_0010455 3300037471 Bacteria 9029
462 Ga0395905_0017473 3300037471 Bacteria 6810
463 Ga0395905_0022428 3300037471 Bacteria 5971
464 Ga0395905_0023023 3300037471 Bacteria 5888
465 Ga0395905_0050227 3300037471 Bacteria 3908
466 Ga0395905_0096104 3300037471 Bacteria 2781
467 Ga0395905_0102981 3300037471 Bacteria 2680
468 Ga0395905_0112982 3300037471 Bacteria 2551
469 Ga0395905_0113130 3300037471 Bacteria 2550
470 Ga0395905_0164778 3300037471 Bacteria 2083
471 Ga0395905_0239490 3300037471 Unclassified 1696
472 Ga0395905_0286887 3300037471 Bacteria 1533
473 Ga0395905_0327273 3300037471 Bacteria 1422
474 Ga0395905_0328060 3300037471 Unclassified 1420
475 Ga0395905_0464265 3300037471 Unclassified 1164
476 Ga0395905_0622134 3300037471 Unclassified 982
477 Ga0395905_0630922 3300037471 Unclassified 973
478 Ga0395905_0654566 3300037471 Bacteria 952
479 Ga0395905_0654986 3300037471 Bacteria 952
480 Ga0395905_1050681 3300037471 Unclassified 717
481 Ga0395905_1464720 3300037471 Bacteria 587
482 Ga0395905_1484870 3300037471 Bacteria 582
483 Ga0395901_0000348 3300038443 Bacteria 56412
484 Ga0395901_0004090 3300038443 Bacteria 14701
485 Ga0395901_0004938 3300038443 Bacteria 13460
486 Ga0395901_0007286 3300038443 Bacteria 11165
487 Ga0395901_0068295 3300038443 Bacteria 3702
488 Ga0395901_0069348 3300038443 Bacteria 3672
489 Ga0395901_0081213 3300038443 Bacteria 3386
490 Ga0395901_0144283 3300038443 Bacteria 2502
491 Ga0395901_0225944 3300038443 Bacteria 1955
492 Ga0395901_0261654 3300038443 Bacteria 1800
493 Ga0395901_0307456 3300038443 Bacteria 1642
494 Ga0395901_0311715 3300038443 Bacteria 1629
495 Ga0395901_0340855 3300038443 Bacteria 1549
496 Ga0395901_0341004 3300038443 Bacteria 1548
497 Ga0395901_0363106 3300038443 Bacteria 1493
498 Ga0395901_0370592 3300038443 Bacteria 1475
499 Ga0395901_0427383 3300038443 Bacteria 1357
500 Ga0395901_0522661 3300038443 Bacteria 1205
501 Ga0395901_0757592 3300038443 Unclassified 963
502 Ga0395901_1525467 3300038443 Unclassified 623
503 Ga0395901_2110331 3300038443 Bacteria 508
504 Ga0439448_0178824 3300042005 Unclassified 741
505 Ga0439458_0000387 3300042157 Bacteria 11106
506 Ga0466963_0001150 3300044694 Bacteria 13860
507 Ga0466963_0110172 3300044694 Bacteria 1889
508 Ga0466964_0099054 3300044706 Bacteria 1282
509 Ga0466964_0509059 3300044706 Bacteria 648
510 Ga0466971_0017378 3300044719 Bacteria 3182
511 Ga0466971_0047454 3300044719 Bacteria 1931
512 Ga0466971_0060848 3300044719 Bacteria 1707
513 Ga0466968_0219570 3300044735 Unclassified 895
514 Ga0466970_0433573 3300044765 Bacteria 752
515 Ga0466957_0000334 3300044842 Bacteria 22999
516 Ga0466960_0066620 3300044901 Bacteria 1781
517 Ga0466960_0227319 3300044901 Unclassified 1029
518 Ga0466967_0000114 3300045976 Bacteria 29801
519 Ga0466967_0002819 3300045976 Bacteria 11024
520 Ga0466967_0070968 3300045976 Bacteria 3117
521 Ga0466967_0096370 3300045976 Bacteria 2698
522 Ga0466967_0175250 3300045976 Bacteria 2020
523 Ga0466967_0182637 3300045976 Bacteria 1979
524 Ga0466967_0450507 3300045976 Unclassified 1258
525 Ga0466967_0738137 3300045976 Unclassified 976
526 Ga0466967_1177892 3300045976 Bacteria 763
527 Ga0466967_1240080 3300045976 Unclassified 743
528 Ga0466967_1441374 3300045976 Bacteria 686
529 Ga0466967_2473711 3300045976 Unclassified 514
530 Ga0495643_0225785 3300046522 Bacteria 886
531 Ga0495663_0008785 3300046525 Bacteria 2802
532 Ga0495669_0006082 3300046684 Bacteria 5034
533 Ga0495670_0204978 3300046691 Bacteria 1045
534 Ga0495677_0016938 3300047445 Bacteria 2643
535 Ga0496102_0623327 3300048905 Bacteria 1002
536 Ga0496108_1195357 3300048911 Unclassified 643
537 Ga0496109_0122150 3300048912 Bacteria 2427
538 Ga0496109_0726095 3300048912 Bacteria 931
539 Ga0496110_0431733 3300048913 Unclassified 1201
540 Ga0496111_0803561 3300048914 Bacteria 681
541 Ga0496112_0043631 3300048915 Bacteria 4391
542 Ga0496112_0138196 3300048915 Bacteria 2406
543 Ga0496112_0304182 3300048915 Unclassified 1540
544 Ga0496112_1862025 3300048915 Unclassified 513
545 Ga0496113_0375483 3300048916 Bacteria 1141
546 Ga0501067_0087499 3300049583 Bacteria 1729
547 Ga0501069_0076166 3300049585 Bacteria 1886
548 Ga0501209_039683 3300049656 Bacteria 1240
549 Ga0501247_065327 3300049677 Bacteria 566
550 Ga0501249_008675 3300049679 Bacteria 2110
551 Ga0501225_0363721 3300049705 Bacteria 503
552 Ga0501268_081045 3300049765 Unclassified 670
553 Ga0501272_023153 3300049769 Bacteria 756
554 nmdc:mga00v17_116220_c1 3300050491 Bacteria 1700
555 Ga0587088_076905 3300059508 Bacteria 707
556 Ga0466962_0371868 3300061719 Bacteria 713
557 Ga0395898_1232521
558 JGI24737J22298_10001575
559 JGI24737J22298_10019523
560 JGI24735J21928_10002236
561 JGI24735J21928_10129712
562 JGI24735J21928_10261684
563 Ga0065712_10096574
564 Ga0065712_10113449
565 Ga0065712_10553627
566 Ga0070658_10012752
567 Ga0070658_10189451
568 Ga0070658_10191800
569 Ga0070658_10231347
570 Ga0070658_10337627
571 Ga0070658_10611156
572 Ga0070658_10808745
573 Ga0070658_11053345
574 Ga0070658_11524916
575 Ga0070658_11717340
576 Ga0070676_10117978
577 Ga0070683_100735730
578 Ga0070683_101436331
579 Ga0070670_100191284
580 Ga0070677_10726652
581 Ga0070666_10214401
582 Ga0070666_10840646
583 Ga0070680_100003480
584 Ga0070680_100116386
585 Ga0070680_100648444
586 Ga0070680_101195561
587 Ga0070680_101775185
588 Ga0070660_100008669
589 Ga0070660_100016613
590 Ga0070660_100042768
591 Ga0070660_100075831
592 Ga0070660_100082235
593 Ga0070660_100083787
594 Ga0070660_100115027
595 Ga0070660_100214836
596 Ga0070660_100455536
597 Ga0070660_100666271
598 Ga0070660_101290609
599 Ga0070660_101294533
600 Ga0070691_10094889
601 Ga0070661_100037223
602 Ga0070661_100052842
603 Ga0070661_100059594
604 Ga0070661_100490974
605 Ga0070661_100530941
606 Ga0070661_100860544
607 Ga0070661_100973325
608 Ga0070661_101437723
609 Ga0070669_100899222
610 Ga0070675_100056756
611 Ga0070675_101303950
612 Ga0070671_100030940
613 Ga0070671_101550634
614 Ga0070674_100812453
615 Ga0070673_100043457
616 Ga0070673_100150510
617 Ga0070659_100008998
618 Ga0070659_100013270
619 Ga0070659_100016995
620 Ga0070659_100065911
621 Ga0070659_100222788
622 Ga0070659_100307501
623 Ga0070659_100356817
624 Ga0070667_100222685
625 Ga0070667_100894157
626 Ga0070714_100030736
627 Ga0070714_100034632
628 Ga0070714_100197800
629 Ga0070714_100271787
630 Ga0070714_100339602
631 Ga0070714_100514967
632 Ga0070713_100070609
633 Ga0070663_100208908
634 Ga0070663_102157022
635 Ga0070662_100157398
636 Ga0070662_100222079
637 Ga0070681_10347890
638 Ga0070681_10727363
639 Ga0070681_10847960
640 Ga0070679_100088865
641 Ga0070679_100154753
642 Ga0070679_100244208
643 Ga0070679_100606597
644 Ga0070679_101058690
645 Ga0070684_100003533
646 Ga0068853_100155229
647 Ga0068853_100389701
648 Ga0068853_101398707
649 Ga0070693_100004690
650 Ga0070693_100111465
651 Ga0068855_100036408
652 Ga0068855_100398086
653 Ga0068855_100443594
654 Ga0068855_100579722
655 Ga0068855_100626618
656 Ga0068855_100699806
657 Ga0068855_101329969
658 Ga0068855_102277950
659 Ga0068855_102394227
660 Ga0070664_100002025
661 Ga0070664_100088789
662 Ga0070664_100109554
663 Ga0070664_100202889
664 Ga0068857_100079764
665 Ga0068857_100262626
666 Ga0068857_101176798
667 Ga0068854_100004561
668 Ga0068854_100012831
669 Ga0068854_100087915
670 Ga0068854_100222635
671 Ga0068854_100312542
672 Ga0068854_100907081
673 Ga0068856_100261352
674 Ga0068856_100575828
675 Ga0068856_100949388
676 Ga0068856_101004370
677 Ga0068856_101173269
678 Ga0068852_100001084
679 Ga0068852_100003900
680 Ga0068852_100027787
681 Ga0068852_100044484
682 Ga0068852_100099039
683 Ga0068852_100654007
684 Ga0068852_100890245
685 Ga0068852_101653342
686 Ga0068852_101653535
687 Ga0068859_102773636
688 Ga0068851_10051466
689 Ga0068851_10111486
690 Ga0068851_10257252
691 Ga0068863_100020819
692 Ga0068858_100120929
693 Ga0068858_102421989
694 Ga0068860_100205794
695 Ga0068860_100982525
696 Ga0068862_100016900
697 Ga0068862_100065039
698 Ga0068862_100301632
699 Ga0070717_10377559
700 Ga0075364_10677139
701 Ga0070716_101300764
702 Ga0075362_10095446
703 Ga0097621_100034847
704 Ga0068871_100280730
705 Ga0068871_102262844
706 Ga0097620_101309757
707 Ga0097620_102773003
708 Ga0105240_10106306
709 Ga0105240_10263468
710 Ga0105240_10300580
711 Ga0105240_12527753
712 Ga0111539_10518905
713 Ga0105245_10952697
714 Ga0105241_10108337
715 Ga0105242_10575586
716 Ga0105248_10037901
717 Ga0105248_10058620
718 Ga0105248_10335462
719 Ga0105248_12356045
720 Ga0105237_10042787
721 Ga0105237_10397313
722 Ga0105237_10440897
723 Ga0105238_10011411
724 Ga0105238_10128425
725 Ga0105238_10368997
726 Ga0105238_10652260
727 Ga0105238_10949358
728 Ga0105238_10970306
729 Ga0105249_10839267
730 Ga0105239_10615295
731 Ga0105239_13249474
732 Ga0105246_12077961
733 Ga0157373_10016979
734 Ga0157373_10018070
735 Ga0157373_10079709
736 Ga0157373_10132953
737 Ga0157373_10362927
738 Ga0157373_10522218
739 Ga0157373_11507943
740 Ga0157371_10039815
741 Ga0157371_10055096
742 Ga0157371_10288003
743 Ga0157371_11161730
744 Ga0157371_11400106
745 Ga0157370_10024880
746 Ga0157370_10079937
747 Ga0157370_10108498
748 Ga0157370_10143012
749 Ga0157370_10502832
750 Ga0157370_10551485
751 Ga0157369_10029036
752 Ga0157369_10072724
753 Ga0157369_10134883
754 Ga0157369_10140550
755 Ga0157369_10603489
756 Ga0157369_10623207
757 Ga0157369_11442365
758 Ga0157369_11504434
759 Ga0157369_11795430
760 Ga0157378_10163077
761 Ga0157378_10261010
762 Ga0163162_10122982
763 Ga0163162_11015771
764 Ga0157372_10020397
765 Ga0157372_10126419
766 Ga0157372_10184819
767 Ga0157372_10315804
768 Ga0157372_10901049
769 Ga0157372_10930764
770 Ga0157372_11098953
771 Ga0157372_11161453
772 Ga0157372_11692703
773 Ga0157372_12550530
774 Ga0157375_10164317
775 Ga0163163_10002880
776 Ga0157379_10066732
777 Ga0163161_10494564
778 Ga0206355_1307932
779 Ga0224712_10550460
780 Ga0207697_10066836
781 Ga0207688_10110624
782 Ga0207688_10260858
783 Ga0207680_10009596
784 Ga0207647_10000793
785 Ga0207647_10008797
786 Ga0207647_10030406
787 Ga0207647_10068030
788 Ga0207647_10333370
789 Ga0207699_10444052
790 Ga0207705_10008131
791 Ga0207705_10031389
792 Ga0207705_10109876
793 Ga0207705_10132855
794 Ga0207705_10184986
795 Ga0207705_10417062
796 Ga0207705_10825324
797 Ga0207707_10070780
798 Ga0207707_10085313
799 Ga0207707_10482692
800 Ga0207707_10820532
801 Ga0207695_10029480
802 Ga0207695_10442097
803 Ga0207695_11470940
804 Ga0207671_10033125
805 Ga0207671_10657693
806 Ga0207693_10019195
807 Ga0207660_10009147
808 Ga0207660_10086354
809 Ga0207660_10268305
810 Ga0207660_10819495
811 Ga0207660_11225113
812 Ga0207657_10016509
813 Ga0207657_10029503
814 Ga0207657_10055019
815 Ga0207657_10118370
816 Ga0207657_10140011
817 Ga0207657_10142680
818 Ga0207657_10158669
819 Ga0207657_10164934
820 Ga0207657_10404397
821 Ga0207657_10556147
822 Ga0207657_11330306
823 Ga0207649_10061732
824 Ga0207649_10187145
825 Ga0207649_10196240
826 Ga0207649_10213997
827 Ga0207649_10389964
828 Ga0207652_10123309
829 Ga0207652_10145852
830 Ga0207652_10159014
831 Ga0207652_10243474
832 Ga0207652_10569441
833 Ga0207681_10023793
834 Ga0207681_10447957
835 Ga0207694_10052253
836 Ga0207694_10853193
837 Ga0207650_10055753
838 Ga0207659_10020922
839 Ga0207700_10208594
840 Ga0207700_10276364
841 Ga0207664_10005643
842 Ga0207664_10154193
843 Ga0207664_10289316
844 Ga0207664_10383206
845 Ga0207664_10593551
846 Ga0207664_10656029
847 Ga0207690_10009490
848 Ga0207690_10027652
849 Ga0207690_10042454
850 Ga0207690_10103845
851 Ga0207690_10126628
852 Ga0207690_10258731
853 Ga0207690_10330054
854 Ga0207690_10597947
855 Ga0207690_10629372
856 Ga0207706_10050943
857 Ga0207706_10187916
858 Ga0207706_10435554
859 Ga0207706_11320762
860 Ga0207686_10378883
861 Ga0207669_10759832
862 Ga0207665_10055310
863 Ga0207691_10299378
864 Ga0207711_10007866
865 Ga0207711_10071871
866 Ga0207661_10012188
867 Ga0207661_10236008
868 Ga0207679_10055927
869 Ga0207679_10070638
870 Ga0207679_10715351
871 Ga0207679_10747487
872 Ga0207667_10088595
873 Ga0207667_10288668
874 Ga0207667_10344141
875 Ga0207667_10461195
876 Ga0207667_10718400
877 Ga0207651_10068233
878 Ga0207651_10169297
879 Ga0207651_12056223
880 Ga0207712_10493733
881 Ga0207640_10047745
882 Ga0207640_10147465
883 Ga0207640_10234116
884 Ga0207640_10385710
885 Ga0207640_10401756
886 Ga0207658_10194560
887 Ga0207658_10646691
888 Ga0207677_11999635
889 Ga0207703_10352264
890 Ga0207639_10000758
891 Ga0207639_10036070
892 Ga0207639_10750813
893 Ga0207639_10857008
894 Ga0207678_10296605
895 Ga0207678_10518944
896 Ga0207702_10037868
897 Ga0207702_10040349
898 Ga0207702_10092168
899 Ga0207702_10425497
900 Ga0207702_10631338
901 Ga0207702_11359710
902 Ga0207702_11501891
903 Ga0207641_10008764
904 Ga0207674_10000139
905 Ga0207674_10002906
906 Ga0207674_10076919
907 Ga0207674_10995790
908 Ga0207674_11848155
909 Ga0207698_10002174
910 Ga0207698_10005655
911 Ga0207698_10081885
912 Ga0207698_10102256
913 Ga0207698_10131597
914 Ga0207698_10566935
915 Ga0207698_11502292
916 Ga0207698_11691591
917 Ga0207698_12116001
918 Ga0268266_10313665
919 Ga0268265_10032517
920 Ga0268265_10096222
921 Ga0268264_11528611
922 Ga0307408_100008336
923 Ga0307408_100046027
924 Ga0307408_100165830
925 Ga0307408_100458167
926 Ga0307408_101081063
927 Ga0307405_10001662
928 Ga0307405_10565570
929 Ga0307413_10002064
930 Ga0307413_10079709
931 Ga0307413_11078694
932 Ga0307413_11281018
933 Ga0307410_10001371
934 Ga0307410_10195912
935 Ga0307410_10643651
936 Ga0307406_10007289
937 Ga0307406_11033318
938 Ga0307406_11630342
939 Ga0307407_10004949
940 Ga0307407_10069156
941 Ga0307407_10753675
942 Ga0307412_10014449
943 Ga0307412_10146496
944 Ga0307412_10587616
945 Ga0307409_100024517
946 Ga0307409_100029115
947 Ga0307409_100454071
948 Ga0307416_100384697
949 Ga0307416_101053863
950 Ga0307416_101383637
951 Ga0307416_103138748
952 Ga0307414_10002497
953 Ga0307414_10218181
954 Ga0307414_10290772
955 Ga0307411_10092196
956 Ga0307411_10498907
957 Ga0307415_100002401
958 Ga0307415_101569818
959 Ga0373936_0521112
960 Ga0373943_0724357
961 Ga0373931_0234155
962 Ga0373935_0094015
963 Ga0373935_0327891
964 Ga0395899_0011734
965 Ga0395899_0018998
966 Ga0395899_0026734
967 Ga0395899_0031356
968 Ga0395899_0064206
969 Ga0395899_0113038
970 Ga0395899_0119489
971 Ga0395899_0182404
972 Ga0395899_0198690
973 Ga0395899_0224018
974 Ga0395899_0366700
975 Ga0395899_0480437
976 Ga0395899_0808775
977 Ga0395900_0002685
978 Ga0395900_0002834
979 Ga0395900_0011916
980 Ga0395900_0028490
981 Ga0395900_0041090
982 Ga0395900_0057657
983 Ga0395900_0096122
984 Ga0395900_0167107
985 Ga0395900_0173774
986 Ga0395900_0177721
987 Ga0395900_0330856
988 Ga0395900_0448860
989 Ga0395900_0498502
990 Ga0395900_0519600
991 Ga0395900_0781960
992 Ga0395900_0970809
993 Ga0395900_1003880
994 Ga0395900_1050690
995 Ga0395900_1055974
996 Ga0395900_1536163
997 Ga0395900_1566129
998 Ga0395898_0033511
999 Ga0395898_0052918
1000 Ga0395898_0089868
1001 Ga0395898_0113523
1002 Ga0395898_0203290
1003 Ga0395898_0232592
1004 Ga0395898_0264027
1005 Ga0395898_0308713
1006 Ga0395898_0328330
1007 Ga0395898_0722808
1008 Ga0395898_1031631
1009 Ga0395898_1040578
1010 Ga0395898_1678355
1011 Ga0395898_1716657
1012 Ga0395898_1744948
1013 Ga0395905_0002952
1014 Ga0395905_0003329
1015 Ga0395905_0003665
1016 Ga0395905_0008128
1017 Ga0395905_0010455
1018 Ga0395905_0017473
1019 Ga0395905_0022428
1020 Ga0395905_0023023
1021 Ga0395905_0050227
1022 Ga0395905_0096104
1023 Ga0395905_0102981
1024 Ga0395905_0112982
1025 Ga0395905_0113130
1026 Ga0395905_0164778
1027 Ga0395905_0239490
1028 Ga0395905_0286887
1029 Ga0395905_0327273
1030 Ga0395905_0328060
1031 Ga0395905_0464265
1032 Ga0395905_0622134
1033 Ga0395905_0630922
1034 Ga0395905_0654566
1035 Ga0395905_0654986
1036 Ga0395905_1050681
1037 Ga0395905_1464720
1038 Ga0395905_1484870
1039 Ga0395901_0000348
1040 Ga0395901_0004090
1041 Ga0395901_0004938
1042 Ga0395901_0007286
1043 Ga0395901_0068295
1044 Ga0395901_0069348
1045 Ga0395901_0081213
1046 Ga0395901_0144283
1047 Ga0395901_0225944
1048 Ga0395901_0261654
1049 Ga0395901_0307456
1050 Ga0395901_0311715
1051 Ga0395901_0340855
1052 Ga0395901_0341004
1053 Ga0395901_0363106
1054 Ga0395901_0370592
1055 Ga0395901_0427383
1056 Ga0395901_0522661
1057 Ga0395901_0757592
1058 Ga0395901_1525467
1059 Ga0395901_2110331
1060 Ga0439448_0178824
1061 Ga0439458_0000387
1062 Ga0466963_0001150
1063 Ga0466963_0110172
1064 Ga0466964_0099054
1065 Ga0466964_0509059
1066 Ga0466971_0017378
1067 Ga0466971_0047454
1068 Ga0466971_0060848
1069 Ga0466968_0219570
1070 Ga0466970_0433573
1071 Ga0466957_0000334
1072 Ga0466960_0066620
1073 Ga0466960_0227319
1074 Ga0466967_0000114
1075 Ga0466967_0002819
1076 Ga0466967_0070968
1077 Ga0466967_0096370
1078 Ga0466967_0175250
1079 Ga0466967_0182637
1080 Ga0466967_0450507
1081 Ga0466967_0738137
1082 Ga0466967_1177892
1083 Ga0466967_1240080
1084 Ga0466967_1441374
1085 Ga0466967_2473711
1086 Ga0495643_0225785
1087 Ga0495663_0008785
1088 Ga0495669_0006082
1089 Ga0495670_0204978
1090 Ga0495677_0016938
1091 Ga0496102_0623327
1092 Ga0496108_1195357
1093 Ga0496109_0122150
1094 Ga0496109_0726095
1095 Ga0496110_0431733
1096 Ga0496111_0803561
1097 Ga0496112_0043631
1098 Ga0496112_0138196
1099 Ga0496112_0304182
1100 Ga0496112_1862025
1101 Ga0496113_0375483
1102 Ga0501067_0087499
1103 Ga0501069_0076166
1104 Ga0501209_039683
1105 Ga0501247_065327
1106 Ga0501249_008675
1107 Ga0501225_0363721
1108 Ga0501268_081045
1109 Ga0501272_023153
1110 nmdc:mga00v17_116220_c1
1111 Ga0587088_076905
1112 Ga0466962_0371868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08922

DUF1905

Domain of unknown function (DUF1905)

10

105

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.7536 3 95
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.738 3 95
2d3v-assembly1.cif.gz_A crystal structure of leukocyte ig-like receptor a5 (lilra5/lir9/ilt11) 0.6231 45 74
5trd-assembly1.cif.gz_B structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator 0.6147 2 95
5trd-assembly1.cif.gz_B structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator 0.6044 2 95
ID Description Score Start End Superfamily
af_G5ED24_460_583_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7708 44 61 2.30.29.30
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.7467 3 95 2.40.30.100
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.7313 3 95 2.40.30.100
af_O81778_126_238_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6679 3 89 2.40.330.10
af_Q851V5_317_412_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6471 20 86 2.40.330.10
ID Description Score Start End GO Terms
AF-A0A7H0G2V8-F1-model_v4 deleted 0.9613 1 95
AF-A0A2V8ZR94-F1-model_v4 Antitermination protein NusB 0.9474 44 95
AF-A0A2M7XC13-F1-model_v4 DUF1905 domain-containing protein 0.9468 2 94
AF-A0A845I1N3-F1-model_v4 DUF1905 domain-containing protein 0.9433 3 94
AF-S5UAI7-F1-model_v4 DUF1905 domain-containing protein 0.9376 3 95

Map