F463175

General Info

Members Datasets Scaffolds Average Seq Length
556 268 1112 128

Family's Representative Sequence

Representative Sequence 3300000549|LJQas_1014898|LJQas_10148981
Length 133
Sequence VRIEAWIFGAGVFFFVPVALIYGFLTNWNEWVGVLGILLVAGLSGMIGAYLGFTGKRVGMRPEDRNDAEIHEGAGEQGHFSPWSWWPLVLGLACAAGFLGLAVGVWIVYVAALLAIVALVGWVYEYSRGDHAH

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
23 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
45 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
46 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
66 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
87 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
88 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
89 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
90 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
91 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
92 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
93 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
94 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
95 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
96 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
97 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
98 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
99 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
100 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
101 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
104 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
105 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
106 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
107 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
108 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
109 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
110 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
111 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
112 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
113 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
214 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
215 2643221613 Oerskovia sp. Root22 Isolate Unclassified
216 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
217 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
218 2643221721 Oerskovia sp. Root918 Isolate Unclassified
219 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
220 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
221 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
222 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
223 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
224 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
225 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
226 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
227 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
228 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
229 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
230 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
231 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
232 2808606394 Promicromonospora sp. C35 Isolate Unclassified
233 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
234 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
235 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
236 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
237 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
238 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
239 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
240 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
241 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
242 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
243 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
244 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
245 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
246 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
247 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
248 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
249 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
250 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
251 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
252 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
253 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
254 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
255 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
256 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
257 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
258 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
259 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
260 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
261 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
262 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
263 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
264 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
265 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
266 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
267 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
268 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.27
Metatranscriptomes 6.29
Isolates 10.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 8.63
Rhizosphere 81.65
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1014898 3300000549 Bacteria 912
2 JGI25152J39213_1001995 3300002773 Bacteria 8056
3 JGI25151J46595_10071453 3300003187 Bacteria 1048
4 Ga0007423J48922_100127 3300003285 Bacteria 3442
5 rootH2_10059814 3300003320 Bacteria 1967
6 Ga0006562J51391_1005847 3300003578 Bacteria 4582
7 Ga0006562J51391_1013058 3300003578 Bacteria 1633
8 Ga0055542_1002454 3300003762 Bacteria 6118
9 Ga0065714_10116607 3300005288 Bacteria 1401
10 Ga0065714_10218620 3300005288 Bacteria 847
11 Ga0065714_10457822 3300005288 Bacteria 549
12 Ga0070676_10368556 3300005328 Bacteria 991
13 Ga0070676_11163585 3300005328 Bacteria 585
14 Ga0070683_101314063 3300005329 Bacteria 695
15 Ga0070670_100084605 3300005331 Bacteria 2725
16 Ga0070666_10015643 3300005335 Bacteria 4842
17 Ga0070682_100067065 3300005337 Bacteria 2285
18 Ga0070682_101193275 3300005337 Bacteria 642
19 Ga0070671_100756714 3300005355 Bacteria 845
20 Ga0070674_100079095 3300005356 Bacteria 2345
21 Ga0070673_100232479 3300005364 Bacteria 1600
22 Ga0070667_100352519 3300005367 Bacteria 1333
23 Ga0070678_100305378 3300005456 Bacteria 1353
24 Ga0070678_100988447 3300005456 Bacteria 773
25 Ga0070678_101107300 3300005456 Bacteria 731
26 Ga0070672_100080857 3300005543 Bacteria 2604
27 Ga0075364_10892550 3300006051 Bacteria 605
28 Ga0075432_10001467 3300006058 Bacteria 7693
29 Ga0105251_10013734 3300009011 Bacteria 4514
30 Ga0105244_10006268 3300009036 Bacteria 7745
31 Ga0105244_10006670 3300009036 Bacteria 7431
32 Ga0105244_10206186 3300009036 Bacteria 926
33 Ga0105244_10585297 3300009036 Bacteria 512
34 Ga0105247_11789154 3300009101 Bacteria 511
35 Ga0105243_10051100 3300009148 Bacteria 3268
36 Ga0105242_10915384 3300009176 Bacteria 878
37 Ga0105249_10992341 3300009553 Bacteria 908
38 Ga0105246_10011758 3300011119 Bacteria 5439
39 Ga0105246_10064850 3300011119 Bacteria 2553
40 Ga0105246_10065913 3300011119 Bacteria 2534
41 Ga0105246_10138930 3300011119 Bacteria 1824
42 Ga0105246_10250089 3300011119 Bacteria 1406
43 Ga0105246_10847808 3300011119 Bacteria 815
44 Ga0157373_10040797 3300013100 Bacteria 3321
45 Ga0157371_10011376 3300013102 Bacteria 6863
46 Ga0157371_10468673 3300013102 Bacteria 927
47 Ga0157370_10069787 3300013104 Bacteria 3318
48 Ga0157370_10312484 3300013104 Bacteria 1450
49 Ga0157369_10100449 3300013105 Bacteria 3084
50 Ga0157369_10255486 3300013105 Bacteria 1828
51 Ga0157369_10289172 3300013105 Bacteria 1706
52 Ga0157369_10339595 3300013105 Bacteria 1560
53 Ga0157374_11145699 3300013296 Bacteria 799
54 Ga0163162_10073213 3300013306 Bacteria 3482
55 Ga0163162_10405972 3300013306 Bacteria 1495
56 Ga0163162_13370834 3300013306 Bacteria 510
57 Ga0157372_10299898 3300013307 Bacteria 1869
58 Ga0157375_10119816 3300013308 Bacteria 2740
59 Ga0157375_10523954 3300013308 Bacteria 1348
60 Ga0157375_10631492 3300013308 Bacteria 1228
61 Ga0157375_11274935 3300013308 Bacteria 863
62 Ga0157375_11554901 3300013308 Bacteria 781
63 Ga0163163_10598293 3300014325 Bacteria 1166
64 Ga0163163_12511388 3300014325 Bacteria 573
65 Ga0157377_10258235 3300014745 Bacteria 1132
66 Ga0206352_10169092 3300020078 Bacteria 580
67 Ga0206354_10712429 3300020081 Bacteria 622
68 Ga0224712_10550266 3300022467 Bacteria 561
69 Ga0207425_1054355 3300025245 Bacteria 722
70 Ga0209148_1001520 3300025254 Bacteria 11411
71 Ga0209759_1041233 3300025256 Bacteria 793
72 Ga0209129_1000145 3300025258 Bacteria 115927
73 Ga0209025_1000226 3300025294 Bacteria 132801
74 Ga0209051_1004426 3300025303 Bacteria 8662
75 Ga0209051_1022975 3300025303 Bacteria 2607
76 Ga0207697_10234880 3300025315 Bacteria 810
77 Ga0207655_1002731 3300025728 Bacteria 13783
78 Ga0207655_1003828 3300025728 Bacteria 10974
79 Ga0207655_1008568 3300025728 Bacteria 6473
80 Ga0207688_10323642 3300025901 Bacteria 946
81 Ga0207645_10040949 3300025907 Bacteria 2967
82 Ga0207657_10470197 3300025919 Bacteria 986
83 Ga0207681_10274645 3300025923 Bacteria 1324
84 Ga0207650_10470991 3300025925 Bacteria 1047
85 Ga0207659_10193377 3300025926 Bacteria 1620
86 Ga0207644_10413442 3300025931 Bacteria 1104
87 Ga0207709_10894657 3300025935 Bacteria 721
88 Ga0207669_10960903 3300025937 Bacteria 716
89 Ga0207691_10001644 3300025940 Bacteria 22170
90 Ga0207651_10014494 3300025960 Bacteria 4556
91 Ga0207703_11732707 3300026035 Bacteria 601
92 Ga0207683_10001843 3300026121 Bacteria 18737
93 Ga0207683_10645862 3300026121 Bacteria 980
94 Ga0207698_11078455 3300026142 Bacteria 815
95 Ga0207428_10200950 3300027907 Bacteria 1500
96 Ga0207428_10585827 3300027907 Bacteria 805
97 Ga0311001_1044261 3300029277 Bacteria 523
98 Ga0316180_1173699 3300030736 Bacteria 815
99 Ga0307408_100003351 3300031548 Bacteria 11002
100 Ga0307408_100019385 3300031548 Bacteria 4580
101 Ga0307408_100023680 3300031548 Bacteria 4186
102 Ga0307408_100138493 3300031548 Bacteria 1907
103 Ga0307408_100270527 3300031548 Bacteria 1410
104 Ga0307408_100315885 3300031548 Bacteria 1314
105 Ga0307408_100483637 3300031548 Bacteria 1080
106 Ga0307408_100578790 3300031548 Bacteria 994
107 Ga0307408_100638426 3300031548 Bacteria 950
108 Ga0307408_100720207 3300031548 Bacteria 898
109 Ga0307408_100778462 3300031548 Bacteria 866
110 Ga0307408_100808309 3300031548 Bacteria 851
111 Ga0316575_10000026 3300031665 Bacteria 35925
112 Ga0307405_10010815 3300031731 Bacteria 4749
113 Ga0307405_10055310 3300031731 Bacteria 2483
114 Ga0307405_10068870 3300031731 Bacteria 2266
115 Ga0307405_10138664 3300031731 Bacteria 1692
116 Ga0307405_10178175 3300031731 Bacteria 1523
117 Ga0307405_10283914 3300031731 Bacteria 1247
118 Ga0307405_10297931 3300031731 Bacteria 1222
119 Ga0307405_10360772 3300031731 Bacteria 1124
120 Ga0307405_10460041 3300031731 Bacteria 1011
121 Ga0307405_10532713 3300031731 Bacteria 947
122 Ga0307405_10704377 3300031731 Bacteria 836
123 Ga0307405_11476757 3300031731 Bacteria 596
124 Ga0307405_11914073 3300031731 Bacteria 529
125 Ga0307413_10063046 3300031824 Bacteria 2297
126 Ga0307413_10084255 3300031824 Bacteria 2048
127 Ga0307413_10155463 3300031824 Bacteria 1599
128 Ga0307413_10389577 3300031824 Bacteria 1088
129 Ga0307413_10580831 3300031824 Bacteria 914
130 Ga0307413_10810886 3300031824 Bacteria 787
131 Ga0307413_10857385 3300031824 Bacteria 768
132 Ga0307413_11080909 3300031824 Bacteria 692
133 Ga0307413_11212196 3300031824 Bacteria 657
134 Ga0307413_12047313 3300031824 Bacteria 517
135 Ga0307410_10032477 3300031852 Bacteria 3360
136 Ga0307410_10044206 3300031852 Bacteria 2957
137 Ga0307410_10061380 3300031852 Bacteria 2572
138 Ga0307410_10156070 3300031852 Bacteria 1704
139 Ga0307410_10321659 3300031852 Bacteria 1227
140 Ga0307410_10584628 3300031852 Bacteria 929
141 Ga0307410_10631270 3300031852 Bacteria 897
142 Ga0307410_10705772 3300031852 Bacteria 851
143 Ga0307410_10808029 3300031852 Bacteria 798
144 Ga0307410_11138503 3300031852 Bacteria 678
145 Ga0326468_10025194 3300031889 Bacteria 746
146 Ga0307406_10219123 3300031901 Bacteria 1413
147 Ga0307406_10416704 3300031901 Bacteria 1069
148 Ga0307406_10696511 3300031901 Bacteria 848
149 Ga0307406_11018036 3300031901 Bacteria 711
150 Ga0307406_11449657 3300031901 Bacteria 603
151 Ga0307406_11557045 3300031901 Bacteria 583
152 Ga0307406_11802095 3300031901 Bacteria 544
153 Ga0307406_11933952 3300031901 Bacteria 526
154 Ga0307407_10010103 3300031903 Bacteria 4435
155 Ga0307407_10020142 3300031903 Bacteria 3411
156 Ga0307407_10131168 3300031903 Bacteria 1603
157 Ga0307407_10519382 3300031903 Bacteria 876
158 Ga0307407_10759927 3300031903 Bacteria 735
159 Ga0307407_10888475 3300031903 Bacteria 683
160 Ga0307412_10001540 3300031911 Bacteria 12742
161 Ga0307412_10012730 3300031911 Bacteria 4908
162 Ga0307412_10036555 3300031911 Bacteria 3147
163 Ga0307412_10086284 3300031911 Bacteria 2184
164 Ga0307412_10088935 3300031911 Bacteria 2156
165 Ga0307412_10186331 3300031911 Bacteria 1565
166 Ga0307412_10495177 3300031911 Bacteria 1016
167 Ga0307412_10589812 3300031911 Bacteria 939
168 Ga0307412_10667520 3300031911 Bacteria 888
169 Ga0307412_10669683 3300031911 Bacteria 887
170 Ga0307412_10693198 3300031911 Bacteria 873
171 Ga0307412_11045770 3300031911 Bacteria 724
172 Ga0307412_11283607 3300031911 Bacteria 658
173 Ga0307409_100032999 3300031995 Bacteria 3761
174 Ga0307409_100111992 3300031995 Bacteria 2290
175 Ga0307409_100164258 3300031995 Bacteria 1946
176 Ga0307409_100290569 3300031995 Bacteria 1516
177 Ga0307409_100346330 3300031995 Bacteria 1400
178 Ga0307409_101258039 3300031995 Bacteria 764
179 Ga0307409_101288927 3300031995 Bacteria 755
180 Ga0307409_101493013 3300031995 Bacteria 703
181 Ga0307409_102025239 3300031995 Bacteria 605
182 Ga0307416_100003994 3300032002 Bacteria 8795
183 Ga0307416_100019241 3300032002 Bacteria 4836
184 Ga0307416_100028735 3300032002 Bacteria 4141
185 Ga0307416_100033549 3300032002 Bacteria 3893
186 Ga0307416_100048443 3300032002 Bacteria 3371
187 Ga0307416_100065662 3300032002 Bacteria 2983
188 Ga0307416_100068977 3300032002 Bacteria 2924
189 Ga0307416_100102413 3300032002 Bacteria 2496
190 Ga0307416_100121916 3300032002 Bacteria 2325
191 Ga0307416_100198587 3300032002 Bacteria 1900
192 Ga0307416_100317124 3300032002 Bacteria 1559
193 Ga0307416_100351169 3300032002 Bacteria 1492
194 Ga0307416_100423984 3300032002 Bacteria 1375
195 Ga0307416_100497449 3300032002 Bacteria 1283
196 Ga0307416_100657711 3300032002 Bacteria 1133
197 Ga0307416_100774563 3300032002 Bacteria 1053
198 Ga0307416_100795008 3300032002 Bacteria 1041
199 Ga0307416_101433890 3300032002 Bacteria 796
200 Ga0307416_101551712 3300032002 Bacteria 768
201 Ga0307416_101587868 3300032002 Bacteria 759
202 Ga0307416_101703294 3300032002 Bacteria 735
203 Ga0307416_102566956 3300032002 Bacteria 607
204 Ga0307416_103575626 3300032002 Bacteria 520
205 Ga0307414_10218206 3300032004 Bacteria 1564
206 Ga0307414_10283729 3300032004 Bacteria 1393
207 Ga0307414_10453975 3300032004 Bacteria 1125
208 Ga0307414_10959800 3300032004 Bacteria 786
209 Ga0307414_11095976 3300032004 Bacteria 735
210 Ga0307414_11107224 3300032004 Bacteria 731
211 Ga0307414_11119176 3300032004 Bacteria 727
212 Ga0307411_10701149 3300032005 Bacteria 882
213 Ga0307411_10785070 3300032005 Bacteria 837
214 Ga0307411_11907879 3300032005 Bacteria 553
215 Ga0307415_100027174 3300032126 Bacteria 3622
216 Ga0307415_100582919 3300032126 Bacteria 992
217 Ga0307415_100656783 3300032126 Bacteria 941
218 Ga0307415_100664561 3300032126 Bacteria 936
219 Ga0307415_100962972 3300032126 Bacteria 791
220 Ga0395899_0001107 3300037312 Bacteria 24142
221 Ga0395899_0002998 3300037312 Bacteria 13488
222 Ga0395899_0032996 3300037312 Bacteria 3890
223 Ga0395899_0279395 3300037312 Bacteria 1136
224 Ga0395899_0319640 3300037312 Bacteria 1046
225 Ga0395899_0448312 3300037312 Bacteria 845
226 Ga0395899_0833416 3300037312 Bacteria 567
227 Ga0395900_0016391 3300037418 Bacteria 7555
228 Ga0395900_0035847 3300037418 Bacteria 5111
229 Ga0395900_0491861 3300037418 Bacteria 1178
230 Ga0395900_0721063 3300037418 Bacteria 929
231 Ga0395900_0934304 3300037418 Bacteria 789
232 Ga0395900_1866424 3300037418 Bacteria 511
233 Ga0395898_0003096 3300037466 Bacteria 18824
234 Ga0395898_0006945 3300037466 Bacteria 12033
235 Ga0395898_0011179 3300037466 Bacteria 9347
236 Ga0395898_0020498 3300037466 Bacteria 6715
237 Ga0395898_0023550 3300037466 Bacteria 6220
238 Ga0395898_0035883 3300037466 Bacteria 4927
239 Ga0395898_0068967 3300037466 Bacteria 3422
240 Ga0395898_0126233 3300037466 Bacteria 2451
241 Ga0395898_0126511 3300037466 Bacteria 2448
242 Ga0395898_0153781 3300037466 Bacteria 2201
243 Ga0395898_0484262 3300037466 Bacteria 1177
244 Ga0395898_0677240 3300037466 Bacteria 973
245 Ga0395905_0003579 3300037471 Bacteria 16536
246 Ga0395905_0042422 3300037471 Bacteria 4270
247 Ga0395905_1543266 3300037471 Bacteria 569
248 Ga0395901_0002858 3300038443 Bacteria 17440
249 Ga0395901_0011972 3300038443 Bacteria 8798
250 Ga0395901_0013367 3300038443 Bacteria 8341
251 Ga0395901_0017916 3300038443 Bacteria 7228
252 Ga0395901_0062489 3300038443 Bacteria 3875
253 Ga0395901_0091203 3300038443 Bacteria 3189
254 Ga0395901_0147424 3300038443 Bacteria 2473
255 Ga0395901_0389863 3300038443 Bacteria 1432
256 Ga0395901_0419183 3300038443 Bacteria 1373
257 Ga0395901_0521965 3300038443 Bacteria 1206
258 Ga0395901_0813883 3300038443 Bacteria 922
259 Ga0395901_0907967 3300038443 Bacteria 862
260 Ga0395901_0925849 3300038443 Bacteria 852
261 Ga0439436_0007822 3300041404 Bacteria 3286
262 Ga0439436_0011100 3300041404 Bacteria 2738
263 Ga0439436_0176867 3300041404 Bacteria 606
264 Ga0439438_015683 3300041405 Bacteria 2221
265 Ga0439438_062850 3300041405 Bacteria 928
266 Ga0439438_067954 3300041405 Bacteria 885
267 Ga0439438_070512 3300041405 Bacteria 865
268 Ga0439439_0007743 3300041406 Bacteria 2519
269 Ga0439439_0041930 3300041406 Bacteria 1188
270 Ga0439447_140872 3300041407 Bacteria 554
271 Ga0439461_0015713 3300041410 Bacteria 1453
272 Ga0439461_0070026 3300041410 Bacteria 811
273 Ga0439466_0071118 3300041411 Bacteria 1107
274 Ga0439466_0193949 3300041411 Bacteria 618
275 Ga0439465_0131978 3300041413 Bacteria 882
276 Ga0451797_0290601 3300041453 Bacteria 960
277 Ga0451797_1049728 3300041453 Bacteria 1003
278 Ga0451797_1112820 3300041453 Bacteria 617
279 Ga0451802_0250628 3300041460 Bacteria 1017
280 Ga0451802_1370008 3300041460 Bacteria 1167
281 Ga0451807_1614612 3300041486 Bacteria 1198
282 Ga0451807_1916018 3300041486 Bacteria 705
283 Ga0451807_2614767 3300041486 Bacteria 648
284 Ga0451833_1390745 3300041491 Bacteria 730
285 Ga0451849_1475537 3300041505 Bacteria 681
286 Ga0451843_0388081 3300041509 Bacteria 741
287 Ga0439433_0000154 3300041999 Bacteria 10583
288 Ga0439433_0049944 3300041999 Bacteria 985
289 Ga0439433_0146761 3300041999 Bacteria 605
290 Ga0439433_0195185 3300041999 Bacteria 533
291 Ga0439442_000130 3300042002 Bacteria 18800
292 Ga0439442_003402 3300042002 Bacteria 3144
293 Ga0439442_009933 3300042002 Bacteria 1926
294 Ga0439442_044699 3300042002 Bacteria 933
295 Ga0439442_083857 3300042002 Unclassified 683
296 Ga0439442_084703 3300042002 Bacteria 680
297 Ga0439432_150216 3300042006 Bacteria 684
298 Ga0439449_0003386 3300042007 Bacteria 6214
299 Ga0439449_0006049 3300042007 Bacteria 4624
300 Ga0439449_0022988 3300042007 Bacteria 2333
301 Ga0439449_0060839 3300042007 Bacteria 1393
302 Ga0439449_0078460 3300042007 Bacteria 1218
303 Ga0439449_0238214 3300042007 Bacteria 683
304 Ga0439452_059385 3300042010 Bacteria 859
305 Ga0439457_000446 3300042014 Bacteria 11897
306 Ga0439457_007756 3300042014 Bacteria 2565
307 Ga0439457_010726 3300042014 Bacteria 2099
308 Ga0439462_0033534 3300042015 Bacteria 1361
309 Ga0439462_0053286 3300042015 Bacteria 1089
310 Ga0439462_0084211 3300042015 Bacteria 870
311 Ga0439462_0148158 3300042015 Bacteria 659
312 Ga0450919_001040 3300042121 Bacteria 3594
313 Ga0450920_000327 3300042122 Bacteria 7244
314 Ga0450920_001970 3300042122 Bacteria 3464
315 Ga0450920_105085 3300042122 Bacteria 588
316 Ga0450907_000109 3300042146 Bacteria 31147
317 Ga0450907_014433 3300042146 Bacteria 1319
318 Ga0450907_015744 3300042146 Bacteria 1261
319 Ga0450910_058599 3300042147 Bacteria 647
320 Ga0450908_026639 3300042184 Bacteria 1008
321 Ga0450908_033785 3300042184 Bacteria 887
322 Ga0450909_000102 3300042185 Bacteria 8403
323 Ga0439434_0000078 3300042435 Bacteria 24583
324 Ga0439434_0006126 3300042435 Bacteria 3506
325 Ga0439434_0109986 3300042435 Bacteria 892
326 Ga0439434_0367196 3300042435 Bacteria 504
327 Ga0450918_001215 3300042531 Bacteria 5236
328 Ga0450918_021489 3300042531 Bacteria 1127
329 Ga0466972_0094423 3300044658 Bacteria 1417
330 Ga0466965_0159445 3300044683 Bacteria 1182
331 Ga0466966_0226520 3300044684 Bacteria 1128
332 Ga0466966_0226987 3300044684 Bacteria 1127
333 Ga0466961_0126338 3300044693 Bacteria 1604
334 Ga0466961_0216852 3300044693 Bacteria 1180
335 Ga0466970_0456572 3300044765 Bacteria 733
336 Ga0466958_0979308 3300045836 Bacteria 552
337 Ga0466967_0209838 3300045976 Bacteria 1847
338 Ga0495629_0334196 3300046459 Bacteria 1035
339 Ga0495653_0003711 3300046463 Bacteria 12347
340 Ga0495580_0248027 3300046472 Bacteria 1219
341 Ga0495580_0440934 3300046472 Bacteria 874
342 Ga0495582_0024138 3300046473 Bacteria 3325
343 Ga0495582_0509534 3300046473 Bacteria 696
344 Ga0495639_0033859 3300046475 Bacteria 2283
345 Ga0495639_0061009 3300046475 Bacteria 1729
346 Ga0495662_0022007 3300046476 Bacteria 3080
347 Ga0495664_0034017 3300046477 Bacteria 2996
348 Ga0495594_0692484 3300046499 Bacteria 576
349 Ga0495594_0819550 3300046499 Bacteria 524
350 Ga0495630_0167152 3300046517 Bacteria 1675
351 Ga0495643_0210334 3300046522 Bacteria 929
352 Ga0495665_0000442 3300046531 Bacteria 20962
353 Ga0495586_0001309 3300046535 Bacteria 13842
354 Ga0495586_0002380 3300046535 Bacteria 10204
355 Ga0495587_0004388 3300046536 Bacteria 9302
356 Ga0495598_0049218 3300046537 Bacteria 1263
357 Ga0495645_0000314 3300046543 Bacteria 34802
358 Ga0495622_0151905 3300046557 Bacteria 1048
359 Ga0495633_0103727 3300046558 Bacteria 1319
360 Ga0495667_0000209 3300046559 Bacteria 39226
361 Ga0495656_0029956 3300046615 Bacteria 2195
362 Ga0495668_0242142 3300046616 Bacteria 987
363 Ga0495668_0280565 3300046616 Bacteria 913
364 Ga0495668_0337708 3300046616 Bacteria 827
365 Ga0495668_0817482 3300046616 Bacteria 516
366 Ga0495635_0295069 3300046663 Bacteria 1087
367 Ga0495659_0025421 3300046664 Bacteria 2027
368 Ga0495588_0008840 3300046674 Bacteria 4632
369 Ga0495588_0038820 3300046674 Bacteria 2423
370 Ga0495588_0071011 3300046674 Bacteria 1810
371 Ga0495588_0083426 3300046674 Bacteria 1669
372 Ga0495588_0689833 3300046674 Bacteria 534
373 Ga0495599_0176902 3300046678 Bacteria 1316
374 Ga0495623_0010866 3300046679 Bacteria 5894
375 Ga0495670_0036656 3300046691 Bacteria 2443
376 Ga0495670_0653598 3300046691 Bacteria 573
377 Ga0495600_0055986 3300046809 Bacteria 2575
378 Ga0495581_0007490 3300047315 Bacteria 6312
379 Ga0495581_0013426 3300047315 Bacteria 4750
380 Ga0495581_0127792 3300047315 Bacteria 1480
381 Ga0495604_0663082 3300047317 Bacteria 665
382 Ga0495636_0396949 3300047318 Bacteria 656
383 Ga0495677_0035285 3300047445 Bacteria 1825
384 Ga0495681_0196520 3300047470 Bacteria 820
385 Ga0495684_0365321 3300047471 Bacteria 1021
386 Ga0496100_0119753 3300048903 Bacteria 1839
387 Ga0496100_1293074 3300048903 Bacteria 575
388 Ga0496101_0140290 3300048904 Bacteria 1841
389 Ga0496102_0015348 3300048905 Bacteria 6671
390 Ga0496102_0122412 3300048905 Bacteria 2430
391 Ga0496102_0204264 3300048905 Bacteria 1862
392 Ga0496102_0213347 3300048905 Bacteria 1820
393 Ga0496102_0361549 3300048905 Bacteria 1366
394 Ga0496103_0033204 3300048906 Bacteria 3152
395 Ga0496103_0185150 3300048906 Bacteria 1338
396 Ga0496103_0210390 3300048906 Bacteria 1251
397 Ga0496103_0313332 3300048906 Bacteria 1009
398 Ga0496103_0491660 3300048906 Bacteria 785
399 Ga0496105_0229523 3300048908 Bacteria 1509
400 Ga0496106_0034324 3300048909 Bacteria 3788
401 Ga0496107_0041883 3300048910 Bacteria 3289
402 Ga0496107_0110996 3300048910 Bacteria 2015
403 Ga0496107_0510376 3300048910 Bacteria 891
404 Ga0496108_1555752 3300048911 Bacteria 548
405 Ga0496109_0354717 3300048912 Bacteria 1385
406 Ga0496109_1889776 3300048912 Bacteria 529
407 Ga0496109_1987564 3300048912 Bacteria 513
408 Ga0496110_0121711 3300048913 Bacteria 2351
409 Ga0496110_0189344 3300048913 Bacteria 1868
410 Ga0496110_0936750 3300048913 Bacteria 773
411 Ga0496111_0031101 3300048914 Bacteria 3800
412 Ga0496111_0223895 3300048914 Bacteria 1397
413 Ga0496111_0264675 3300048914 Bacteria 1275
414 Ga0496111_0318481 3300048914 Bacteria 1152
415 Ga0496111_0522669 3300048914 Bacteria 872
416 Ga0496112_0026535 3300048915 Bacteria 5575
417 Ga0496112_1002498 3300048915 Bacteria 755
418 Ga0496113_0291401 3300048916 Bacteria 1306
419 Ga0496113_0494878 3300048916 Bacteria 982
420 Ga0496113_0553085 3300048916 Bacteria 923
421 Ga0496113_0746273 3300048916 Bacteria 779
422 Ga0496114_0173233 3300048917 Bacteria 1882
423 Ga0496114_0587372 3300048917 Bacteria 983
424 Ga0496114_0702693 3300048917 Bacteria 886
425 Ga0496115_0599216 3300048918 Bacteria 876
426 Ga0496118_0011045 3300048921 Bacteria 8865
427 Ga0496119_0104590 3300048922 Bacteria 1583
428 Ga0496120_0250542 3300048923 Bacteria 831
429 Ga0496121_0571796 3300048924 Bacteria 703
430 Ga0496122_0003238 3300048925 Bacteria 21623
431 Ga0496124_0948286 3300048927 Bacteria 517
432 Ga0496125_0000094 3300048928 Bacteria 208341
433 Ga0496125_0011077 3300048928 Bacteria 9047
434 Ga0496126_0017543 3300048929 Bacteria 7130
435 Ga0496126_0128160 3300048929 Bacteria 2195
436 Ga0501306_049393 3300049127 Bacteria 671
437 Ga0501309_006184 3300049129 Bacteria 1453
438 Ga0501305_002101 3300049161 Bacteria 2096
439 Ga0501305_006601 3300049161 Bacteria 1445
440 Ga0501307_018888 3300049162 Bacteria 880
441 Ga0501307_085274 3300049162 Bacteria 521
442 Ga0501312_000495 3300049528 Bacteria 3208
443 Ga0501312_026502 3300049528 Bacteria 889
444 Ga0501316_002940 3300049532 Bacteria 1619
445 Ga0501316_008079 3300049532 Bacteria 1156
446 Ga0501316_047057 3300049532 Bacteria 613
447 Ga0501316_054203 3300049532 Bacteria 583
448 Ga0501317_030125 3300049533 Bacteria 783
449 Ga0501318_008778 3300049534 Bacteria 1088
450 Ga0501318_009370 3300049534 Bacteria 1067
451 Ga0501318_011643 3300049534 Bacteria 997
452 Ga0501320_008267 3300049536 Bacteria 1020
453 Ga0501321_000940 3300049537 Bacteria 2130
454 Ga0501321_018176 3300049537 Bacteria 851
455 Ga0501321_020527 3300049537 Bacteria 818
456 Ga0501321_024278 3300049537 Bacteria 775
457 Ga0501323_004732 3300049539 Bacteria 1455
458 Ga0501324_006854 3300049540 Bacteria 970
459 Ga0501325_006345 3300049541 Bacteria 970
460 Ga0501325_019074 3300049541 Bacteria 708
461 Ga0501330_013736 3300049546 Bacteria 603
462 Ga0501340_001043 3300049556 Bacteria 1420
463 Ga0501031_0102404 3300049568 Bacteria 1868
464 Ga0501032_0005923 3300049569 Bacteria 9031
465 Ga0501032_0027063 3300049569 Bacteria 3942
466 Ga0501032_0065760 3300049569 Bacteria 2424
467 Ga0501033_0804561 3300049570 Bacteria 635
468 Ga0501034_0000016 3300049571 Bacteria 289751
469 Ga0501034_0015321 3300049571 Bacteria 7880
470 Ga0501034_0600239 3300049571 Bacteria 1006
471 Ga0501034_0601128 3300049571 Bacteria 1005
472 Ga0501036_0087862 3300049572 Bacteria 2627
473 Ga0501036_0702539 3300049572 Bacteria 835
474 Ga0501036_0749702 3300049572 Bacteria 805
475 Ga0501037_0009849 3300049573 Bacteria 7014
476 Ga0501038_0000454 3300049574 Bacteria 35793
477 Ga0501038_0290708 3300049574 Bacteria 1284
478 Ga0501039_0036983 3300049575 Bacteria 3767
479 Ga0501043_0048702 3300049579 Bacteria 3331
480 Ga0501043_0130597 3300049579 Bacteria 1968
481 Ga0501043_0438186 3300049579 Bacteria 983
482 Ga0501043_1046705 3300049579 Bacteria 579
483 Ga0501046_0045288 3300049580 Bacteria 3496
484 Ga0501047_0002218 3300049581 Bacteria 18603
485 Ga0501047_0087547 3300049581 Bacteria 2992
486 Ga0501047_0663936 3300049581 Bacteria 861
487 Ga0501048_0093537 3300049582 Bacteria 2120
488 Ga0501080_1573378 3300049742 Bacteria 557
489 Ga0501083_0010826 3300049744 Bacteria 6415
490 Ga0501279_047428 3300049775 Bacteria 674
491 Ga0501035_0021800 3300049822 Bacteria 5887
492 Ga0501044_0001597 3300049823 Bacteria 26511
493 Ga0501044_0022032 3300049823 Bacteria 6794
494 Ga0501044_0105230 3300049823 Bacteria 2835
495 nmdc:mga00v17_814838_c1 3300050491 Bacteria 594
496 Ga0495655_0008834 3300053083 Bacteria 1930
497 Ga0501084_0927041 3300054114 Bacteria 732
498 Ga0587090_021170 3300059510 Bacteria 1018
499 2537898159 2537561592 Bacteria 4348607
500 2555229875 2554235227 Bacteria 3637389
501 2644083151 2643221613 Bacteria 4622396
502 2644503589 2643221690 Bacteria 4654705
503 2644525869 2643221694 Bacteria 4392972
504 2644666166 2643221721 Bacteria 4486924
505 2644669928 2643221722 Bacteria 4247614
506 2691513957 2690315906 Bacteria 4517044
507 2738697365 2738541272 Bacteria 6848551
508 2739326742 2738543027 Bacteria 6409078
509 2739606066 2739367654 Bacteria 6049412
510 2760307107 2758568522 Bacteria 5953541
511 2760624429 2758568621 Bacteria 5967089
512 2775656831 2775506735 Bacteria 4556596
513 2808831214 2808606357 Bacteria 4466944
514 2808852488 2808606360 Bacteria 4404006
515 2808879226 2808606366 Bacteria 4415912
516 2808891357 2808606370 Bacteria 4942454
517 2808896531 2808606371 Bacteria 4251511
518 2809029298 2808606394 Bacteria 6248540
519 2810363798 2808606700 Bacteria 3482157
520 2812321092 2811994871 Bacteria 4497550
521 2835191756 2835188231 Bacteria 3476928
522 2839987162 2839986021 Bacteria 3685650
523 2844852805 2844849076 Bacteria 4091819
524 2857742025 2857740372 Bacteria 4782044
525 2884995726 2884994152 Bacteria 4492978
526 2904498140 2904497146 Bacteria 4731781
527 2904777497 2904776348 Bacteria 4658726
528 2905927132 2905926851 Bacteria 4423176
529 2910810121 2910809715 Bacteria 4982797
530 2919034869 2919034639 Bacteria 4763403
531 2919051354 2919051321 Bacteria 4210889
532 2919062173 2919059106 Bacteria 4991624
533 2919393717 2919391150 Bacteria 4884741
534 2919540333 2919538618 Bacteria 4677069
535 2932428161 2932426870 Bacteria 4547726
536 2933421314 2933418574 Bacteria 4476724
537 2935894619 2935890801 Bacteria 4593001
538 2939601206 2939598168 Bacteria 4687164
539 2939648585 2939647034 Bacteria 4681660
540 2939675373 2939674588 Bacteria 4844420
541 2945918837 2945916053 Bacteria 4555517
542 2945920796 2945920336 Bacteria 4501603
543 2945942990 2945941187 Bacteria 4682474
544 2945958692 2945956166 Bacteria 5110334
545 2945959252 2945956166 Bacteria 5110334
546 2946004703 2946003308 Bacteria 3857229
547 2946025695 2946024296 Bacteria 3508095
548 2946038884 2946037020 Bacteria 4900426
549 2946062528 2946059875 Bacteria 4386623
550 2946062702 2946059875 Bacteria 4386623
551 2954000328 2953998280 Bacteria 4812144
552 2974306836 2974302888 Bacteria 4369871
553 8004024816 8004021418 Bacteria 4313954
554 8004028598 8004025490 Bacteria 4327753
555 8054107767 8054107350 Bacteria 5022511
556 8056583709 8056579771 Bacteria 5840325
557 LJQas_1014898
558 JGI25152J39213_1001995
559 JGI25151J46595_10071453
560 Ga0007423J48922_100127
561 rootH2_10059814
562 Ga0006562J51391_1005847
563 Ga0006562J51391_1013058
564 Ga0055542_1002454
565 Ga0065714_10116607
566 Ga0065714_10218620
567 Ga0065714_10457822
568 Ga0070676_10368556
569 Ga0070676_11163585
570 Ga0070683_101314063
571 Ga0070670_100084605
572 Ga0070666_10015643
573 Ga0070682_100067065
574 Ga0070682_101193275
575 Ga0070671_100756714
576 Ga0070674_100079095
577 Ga0070673_100232479
578 Ga0070667_100352519
579 Ga0070678_100305378
580 Ga0070678_100988447
581 Ga0070678_101107300
582 Ga0070672_100080857
583 Ga0075364_10892550
584 Ga0075432_10001467
585 Ga0105251_10013734
586 Ga0105244_10006268
587 Ga0105244_10006670
588 Ga0105244_10206186
589 Ga0105244_10585297
590 Ga0105247_11789154
591 Ga0105243_10051100
592 Ga0105242_10915384
593 Ga0105249_10992341
594 Ga0105246_10011758
595 Ga0105246_10064850
596 Ga0105246_10065913
597 Ga0105246_10138930
598 Ga0105246_10250089
599 Ga0105246_10847808
600 Ga0157373_10040797
601 Ga0157371_10011376
602 Ga0157371_10468673
603 Ga0157370_10069787
604 Ga0157370_10312484
605 Ga0157369_10100449
606 Ga0157369_10255486
607 Ga0157369_10289172
608 Ga0157369_10339595
609 Ga0157374_11145699
610 Ga0163162_10073213
611 Ga0163162_10405972
612 Ga0163162_13370834
613 Ga0157372_10299898
614 Ga0157375_10119816
615 Ga0157375_10523954
616 Ga0157375_10631492
617 Ga0157375_11274935
618 Ga0157375_11554901
619 Ga0163163_10598293
620 Ga0163163_12511388
621 Ga0157377_10258235
622 Ga0206352_10169092
623 Ga0206354_10712429
624 Ga0224712_10550266
625 Ga0207425_1054355
626 Ga0209148_1001520
627 Ga0209759_1041233
628 Ga0209129_1000145
629 Ga0209025_1000226
630 Ga0209051_1004426
631 Ga0209051_1022975
632 Ga0207697_10234880
633 Ga0207655_1002731
634 Ga0207655_1003828
635 Ga0207655_1008568
636 Ga0207688_10323642
637 Ga0207645_10040949
638 Ga0207657_10470197
639 Ga0207681_10274645
640 Ga0207650_10470991
641 Ga0207659_10193377
642 Ga0207644_10413442
643 Ga0207709_10894657
644 Ga0207669_10960903
645 Ga0207691_10001644
646 Ga0207651_10014494
647 Ga0207703_11732707
648 Ga0207683_10001843
649 Ga0207683_10645862
650 Ga0207698_11078455
651 Ga0207428_10200950
652 Ga0207428_10585827
653 Ga0311001_1044261
654 Ga0316180_1173699
655 Ga0307408_100003351
656 Ga0307408_100019385
657 Ga0307408_100023680
658 Ga0307408_100138493
659 Ga0307408_100270527
660 Ga0307408_100315885
661 Ga0307408_100483637
662 Ga0307408_100578790
663 Ga0307408_100638426
664 Ga0307408_100720207
665 Ga0307408_100778462
666 Ga0307408_100808309
667 Ga0316575_10000026
668 Ga0307405_10010815
669 Ga0307405_10055310
670 Ga0307405_10068870
671 Ga0307405_10138664
672 Ga0307405_10178175
673 Ga0307405_10283914
674 Ga0307405_10297931
675 Ga0307405_10360772
676 Ga0307405_10460041
677 Ga0307405_10532713
678 Ga0307405_10704377
679 Ga0307405_11476757
680 Ga0307405_11914073
681 Ga0307413_10063046
682 Ga0307413_10084255
683 Ga0307413_10155463
684 Ga0307413_10389577
685 Ga0307413_10580831
686 Ga0307413_10810886
687 Ga0307413_10857385
688 Ga0307413_11080909
689 Ga0307413_11212196
690 Ga0307413_12047313
691 Ga0307410_10032477
692 Ga0307410_10044206
693 Ga0307410_10061380
694 Ga0307410_10156070
695 Ga0307410_10321659
696 Ga0307410_10584628
697 Ga0307410_10631270
698 Ga0307410_10705772
699 Ga0307410_10808029
700 Ga0307410_11138503
701 Ga0326468_10025194
702 Ga0307406_10219123
703 Ga0307406_10416704
704 Ga0307406_10696511
705 Ga0307406_11018036
706 Ga0307406_11449657
707 Ga0307406_11557045
708 Ga0307406_11802095
709 Ga0307406_11933952
710 Ga0307407_10010103
711 Ga0307407_10020142
712 Ga0307407_10131168
713 Ga0307407_10519382
714 Ga0307407_10759927
715 Ga0307407_10888475
716 Ga0307412_10001540
717 Ga0307412_10012730
718 Ga0307412_10036555
719 Ga0307412_10086284
720 Ga0307412_10088935
721 Ga0307412_10186331
722 Ga0307412_10495177
723 Ga0307412_10589812
724 Ga0307412_10667520
725 Ga0307412_10669683
726 Ga0307412_10693198
727 Ga0307412_11045770
728 Ga0307412_11283607
729 Ga0307409_100032999
730 Ga0307409_100111992
731 Ga0307409_100164258
732 Ga0307409_100290569
733 Ga0307409_100346330
734 Ga0307409_101258039
735 Ga0307409_101288927
736 Ga0307409_101493013
737 Ga0307409_102025239
738 Ga0307416_100003994
739 Ga0307416_100019241
740 Ga0307416_100028735
741 Ga0307416_100033549
742 Ga0307416_100048443
743 Ga0307416_100065662
744 Ga0307416_100068977
745 Ga0307416_100102413
746 Ga0307416_100121916
747 Ga0307416_100198587
748 Ga0307416_100317124
749 Ga0307416_100351169
750 Ga0307416_100423984
751 Ga0307416_100497449
752 Ga0307416_100657711
753 Ga0307416_100774563
754 Ga0307416_100795008
755 Ga0307416_101433890
756 Ga0307416_101551712
757 Ga0307416_101587868
758 Ga0307416_101703294
759 Ga0307416_102566956
760 Ga0307416_103575626
761 Ga0307414_10218206
762 Ga0307414_10283729
763 Ga0307414_10453975
764 Ga0307414_10959800
765 Ga0307414_11095976
766 Ga0307414_11107224
767 Ga0307414_11119176
768 Ga0307411_10701149
769 Ga0307411_10785070
770 Ga0307411_11907879
771 Ga0307415_100027174
772 Ga0307415_100582919
773 Ga0307415_100656783
774 Ga0307415_100664561
775 Ga0307415_100962972
776 Ga0395899_0001107
777 Ga0395899_0002998
778 Ga0395899_0032996
779 Ga0395899_0279395
780 Ga0395899_0319640
781 Ga0395899_0448312
782 Ga0395899_0833416
783 Ga0395900_0016391
784 Ga0395900_0035847
785 Ga0395900_0491861
786 Ga0395900_0721063
787 Ga0395900_0934304
788 Ga0395900_1866424
789 Ga0395898_0003096
790 Ga0395898_0006945
791 Ga0395898_0011179
792 Ga0395898_0020498
793 Ga0395898_0023550
794 Ga0395898_0035883
795 Ga0395898_0068967
796 Ga0395898_0126233
797 Ga0395898_0126511
798 Ga0395898_0153781
799 Ga0395898_0484262
800 Ga0395898_0677240
801 Ga0395905_0003579
802 Ga0395905_0042422
803 Ga0395905_1543266
804 Ga0395901_0002858
805 Ga0395901_0011972
806 Ga0395901_0013367
807 Ga0395901_0017916
808 Ga0395901_0062489
809 Ga0395901_0091203
810 Ga0395901_0147424
811 Ga0395901_0389863
812 Ga0395901_0419183
813 Ga0395901_0521965
814 Ga0395901_0813883
815 Ga0395901_0907967
816 Ga0395901_0925849
817 Ga0439436_0007822
818 Ga0439436_0011100
819 Ga0439436_0176867
820 Ga0439438_015683
821 Ga0439438_062850
822 Ga0439438_067954
823 Ga0439438_070512
824 Ga0439439_0007743
825 Ga0439439_0041930
826 Ga0439447_140872
827 Ga0439461_0015713
828 Ga0439461_0070026
829 Ga0439466_0071118
830 Ga0439466_0193949
831 Ga0439465_0131978
832 Ga0451797_0290601
833 Ga0451797_1049728
834 Ga0451797_1112820
835 Ga0451802_0250628
836 Ga0451802_1370008
837 Ga0451807_1614612
838 Ga0451807_1916018
839 Ga0451807_2614767
840 Ga0451833_1390745
841 Ga0451849_1475537
842 Ga0451843_0388081
843 Ga0439433_0000154
844 Ga0439433_0049944
845 Ga0439433_0146761
846 Ga0439433_0195185
847 Ga0439442_000130
848 Ga0439442_003402
849 Ga0439442_009933
850 Ga0439442_044699
851 Ga0439442_083857
852 Ga0439442_084703
853 Ga0439432_150216
854 Ga0439449_0003386
855 Ga0439449_0006049
856 Ga0439449_0022988
857 Ga0439449_0060839
858 Ga0439449_0078460
859 Ga0439449_0238214
860 Ga0439452_059385
861 Ga0439457_000446
862 Ga0439457_007756
863 Ga0439457_010726
864 Ga0439462_0033534
865 Ga0439462_0053286
866 Ga0439462_0084211
867 Ga0439462_0148158
868 Ga0450919_001040
869 Ga0450920_000327
870 Ga0450920_001970
871 Ga0450920_105085
872 Ga0450907_000109
873 Ga0450907_014433
874 Ga0450907_015744
875 Ga0450910_058599
876 Ga0450908_026639
877 Ga0450908_033785
878 Ga0450909_000102
879 Ga0439434_0000078
880 Ga0439434_0006126
881 Ga0439434_0109986
882 Ga0439434_0367196
883 Ga0450918_001215
884 Ga0450918_021489
885 Ga0466972_0094423
886 Ga0466965_0159445
887 Ga0466966_0226520
888 Ga0466966_0226987
889 Ga0466961_0126338
890 Ga0466961_0216852
891 Ga0466970_0456572
892 Ga0466958_0979308
893 Ga0466967_0209838
894 Ga0495629_0334196
895 Ga0495653_0003711
896 Ga0495580_0248027
897 Ga0495580_0440934
898 Ga0495582_0024138
899 Ga0495582_0509534
900 Ga0495639_0033859
901 Ga0495639_0061009
902 Ga0495662_0022007
903 Ga0495664_0034017
904 Ga0495594_0692484
905 Ga0495594_0819550
906 Ga0495630_0167152
907 Ga0495643_0210334
908 Ga0495665_0000442
909 Ga0495586_0001309
910 Ga0495586_0002380
911 Ga0495587_0004388
912 Ga0495598_0049218
913 Ga0495645_0000314
914 Ga0495622_0151905
915 Ga0495633_0103727
916 Ga0495667_0000209
917 Ga0495656_0029956
918 Ga0495668_0242142
919 Ga0495668_0280565
920 Ga0495668_0337708
921 Ga0495668_0817482
922 Ga0495635_0295069
923 Ga0495659_0025421
924 Ga0495588_0008840
925 Ga0495588_0038820
926 Ga0495588_0071011
927 Ga0495588_0083426
928 Ga0495588_0689833
929 Ga0495599_0176902
930 Ga0495623_0010866
931 Ga0495670_0036656
932 Ga0495670_0653598
933 Ga0495600_0055986
934 Ga0495581_0007490
935 Ga0495581_0013426
936 Ga0495581_0127792
937 Ga0495604_0663082
938 Ga0495636_0396949
939 Ga0495677_0035285
940 Ga0495681_0196520
941 Ga0495684_0365321
942 Ga0496100_0119753
943 Ga0496100_1293074
944 Ga0496101_0140290
945 Ga0496102_0015348
946 Ga0496102_0122412
947 Ga0496102_0204264
948 Ga0496102_0213347
949 Ga0496102_0361549
950 Ga0496103_0033204
951 Ga0496103_0185150
952 Ga0496103_0210390
953 Ga0496103_0313332
954 Ga0496103_0491660
955 Ga0496105_0229523
956 Ga0496106_0034324
957 Ga0496107_0041883
958 Ga0496107_0110996
959 Ga0496107_0510376
960 Ga0496108_1555752
961 Ga0496109_0354717
962 Ga0496109_1889776
963 Ga0496109_1987564
964 Ga0496110_0121711
965 Ga0496110_0189344
966 Ga0496110_0936750
967 Ga0496111_0031101
968 Ga0496111_0223895
969 Ga0496111_0264675
970 Ga0496111_0318481
971 Ga0496111_0522669
972 Ga0496112_0026535
973 Ga0496112_1002498
974 Ga0496113_0291401
975 Ga0496113_0494878
976 Ga0496113_0553085
977 Ga0496113_0746273
978 Ga0496114_0173233
979 Ga0496114_0587372
980 Ga0496114_0702693
981 Ga0496115_0599216
982 Ga0496118_0011045
983 Ga0496119_0104590
984 Ga0496120_0250542
985 Ga0496121_0571796
986 Ga0496122_0003238
987 Ga0496124_0948286
988 Ga0496125_0000094
989 Ga0496125_0011077
990 Ga0496126_0017543
991 Ga0496126_0128160
992 Ga0501306_049393
993 Ga0501309_006184
994 Ga0501305_002101
995 Ga0501305_006601
996 Ga0501307_018888
997 Ga0501307_085274
998 Ga0501312_000495
999 Ga0501312_026502
1000 Ga0501316_002940
1001 Ga0501316_008079
1002 Ga0501316_047057
1003 Ga0501316_054203
1004 Ga0501317_030125
1005 Ga0501318_008778
1006 Ga0501318_009370
1007 Ga0501318_011643
1008 Ga0501320_008267
1009 Ga0501321_000940
1010 Ga0501321_018176
1011 Ga0501321_020527
1012 Ga0501321_024278
1013 Ga0501323_004732
1014 Ga0501324_006854
1015 Ga0501325_006345
1016 Ga0501325_019074
1017 Ga0501330_013736
1018 Ga0501340_001043
1019 Ga0501031_0102404
1020 Ga0501032_0005923
1021 Ga0501032_0027063
1022 Ga0501032_0065760
1023 Ga0501033_0804561
1024 Ga0501034_0000016
1025 Ga0501034_0015321
1026 Ga0501034_0600239
1027 Ga0501034_0601128
1028 Ga0501036_0087862
1029 Ga0501036_0702539
1030 Ga0501036_0749702
1031 Ga0501037_0009849
1032 Ga0501038_0000454
1033 Ga0501038_0290708
1034 Ga0501039_0036983
1035 Ga0501043_0048702
1036 Ga0501043_0130597
1037 Ga0501043_0438186
1038 Ga0501043_1046705
1039 Ga0501046_0045288
1040 Ga0501047_0002218
1041 Ga0501047_0087547
1042 Ga0501047_0663936
1043 Ga0501048_0093537
1044 Ga0501080_1573378
1045 Ga0501083_0010826
1046 Ga0501279_047428
1047 Ga0501035_0021800
1048 Ga0501044_0001597
1049 Ga0501044_0022032
1050 Ga0501044_0105230
1051 nmdc:mga00v17_814838_c1
1052 Ga0495655_0008834
1053 Ga0501084_0927041
1054 Ga0587090_021170
1055 2537898159
1056 2555229875
1057 2644083151
1058 2644503589
1059 2644525869
1060 2644666166
1061 2644669928
1062 2691513957
1063 2738697365
1064 2739326742
1065 2739606066
1066 2760307107
1067 2760624429
1068 2775656831
1069 2808831214
1070 2808852488
1071 2808879226
1072 2808891357
1073 2808896531
1074 2809029298
1075 2810363798
1076 2812321092
1077 2835191756
1078 2839987162
1079 2844852805
1080 2857742025
1081 2884995726
1082 2904498140
1083 2904777497
1084 2905927132
1085 2910810121
1086 2919034869
1087 2919051354
1088 2919062173
1089 2919393717
1090 2919540333
1091 2932428161
1092 2933421314
1093 2935894619
1094 2939601206
1095 2939648585
1096 2939675373
1097 2945918837
1098 2945920796
1099 2945942990
1100 2945958692
1101 2945959252
1102 2946004703
1103 2946025695
1104 2946038884
1105 2946062528
1106 2946062702
1107 2954000328
1108 2974306836
1109 8004024816
1110 8004028598
1111 8054107767
1112 8056583709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12270

Cyt_c_ox_IV

Cytochrome c oxidase subunit IV

1

132

0.99

Map