F463154

General Info

Members Datasets Scaffolds Average Seq Length
555 258 1110 119

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0012433|Ga0501034_0012433_5366_5761
Length 131
Sequence VRCREIDVVTTDVTRVEKPWGYELHWAKTDRYVGKLIHVNAGHALSLQYHNLKDETIYLQAGRMLFEIEVDGVLTKREMTPGECVHVTPKTVHRMTAIDDCDIFEVSTPELHDVVRLEDRYGREDKAAGTT

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
97 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
184 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 4.86
Rhizosphere 93.69
Stem 0
Stem Tuber 0
Unclassified 19.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0012433 3300049571 Bacteria 8792
2 JGI24751J29686_10097839 3300002459 Bacteria 612
3 Ga0065714_10114025 3300005288 Bacteria 1434
4 Ga0065704_10338076 3300005289 Bacteria 828
5 Ga0065712_10025782 3300005290 Bacteria 1007
6 Ga0065712_10075102 3300005290 Bacteria 3937
7 Ga0065712_10077156 3300005290 Bacteria 3540
8 Ga0065712_10118185 3300005290 Bacteria 1710
9 Ga0065712_10258903 3300005290 Bacteria 942
10 Ga0065715_10215471 3300005293 Bacteria 1295
11 Ga0065715_10464427 3300005293 Bacteria 799
12 Ga0065715_10584288 3300005293 Unclassified 718
13 Ga0065707_10017201 3300005295 Bacteria 1564
14 Ga0065707_10547855 3300005295 Unclassified 723
15 Ga0065707_10744863 3300005295 Unclassified 621
16 Ga0070658_11712875 3300005327 Unclassified 544
17 Ga0070676_10434367 3300005328 Unclassified 920
18 Ga0070683_100178849 3300005329 Bacteria 2013
19 Ga0070683_101754556 3300005329 Bacteria 597
20 Ga0070670_100036052 3300005331 Bacteria 4258
21 Ga0070670_100071056 3300005331 Bacteria 2988
22 Ga0070670_100236813 3300005331 Bacteria 1589
23 Ga0070670_100406903 3300005331 Unclassified 1202
24 Ga0070670_101055755 3300005331 Bacteria 740
25 Ga0070677_10133537 3300005333 Bacteria 1136
26 Ga0068869_101524219 3300005334 Bacteria 594
27 Ga0070666_10247364 3300005335 Bacteria 1262
28 Ga0070666_11308392 3300005335 Bacteria 541
29 Ga0070680_100142132 3300005336 Bacteria 2013
30 Ga0070682_101374993 3300005337 Unclassified 603
31 Ga0068868_100083286 3300005338 Bacteria 2567
32 Ga0068868_100103090 3300005338 Bacteria 2311
33 Ga0068868_100113801 3300005338 Bacteria 2201
34 Ga0068868_100141518 3300005338 Bacteria 1975
35 Ga0070660_100005945 3300005339 Bacteria 8437
36 Ga0070660_100137974 3300005339 Unclassified 1955
37 Ga0070689_100026105 3300005340 Bacteria 4395
38 Ga0070689_100095640 3300005340 Bacteria 2346
39 Ga0070689_100521279 3300005340 Bacteria 1021
40 Ga0070689_100824944 3300005340 Bacteria 817
41 Ga0070691_10462471 3300005341 Unclassified 726
42 Ga0070687_100129615 3300005343 Bacteria 1454
43 Ga0070661_100050914 3300005344 Unclassified 3031
44 Ga0070692_10581867 3300005345 Unclassified 738
45 Ga0070692_10847386 3300005345 Bacteria 628
46 Ga0070668_102265325 3300005347 Unclassified 502
47 Ga0070669_100026128 3300005353 Bacteria 4200
48 Ga0070669_100181421 3300005353 Bacteria 1647
49 Ga0070675_100009110 3300005354 Bacteria 7709
50 Ga0070675_100061205 3300005354 Bacteria 3108
51 Ga0070675_100090281 3300005354 Bacteria 2566
52 Ga0070675_100390417 3300005354 Bacteria 1240
53 Ga0070675_100983030 3300005354 Bacteria 775
54 Ga0070675_101001520 3300005354 Bacteria 767
55 Ga0070675_101297846 3300005354 Bacteria 671
56 Ga0070674_100160411 3300005356 Bacteria 1706
57 Ga0070674_100299736 3300005356 Bacteria 1281
58 Ga0070674_100450642 3300005356 Unclassified 1062
59 Ga0070674_101582364 3300005356 Bacteria 591
60 Ga0070673_100010567 3300005364 Bacteria 6253
61 Ga0070673_100109786 3300005364 Bacteria 2286
62 Ga0070688_100246642 3300005365 Bacteria 1270
63 Ga0070688_100269234 3300005365 Bacteria 1220
64 Ga0070688_100348868 3300005365 Bacteria 1083
65 Ga0070688_100892079 3300005365 Bacteria 701
66 Ga0070659_100248657 3300005366 Bacteria 1473
67 Ga0070667_100780278 3300005367 Bacteria 887
68 Ga0070667_101045238 3300005367 Bacteria 763
69 Ga0070703_10545886 3300005406 Bacteria 528
70 Ga0070709_11605772 3300005434 Unclassified 530
71 Ga0070711_101335587 3300005439 Unclassified 623
72 Ga0070694_100055142 3300005444 Bacteria 2695
73 Ga0070694_100312658 3300005444 Bacteria 1207
74 Ga0070708_100633403 3300005445 Bacteria 1008
75 Ga0070678_100073387 3300005456 Bacteria 2568
76 Ga0070678_100130686 3300005456 Bacteria 1994
77 Ga0070678_100210393 3300005456 Bacteria 1611
78 Ga0070662_100909463 3300005457 Unclassified 751
79 Ga0070662_101066473 3300005457 Bacteria 693
80 Ga0070681_10156922 3300005458 Bacteria 2200
81 Ga0070707_100388332 3300005468 Bacteria 1356
82 Ga0070699_101132669 3300005518 Bacteria 718
83 Ga0070679_100015065 3300005530 Bacteria 7430
84 Ga0070679_100112084 3300005530 Bacteria 2714
85 Ga0070684_101102718 3300005535 Bacteria 746
86 Ga0070697_100346888 3300005536 Bacteria 1282
87 Ga0070697_101631418 3300005536 Bacteria 577
88 Ga0070672_100495970 3300005543 Bacteria 1056
89 Ga0070686_100295776 3300005544 Bacteria 1199
90 Ga0070686_100337711 3300005544 Unclassified 1128
91 Ga0070695_100289992 3300005545 Bacteria 1206
92 Ga0070693_100440465 3300005547 Bacteria 912
93 Ga0070665_100003554 3300005548 Bacteria 16537
94 Ga0070665_100174989 3300005548 Unclassified 2147
95 Ga0070665_101799423 3300005548 Unclassified 619
96 Ga0070704_101586519 3300005549 Unclassified 603
97 Ga0068855_100047983 3300005563 Bacteria 5042
98 Ga0068855_101062366 3300005563 Unclassified 848
99 Ga0068855_101131445 3300005563 Bacteria 817
100 Ga0070664_100315838 3300005564 Bacteria 1415
101 Ga0068857_102418440 3300005577 Unclassified 516
102 Ga0068854_100360750 3300005578 Bacteria 1192
103 Ga0068854_101670858 3300005578 Unclassified 582
104 Ga0068856_100467476 3300005614 Bacteria 1282
105 Ga0068856_101658355 3300005614 Unclassified 652
106 Ga0068856_102483045 3300005614 Unclassified 525
107 Ga0068852_100976868 3300005616 Bacteria 865
108 Ga0068852_101532927 3300005616 Bacteria 689
109 Ga0068859_100015365 3300005617 Bacteria 7691
110 Ga0068859_102726459 3300005617 Bacteria 543
111 Ga0068864_100021441 3300005618 Bacteria 5413
112 Ga0068864_100101923 3300005618 Bacteria 2547
113 Ga0068864_100145376 3300005618 Unclassified 2143
114 Ga0068864_100293061 3300005618 Bacteria 1521
115 Ga0068864_100890126 3300005618 Bacteria 879
116 Ga0068861_100376591 3300005719 Bacteria 1253
117 Ga0068861_101039778 3300005719 Unclassified 784
118 Ga0068863_100023151 3300005841 Bacteria 5936
119 Ga0068863_100044810 3300005841 Bacteria 4198
120 Ga0068863_100374563 3300005841 Bacteria 1389
121 Ga0068863_100533210 3300005841 Bacteria 1158
122 Ga0068858_100001318 3300005842 Bacteria 25636
123 Ga0068858_100004901 3300005842 Bacteria 13118
124 Ga0068858_100185390 3300005842 Bacteria 1965
125 Ga0068858_100343119 3300005842 Bacteria 1430
126 Ga0068858_100862521 3300005842 Bacteria 884
127 Ga0068860_100492419 3300005843 Bacteria 1223
128 Ga0068860_101112092 3300005843 Bacteria 810
129 Ga0068860_102361499 3300005843 Unclassified 552
130 Ga0068862_100209972 3300005844 Bacteria 1759
131 Ga0068862_100403532 3300005844 Bacteria 1279
132 Ga0068862_100673649 3300005844 Bacteria 1000
133 Ga0068862_102337540 3300005844 Unclassified 546
134 Ga0081539_10079984 3300005985 Bacteria 1720
135 Ga0070717_10608070 3300006028 Bacteria 992
136 Ga0070715_10139481 3300006163 Bacteria 1176
137 Ga0070716_100058618 3300006173 Bacteria 2216
138 Ga0070716_100356014 3300006173 Bacteria 1038
139 Ga0075366_10152829 3300006195 Bacteria 1398
140 Ga0097621_100012194 3300006237 Bacteria 6359
141 Ga0097621_100050021 3300006237 Bacteria 3398
142 Ga0097621_100120254 3300006237 Bacteria 2227
143 Ga0097621_101711850 3300006237 Unclassified 599
144 Ga0068871_100002033 3300006358 Bacteria 13708
145 Ga0068871_100093416 3300006358 Bacteria 2510
146 Ga0068871_100117326 3300006358 Bacteria 2245
147 Ga0068871_100543099 3300006358 Bacteria 1052
148 Ga0068871_101501821 3300006358 Unclassified 637
149 Ga0075428_100078541 3300006844 Bacteria 3603
150 Ga0075428_102166651 3300006844 Unclassified 574
151 Ga0075430_100338152 3300006846 Bacteria 1244
152 Ga0075430_100376784 3300006846 Bacteria 1171
153 Ga0075431_100042856 3300006847 Bacteria 4669
154 Ga0075431_100060411 3300006847 Bacteria 3911
155 Ga0075431_100125465 3300006847 Bacteria 2649
156 Ga0075431_100774240 3300006847 Unclassified 934
157 Ga0075433_10151111 3300006852 Bacteria 2066
158 Ga0075434_100012281 3300006871 Bacteria 8115
159 Ga0075434_100625547 3300006871 Bacteria 1095
160 Ga0075434_101699919 3300006871 Bacteria 639
161 Ga0075429_100074739 3300006880 Bacteria 2952
162 Ga0075429_100270379 3300006880 Bacteria 1489
163 Ga0075429_100344747 3300006880 Bacteria 1304
164 Ga0075429_100533142 3300006880 Bacteria 1029
165 Ga0068865_100022699 3300006881 Bacteria 4098
166 Ga0075436_100109921 3300006914 Bacteria 1923
167 Ga0075436_100697211 3300006914 Bacteria 752
168 Ga0097620_100015365 3300006931 Bacteria 7691
169 Ga0097620_102725898 3300006931 Bacteria 543
170 Ga0075435_100094828 3300007076 Bacteria 2467
171 Ga0075435_100209664 3300007076 Bacteria 1652
172 Ga0105251_10494930 3300009011 Bacteria 571
173 Ga0105240_10411146 3300009093 Bacteria 1522
174 Ga0105240_11306416 3300009093 Bacteria 765
175 Ga0111539_10034444 3300009094 Bacteria 6139
176 Ga0111539_10040158 3300009094 Bacteria 5635
177 Ga0111539_10073440 3300009094 Bacteria 4033
178 Ga0111539_10106728 3300009094 Bacteria 3285
179 Ga0111539_10629901 3300009094 Bacteria 1249
180 Ga0111539_11516240 3300009094 Bacteria 777
181 Ga0111539_11737531 3300009094 Unclassified 723
182 Ga0105245_10017926 3300009098 Bacteria 6183
183 Ga0105245_10173745 3300009098 Bacteria 2053
184 Ga0105245_10550287 3300009098 Bacteria 1176
185 Ga0105245_11029092 3300009098 Bacteria 869
186 Ga0105245_11454674 3300009098 Bacteria 736
187 Ga0105245_12485823 3300009098 Bacteria 571
188 Ga0105245_12622729 3300009098 Bacteria 557
189 Ga0105247_10030356 3300009101 Bacteria 3276
190 Ga0114129_10035666 3300009147 Bacteria 7026
191 Ga0114129_10095327 3300009147 Bacteria 4121
192 Ga0114129_10127070 3300009147 Bacteria 3505
193 Ga0114129_10199894 3300009147 Bacteria 2708
194 Ga0114129_10203132 3300009147 Bacteria 2683
195 Ga0114129_10900194 3300009147 Bacteria 1121
196 Ga0114129_12534748 3300009147 Unclassified 613
197 Ga0105243_12397337 3300009148 Bacteria 566
198 Ga0105243_12860306 3300009148 Bacteria 523
199 Ga0105241_11226068 3300009174 Bacteria 711
200 Ga0105241_11244266 3300009174 Bacteria 707
201 Ga0105242_10002076 3300009176 Bacteria 15787
202 Ga0105242_10032302 3300009176 Bacteria 4185
203 Ga0105242_10371304 3300009176 Bacteria 1327
204 Ga0105242_10627317 3300009176 Bacteria 1042
205 Ga0105242_11255197 3300009176 Bacteria 763
206 Ga0105242_11278780 3300009176 Bacteria 756
207 Ga0105248_10008235 3300009177 Bacteria 11454
208 Ga0105248_10202435 3300009177 Bacteria 2237
209 Ga0105248_10240294 3300009177 Bacteria 2039
210 Ga0105248_10457194 3300009177 Bacteria 1439
211 Ga0105248_11155557 3300009177 Bacteria 875
212 Ga0105248_11770537 3300009177 Bacteria 700
213 Ga0105237_12048077 3300009545 Bacteria 581
214 Ga0105237_12456706 3300009545 Bacteria 531
215 Ga0105238_10312316 3300009551 Bacteria 1557
216 Ga0105238_10344061 3300009551 Bacteria 1480
217 Ga0105249_10237485 3300009553 Bacteria 1800
218 Ga0105249_11169514 3300009553 Bacteria 840
219 Ga0105239_11072275 3300010375 Bacteria 927
220 Ga0105239_12893553 3300010375 Bacteria 560
221 Ga0105246_11310521 3300011119 Unclassified 672
222 Ga0157314_1045001 3300012500 Bacteria 546
223 Ga0157338_1053272 3300012515 Unclassified 587
224 Ga0157370_10974358 3300013104 Bacteria 768
225 Ga0157370_11074650 3300013104 Bacteria 727
226 Ga0157374_10002657 3300013296 Bacteria 15054
227 Ga0157374_11869433 3300013296 Bacteria 626
228 Ga0157378_10274058 3300013297 Bacteria 1624
229 Ga0157378_12819475 3300013297 Unclassified 538
230 Ga0163162_10033907 3300013306 Bacteria 5077
231 Ga0163162_10185046 3300013306 Bacteria 2210
232 Ga0163162_10839752 3300013306 Bacteria 1034
233 Ga0163162_11533156 3300013306 Bacteria 759
234 Ga0163162_12819484 3300013306 Bacteria 559
235 Ga0157372_10259931 3300013307 Bacteria 2016
236 Ga0157375_10254566 3300013308 Bacteria 1917
237 Ga0157375_10299847 3300013308 Bacteria 1771
238 Ga0157375_11568174 3300013308 Unclassified 778
239 Ga0157375_11797142 3300013308 Bacteria 727
240 Ga0157375_12765563 3300013308 Bacteria 587
241 Ga0163163_10013598 3300014325 Bacteria 7454
242 Ga0163163_10016066 3300014325 Bacteria 6942
243 Ga0163163_10026496 3300014325 Bacteria 5543
244 Ga0163163_11131023 3300014325 Bacteria 846
245 Ga0163163_12448426 3300014325 Unclassified 580
246 Ga0157380_10235152 3300014326 Bacteria 1648
247 Ga0157380_10345904 3300014326 Unclassified 1389
248 Ga0157380_11652278 3300014326 Unclassified 697
249 Ga0157377_10214685 3300014745 Bacteria 1228
250 Ga0157377_10959158 3300014745 Bacteria 644
251 Ga0157379_10878831 3300014968 Bacteria 849
252 Ga0157379_11131764 3300014968 Unclassified 751
253 Ga0157379_11573590 3300014968 Unclassified 641
254 Ga0157376_10011761 3300014969 Bacteria 6464
255 Ga0157376_10548394 3300014969 Bacteria 1144
256 Ga0157376_10743211 3300014969 Unclassified 989
257 Ga0163161_10876076 3300017792 Bacteria 759
258 Ga0224712_10589991 3300022467 Bacteria 542
259 Ga0207697_10487925 3300025315 Bacteria 545
260 Ga0207697_10507178 3300025315 Bacteria 532
261 Ga0207656_10252514 3300025321 Bacteria 864
262 Ga0207653_10390959 3300025885 Bacteria 545
263 Ga0207682_10051708 3300025893 Bacteria 1702
264 Ga0207682_10093419 3300025893 Bacteria 1307
265 Ga0207682_10308192 3300025893 Unclassified 743
266 Ga0207688_10621307 3300025901 Bacteria 681
267 Ga0207688_10890020 3300025901 Unclassified 564
268 Ga0207680_10057416 3300025903 Bacteria 2355
269 Ga0207699_10217330 3300025906 Bacteria 1303
270 Ga0207643_10076865 3300025908 Bacteria 1929
271 Ga0207643_10373917 3300025908 Bacteria 897
272 Ga0207654_11038353 3300025911 Archaea 596
273 Ga0207695_11075160 3300025913 Bacteria 684
274 Ga0207660_10703232 3300025917 Bacteria 824
275 Ga0207662_10422864 3300025918 Bacteria 907
276 Ga0207657_10001144 3300025919 Bacteria 28206
277 Ga0207657_10100004 3300025919 Bacteria 2408
278 Ga0207649_10168425 3300025920 Bacteria 1524
279 Ga0207652_10287278 3300025921 Bacteria 1484
280 Ga0207652_10340758 3300025921 Bacteria 1353
281 Ga0207646_10737571 3300025922 Bacteria 879
282 Ga0207681_10096797 3300025923 Bacteria 2120
283 Ga0207681_11171369 3300025923 Unclassified 646
284 Ga0207650_10049774 3300025925 Bacteria 3096
285 Ga0207650_10166514 3300025925 Bacteria 1749
286 Ga0207650_10341135 3300025925 Unclassified 1230
287 Ga0207650_10538403 3300025925 Unclassified 978
288 Ga0207650_10638773 3300025925 Bacteria 897
289 Ga0207659_10005490 3300025926 Bacteria 7692
290 Ga0207659_10026676 3300025926 Bacteria 3901
291 Ga0207659_10246429 3300025926 Bacteria 1448
292 Ga0207659_10265734 3300025926 Bacteria 1398
293 Ga0207659_10290926 3300025926 Bacteria 1338
294 Ga0207659_10674803 3300025926 Unclassified 884
295 Ga0207659_11745195 3300025926 Unclassified 529
296 Ga0207687_10308195 3300025927 Bacteria 1277
297 Ga0207687_10444089 3300025927 Bacteria 1075
298 Ga0207644_10981229 3300025931 Bacteria 709
299 Ga0207644_11034203 3300025931 Bacteria 690
300 Ga0207690_10428085 3300025932 Bacteria 1060
301 Ga0207706_10953268 3300025933 Unclassified 723
302 Ga0207686_10007531 3300025934 Bacteria 5861
303 Ga0207686_10076345 3300025934 Bacteria 2172
304 Ga0207686_10211292 3300025934 Bacteria 1395
305 Ga0207686_10552229 3300025934 Unclassified 901
306 Ga0207686_11610031 3300025934 Unclassified 536
307 Ga0207670_10059012 3300025936 Bacteria 2609
308 Ga0207670_10111471 3300025936 Bacteria 1972
309 Ga0207670_10679958 3300025936 Unclassified 851
310 Ga0207669_10281484 3300025937 Bacteria 1254
311 Ga0207704_10190357 3300025938 Bacteria 1492
312 Ga0207704_10411394 3300025938 Bacteria 1070
313 Ga0207704_10411999 3300025938 Bacteria 1069
314 Ga0207665_10017925 3300025939 Bacteria 4654
315 Ga0207665_10047293 3300025939 Bacteria 2884
316 Ga0207691_10182797 3300025940 Bacteria 1831
317 Ga0207691_10731836 3300025940 Bacteria 833
318 Ga0207711_10049598 3300025941 Bacteria 3594
319 Ga0207711_10300601 3300025941 Bacteria 1480
320 Ga0207711_10377278 3300025941 Unclassified 1315
321 Ga0207711_10758842 3300025941 Unclassified 904
322 Ga0207711_10794831 3300025941 Bacteria 881
323 Ga0207711_11219448 3300025941 Bacteria 694
324 Ga0207689_10788656 3300025942 Bacteria 802
325 Ga0207661_11293347 3300025944 Bacteria 670
326 Ga0207661_11490100 3300025944 Bacteria 620
327 Ga0207679_10100086 3300025945 Unclassified 2265
328 Ga0207679_10272988 3300025945 Bacteria 1447
329 Ga0207679_10857028 3300025945 Bacteria 830
330 Ga0207679_11527034 3300025945 Bacteria 612
331 Ga0207667_10177306 3300025949 Bacteria 2189
332 Ga0207667_10362541 3300025949 Bacteria 1478
333 Ga0207667_12088735 3300025949 Bacteria 525
334 Ga0207651_10013993 3300025960 Bacteria 4617
335 Ga0207651_10239372 3300025960 Bacteria 1478
336 Ga0207651_11135373 3300025960 Bacteria 701
337 Ga0207712_10275319 3300025961 Bacteria 1371
338 Ga0207712_11649615 3300025961 Bacteria 575
339 Ga0207668_10527208 3300025972 Bacteria 1020
340 Ga0207640_10423752 3300025981 Bacteria 1090
341 Ga0207658_11091772 3300025986 Bacteria 729
342 Ga0207677_10082662 3300026023 Bacteria 2309
343 Ga0207677_10128227 3300026023 Bacteria 1921
344 Ga0207677_10141372 3300026023 Bacteria 1843
345 Ga0207703_10005411 3300026035 Bacteria 10276
346 Ga0207703_10013580 3300026035 Bacteria 6346
347 Ga0207703_10032088 3300026035 Bacteria 4156
348 Ga0207703_10461715 3300026035 Bacteria 1188
349 Ga0207678_11837160 3300026067 Unclassified 530
350 Ga0207708_10267849 3300026075 Unclassified 1381
351 Ga0207708_10585344 3300026075 Bacteria 944
352 Ga0207702_10463796 3300026078 Bacteria 1231
353 Ga0207702_10489231 3300026078 Bacteria 1198
354 Ga0207641_10225233 3300026088 Bacteria 1741
355 Ga0207641_10383922 3300026088 Bacteria 1346
356 Ga0207641_10509645 3300026088 Bacteria 1169
357 Ga0207648_11142969 3300026089 Unclassified 731
358 Ga0207676_10013448 3300026095 Bacteria 5878
359 Ga0207676_10027935 3300026095 Bacteria 4209
360 Ga0207676_10119250 3300026095 Bacteria 2222
361 Ga0207676_10174260 3300026095 Bacteria 1877
362 Ga0207676_10208570 3300026095 Bacteria 1732
363 Ga0207676_10213425 3300026095 Unclassified 1714
364 Ga0207676_10296509 3300026095 Unclassified 1474
365 Ga0207676_10329986 3300026095 Bacteria 1404
366 Ga0207676_10510435 3300026095 Bacteria 1143
367 Ga0207676_10713622 3300026095 Bacteria 973
368 Ga0207676_11619528 3300026095 Unclassified 645
369 Ga0207674_10206829 3300026116 Bacteria 1912
370 Ga0207674_10785218 3300026116 Bacteria 919
371 Ga0207675_100061324 3300026118 Bacteria 3511
372 Ga0207683_10004066 3300026121 Bacteria 12643
373 Ga0207683_10156816 3300026121 Bacteria 2056
374 Ga0207683_10261943 3300026121 Bacteria 1579
375 Ga0207683_10579679 3300026121 Unclassified 1038
376 Ga0210002_1026741 3300027617 Bacteria 948
377 Ga0209971_1008761 3300027682 Bacteria 2399
378 Ga0209974_10007850 3300027876 Bacteria 3663
379 Ga0207428_10023815 3300027907 Bacteria 5143
380 Ga0207428_10392677 3300027907 Bacteria 1016
381 Ga0268266_10036398 3300028379 Bacteria 4189
382 Ga0268266_10055887 3300028379 Bacteria 3394
383 Ga0268266_10166617 3300028379 Bacteria 1997
384 Ga0268266_10945747 3300028379 Bacteria 834
385 Ga0268265_11233581 3300028380 Unclassified 746
386 Ga0268265_11241759 3300028380 Bacteria 744
387 Ga0268265_12322513 3300028380 Bacteria 543
388 Ga0268265_12374833 3300028380 Bacteria 537
389 Ga0268264_10184333 3300028381 Bacteria 1898
390 Ga0268264_10207500 3300028381 Bacteria 1796
391 Ga0268264_10333307 3300028381 Bacteria 1439
392 Ga0268264_11530268 3300028381 Unclassified 678
393 Ga0268264_11811611 3300028381 Unclassified 620
394 Ga0307408_100046801 3300031548 Bacteria 3095
395 Ga0307408_100738826 3300031548 Bacteria 888
396 Ga0307408_102480626 3300031548 Bacteria 504
397 Ga0307406_10712962 3300031901 Bacteria 839
398 Ga0307407_11111495 3300031903 Unclassified 615
399 Ga0307409_100913261 3300031995 Unclassified 892
400 Ga0307416_100171348 3300032002 Bacteria 2021
401 Ga0307416_103822289 3300032002 Bacteria 504
402 Ga0307411_10157532 3300032005 Bacteria 1696
403 Ga0307411_11514256 3300032005 Bacteria 617
404 Ga0307415_100523473 3300032126 Bacteria 1041
405 Ga0373948_0050466 3300034817 Unclassified 893
406 Ga0373955_0817064 3300035172 Unclassified 573
407 Ga0373961_0045737 3300035241 Bacteria 1281
408 Ga0373931_0683026 3300035691 Bacteria 677
409 Ga0373931_1272828 3300035691 Unclassified 505
410 Ga0373935_0743516 3300035692 Bacteria 722
411 Ga0373927_0364444 3300035695 Unclassified 953
412 Ga0373933_0207499 3300035724 Bacteria 1255
413 Ga0373937_0081415 3300036401 Bacteria 2995
414 Ga0373937_0499345 3300036401 Bacteria 1156
415 Ga0373937_0693933 3300036401 Unclassified 964
416 Ga0373937_1639573 3300036401 Unclassified 590
417 Ga0439453_0000845 3300041408 Bacteria 3640
418 Ga0439453_0008065 3300041408 Unclassified 1684
419 Ga0439453_0048548 3300041408 Bacteria 852
420 Ga0451839_0537203 3300041496 Unclassified 720
421 Ga0451853_3534482 3300041512 Unclassified 683
422 Ga0451853_3938810 3300041512 Bacteria 655
423 Ga0439457_094233 3300042014 Unclassified 695
424 Ga0439435_0000840 3300042436 Bacteria 5256
425 Ga0439435_0070283 3300042436 Bacteria 1035
426 Ga0439464_0025325 3300042439 Bacteria 1643
427 Ga0453683_0491334 3300044673 Bacteria 796
428 Ga0466957_1347656 3300044842 Bacteria 519
429 Ga0451576_2065721 3300045051 Unclassified 586
430 Ga0495629_1099235 3300046459 Unclassified 514
431 Ga0495638_0010842 3300046460 Bacteria 6302
432 Ga0495651_0398544 3300046462 Bacteria 899
433 Ga0495664_0627467 3300046477 Bacteria 638
434 Ga0495652_0599355 3300046529 Unclassified 752
435 Ga0495621_0205741 3300046539 Bacteria 793
436 Ga0495645_0000774 3300046543 Bacteria 21888
437 Ga0495645_0418618 3300046543 Bacteria 851
438 Ga0495622_0364250 3300046557 Unclassified 625
439 Ga0495635_0184980 3300046663 Bacteria 1415
440 Ga0495647_0056987 3300046681 Bacteria 1533
441 Ga0495647_0160706 3300046681 Bacteria 968
442 Ga0495647_0214231 3300046681 Unclassified 848
443 Ga0495647_0236680 3300046681 Bacteria 810
444 Ga0495658_0019146 3300046683 Bacteria 3570
445 Ga0495658_0231205 3300046683 Bacteria 1159
446 Ga0495674_0324903 3300047319 Bacteria 1253
447 Ga0495675_0801970 3300047444 Unclassified 521
448 Ga0495684_0034530 3300047471 Bacteria 3880
449 Ga0495684_0602743 3300047471 Bacteria 741
450 Ga0496101_0067661 3300048904 Bacteria 2609
451 Ga0496101_0805749 3300048904 Bacteria 741
452 Ga0496102_0012205 3300048905 Bacteria 7428
453 Ga0496103_0171262 3300048906 Bacteria 1394
454 Ga0496104_0210466 3300048907 Bacteria 1856
455 Ga0496104_0211922 3300048907 Bacteria 1849
456 Ga0496104_0409263 3300048907 Bacteria 1269
457 Ga0496104_0886853 3300048907 Bacteria 797
458 Ga0496104_0911018 3300048907 Unclassified 784
459 Ga0496105_0282592 3300048908 Bacteria 1338
460 Ga0496106_0239688 3300048909 Bacteria 1449
461 Ga0496107_0740402 3300048910 Unclassified 722
462 Ga0496107_0802511 3300048910 Bacteria 689
463 Ga0496108_0289398 3300048911 Bacteria 1426
464 Ga0496108_0766629 3300048911 Unclassified 834
465 Ga0496108_0903294 3300048911 Bacteria 758
466 Ga0496109_0239597 3300048912 Bacteria 1707
467 Ga0496109_0633698 3300048912 Bacteria 1006
468 Ga0496110_0106415 3300048913 Bacteria 2517
469 Ga0496112_0010301 3300048915 Bacteria 8476
470 Ga0496112_0176080 3300048915 Bacteria 2104
471 Ga0496112_0240766 3300048915 Bacteria 1762
472 Ga0496113_0065006 3300048916 Bacteria 2760
473 Ga0496113_0148362 3300048916 Bacteria 1849
474 Ga0496114_0024256 3300048917 Bacteria 4949
475 Ga0496114_0127253 3300048917 Bacteria 2197
476 Ga0496115_0061177 3300048918 Bacteria 3036
477 Ga0501031_0135015 3300049568 Bacteria 1612
478 Ga0501036_0018743 3300049572 Bacteria 5805
479 Ga0501036_0229463 3300049572 Bacteria 1558
480 Ga0501036_0964115 3300049572 Bacteria 699
481 Ga0501036_1034202 3300049572 Bacteria 672
482 Ga0501040_0012710 3300049576 Bacteria 5523
483 Ga0501040_1405966 3300049576 Bacteria 506
484 Ga0501041_1127665 3300049577 Bacteria 506
485 Ga0501042_0016139 3300049578 Bacteria 5124
486 Ga0501046_0281276 3300049580 Bacteria 1219
487 Ga0501047_0020449 3300049581 Bacteria 6356
488 Ga0501048_0011914 3300049582 Bacteria 6484
489 Ga0501048_0736824 3300049582 Unclassified 708
490 Ga0501067_0317409 3300049583 Bacteria 868
491 Ga0501068_0987334 3300049584 Unclassified 555
492 Ga0501069_0402882 3300049585 Bacteria 810
493 Ga0501071_0029544 3300049587 Bacteria 3870
494 Ga0501072_0149937 3300049588 Bacteria 1859
495 Ga0501073_0293453 3300049589 Bacteria 1122
496 Ga0501073_0558909 3300049589 Bacteria 791
497 Ga0501076_0706823 3300049592 Bacteria 832
498 Ga0501077_0009219 3300049593 Bacteria 6126
499 Ga0501077_0776405 3300049593 Unclassified 616
500 Ga0501077_0896136 3300049593 Unclassified 571
501 Ga0501217_266608 3300049661 Bacteria 557
502 Ga0501079_0231022 3300049741 Bacteria 1445
503 Ga0501080_0526050 3300049742 Bacteria 1055
504 Ga0501080_0876248 3300049742 Bacteria 784
505 Ga0501044_0001483 3300049823 Bacteria 27518
506 Ga0501045_0637146 3300049824 Bacteria 788
507 nmdc:mga0k408_174598_c1 3300050493 Unclassified 1281
508 nmdc:mga06z11_59186_c2 3300050494 Bacteria 1586
509 nmdc:mga05p37_1156607_c1 3300050507 Unclassified 804
510 nmdc:mga05p37_127187_c1 3300050507 Bacteria 3129
511 nmdc:mga05p37_14672_c1 3300050507 Bacteria 9412
512 nmdc:mga05p37_1782028_c1 3300050507 Unclassified 595
513 nmdc:mga05p37_340789_c1 3300050507 Unclassified 1768
514 nmdc:mga05p37_60657_c1 3300050507 Bacteria 4656
515 nmdc:mga05p37_662777_c1 3300050507 Bacteria 1166
516 nmdc:mga09592_109547_c1 3300050508 Bacteria 2369
517 nmdc:mga09592_1105237_c1 3300050508 Bacteria 659
518 nmdc:mga09592_1682254_c1 3300050508 Unclassified 512
519 nmdc:mga09592_317353_c1 3300050508 Bacteria 1350
520 nmdc:mga09592_95353_c1 3300050508 Bacteria 2545
521 nmdc:mga0qj67_34098_c1 3300050509 Bacteria 3975
522 nmdc:mga0qj67_38860_c1 3300050509 Unclassified 3735
523 nmdc:mga06r32_672326_c1 3300050510 Unclassified 1002
524 nmdc:mga06r32_9901_c1 3300050510 Bacteria 8602
525 nmdc:mga08y16_126468_c1 3300050511 Bacteria 2659
526 nmdc:mga08y16_1385005_c1 3300050511 Unclassified 667
527 nmdc:mga08y16_18709_c1 3300050511 Bacteria 7296
528 nmdc:mga08y16_2000815_c1 3300050511 Bacteria 529
529 nmdc:mga08y16_21215_c1 3300050511 Bacteria 6860
530 nmdc:mga08y16_277858_c1 3300050511 Bacteria 1728
531 nmdc:mga08y16_318254_c1 3300050511 Bacteria 1602
532 nmdc:mga08y16_8409_c1 3300050511 Bacteria 10800
533 nmdc:mga0n895_1289291_c1 3300050512 Bacteria 702
534 nmdc:mga0n895_1747761_c1 3300050512 Bacteria 584
535 nmdc:mga0n895_349975_c1 3300050512 Bacteria 1496
536 nmdc:mga0n895_37660_c1 3300050512 Bacteria 4681
537 nmdc:mga0n895_650_c1 3300050512 Bacteria 24250
538 nmdc:mga0n895_929653_c1 3300050512 Bacteria 854
539 nmdc:mga0rr50_451013_c1 3300050513 Bacteria 1090
540 nmdc:mga0rr50_726536_c1 3300050513 Bacteria 848
541 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
542 nmdc:mga08x19_586036_c1 3300050514 Bacteria 790
543 nmdc:mga08x19_906_c1 3300050514 Bacteria 18743
544 nmdc:mga0a205_150292_c1 3300050515 Bacteria 2229
545 Ga0495601_0017299 3300053077 Bacteria 4375
546 Ga0495601_0477239 3300053077 Unclassified 806
547 Ga0495619_0004150 3300053085 Bacteria 9258
548 Ga0495619_0064520 3300053085 Bacteria 2442
549 Ga0500588_0349046 3300053146 Unclassified 562
550 Ga0500588_0421859 3300053146 Unclassified 508
551 Ga0501084_1365338 3300054114 Bacteria 594
552 Ga0501084_1849623 3300054114 Bacteria 504
553 Ga0590075_173165 3300059424 Unclassified 570
554 Ga0590077_180344 3300059426 Unclassified 510
555 Ga0587091_176744 3300059511 Unclassified 559
556 Ga0501034_0012433
557 JGI24751J29686_10097839
558 Ga0065714_10114025
559 Ga0065704_10338076
560 Ga0065712_10025782
561 Ga0065712_10075102
562 Ga0065712_10077156
563 Ga0065712_10118185
564 Ga0065712_10258903
565 Ga0065715_10215471
566 Ga0065715_10464427
567 Ga0065715_10584288
568 Ga0065707_10017201
569 Ga0065707_10547855
570 Ga0065707_10744863
571 Ga0070658_11712875
572 Ga0070676_10434367
573 Ga0070683_100178849
574 Ga0070683_101754556
575 Ga0070670_100036052
576 Ga0070670_100071056
577 Ga0070670_100236813
578 Ga0070670_100406903
579 Ga0070670_101055755
580 Ga0070677_10133537
581 Ga0068869_101524219
582 Ga0070666_10247364
583 Ga0070666_11308392
584 Ga0070680_100142132
585 Ga0070682_101374993
586 Ga0068868_100083286
587 Ga0068868_100103090
588 Ga0068868_100113801
589 Ga0068868_100141518
590 Ga0070660_100005945
591 Ga0070660_100137974
592 Ga0070689_100026105
593 Ga0070689_100095640
594 Ga0070689_100521279
595 Ga0070689_100824944
596 Ga0070691_10462471
597 Ga0070687_100129615
598 Ga0070661_100050914
599 Ga0070692_10581867
600 Ga0070692_10847386
601 Ga0070668_102265325
602 Ga0070669_100026128
603 Ga0070669_100181421
604 Ga0070675_100009110
605 Ga0070675_100061205
606 Ga0070675_100090281
607 Ga0070675_100390417
608 Ga0070675_100983030
609 Ga0070675_101001520
610 Ga0070675_101297846
611 Ga0070674_100160411
612 Ga0070674_100299736
613 Ga0070674_100450642
614 Ga0070674_101582364
615 Ga0070673_100010567
616 Ga0070673_100109786
617 Ga0070688_100246642
618 Ga0070688_100269234
619 Ga0070688_100348868
620 Ga0070688_100892079
621 Ga0070659_100248657
622 Ga0070667_100780278
623 Ga0070667_101045238
624 Ga0070703_10545886
625 Ga0070709_11605772
626 Ga0070711_101335587
627 Ga0070694_100055142
628 Ga0070694_100312658
629 Ga0070708_100633403
630 Ga0070678_100073387
631 Ga0070678_100130686
632 Ga0070678_100210393
633 Ga0070662_100909463
634 Ga0070662_101066473
635 Ga0070681_10156922
636 Ga0070707_100388332
637 Ga0070699_101132669
638 Ga0070679_100015065
639 Ga0070679_100112084
640 Ga0070684_101102718
641 Ga0070697_100346888
642 Ga0070697_101631418
643 Ga0070672_100495970
644 Ga0070686_100295776
645 Ga0070686_100337711
646 Ga0070695_100289992
647 Ga0070693_100440465
648 Ga0070665_100003554
649 Ga0070665_100174989
650 Ga0070665_101799423
651 Ga0070704_101586519
652 Ga0068855_100047983
653 Ga0068855_101062366
654 Ga0068855_101131445
655 Ga0070664_100315838
656 Ga0068857_102418440
657 Ga0068854_100360750
658 Ga0068854_101670858
659 Ga0068856_100467476
660 Ga0068856_101658355
661 Ga0068856_102483045
662 Ga0068852_100976868
663 Ga0068852_101532927
664 Ga0068859_100015365
665 Ga0068859_102726459
666 Ga0068864_100021441
667 Ga0068864_100101923
668 Ga0068864_100145376
669 Ga0068864_100293061
670 Ga0068864_100890126
671 Ga0068861_100376591
672 Ga0068861_101039778
673 Ga0068863_100023151
674 Ga0068863_100044810
675 Ga0068863_100374563
676 Ga0068863_100533210
677 Ga0068858_100001318
678 Ga0068858_100004901
679 Ga0068858_100185390
680 Ga0068858_100343119
681 Ga0068858_100862521
682 Ga0068860_100492419
683 Ga0068860_101112092
684 Ga0068860_102361499
685 Ga0068862_100209972
686 Ga0068862_100403532
687 Ga0068862_100673649
688 Ga0068862_102337540
689 Ga0081539_10079984
690 Ga0070717_10608070
691 Ga0070715_10139481
692 Ga0070716_100058618
693 Ga0070716_100356014
694 Ga0075366_10152829
695 Ga0097621_100012194
696 Ga0097621_100050021
697 Ga0097621_100120254
698 Ga0097621_101711850
699 Ga0068871_100002033
700 Ga0068871_100093416
701 Ga0068871_100117326
702 Ga0068871_100543099
703 Ga0068871_101501821
704 Ga0075428_100078541
705 Ga0075428_102166651
706 Ga0075430_100338152
707 Ga0075430_100376784
708 Ga0075431_100042856
709 Ga0075431_100060411
710 Ga0075431_100125465
711 Ga0075431_100774240
712 Ga0075433_10151111
713 Ga0075434_100012281
714 Ga0075434_100625547
715 Ga0075434_101699919
716 Ga0075429_100074739
717 Ga0075429_100270379
718 Ga0075429_100344747
719 Ga0075429_100533142
720 Ga0068865_100022699
721 Ga0075436_100109921
722 Ga0075436_100697211
723 Ga0097620_100015365
724 Ga0097620_102725898
725 Ga0075435_100094828
726 Ga0075435_100209664
727 Ga0105251_10494930
728 Ga0105240_10411146
729 Ga0105240_11306416
730 Ga0111539_10034444
731 Ga0111539_10040158
732 Ga0111539_10073440
733 Ga0111539_10106728
734 Ga0111539_10629901
735 Ga0111539_11516240
736 Ga0111539_11737531
737 Ga0105245_10017926
738 Ga0105245_10173745
739 Ga0105245_10550287
740 Ga0105245_11029092
741 Ga0105245_11454674
742 Ga0105245_12485823
743 Ga0105245_12622729
744 Ga0105247_10030356
745 Ga0114129_10035666
746 Ga0114129_10095327
747 Ga0114129_10127070
748 Ga0114129_10199894
749 Ga0114129_10203132
750 Ga0114129_10900194
751 Ga0114129_12534748
752 Ga0105243_12397337
753 Ga0105243_12860306
754 Ga0105241_11226068
755 Ga0105241_11244266
756 Ga0105242_10002076
757 Ga0105242_10032302
758 Ga0105242_10371304
759 Ga0105242_10627317
760 Ga0105242_11255197
761 Ga0105242_11278780
762 Ga0105248_10008235
763 Ga0105248_10202435
764 Ga0105248_10240294
765 Ga0105248_10457194
766 Ga0105248_11155557
767 Ga0105248_11770537
768 Ga0105237_12048077
769 Ga0105237_12456706
770 Ga0105238_10312316
771 Ga0105238_10344061
772 Ga0105249_10237485
773 Ga0105249_11169514
774 Ga0105239_11072275
775 Ga0105239_12893553
776 Ga0105246_11310521
777 Ga0157314_1045001
778 Ga0157338_1053272
779 Ga0157370_10974358
780 Ga0157370_11074650
781 Ga0157374_10002657
782 Ga0157374_11869433
783 Ga0157378_10274058
784 Ga0157378_12819475
785 Ga0163162_10033907
786 Ga0163162_10185046
787 Ga0163162_10839752
788 Ga0163162_11533156
789 Ga0163162_12819484
790 Ga0157372_10259931
791 Ga0157375_10254566
792 Ga0157375_10299847
793 Ga0157375_11568174
794 Ga0157375_11797142
795 Ga0157375_12765563
796 Ga0163163_10013598
797 Ga0163163_10016066
798 Ga0163163_10026496
799 Ga0163163_11131023
800 Ga0163163_12448426
801 Ga0157380_10235152
802 Ga0157380_10345904
803 Ga0157380_11652278
804 Ga0157377_10214685
805 Ga0157377_10959158
806 Ga0157379_10878831
807 Ga0157379_11131764
808 Ga0157379_11573590
809 Ga0157376_10011761
810 Ga0157376_10548394
811 Ga0157376_10743211
812 Ga0163161_10876076
813 Ga0224712_10589991
814 Ga0207697_10487925
815 Ga0207697_10507178
816 Ga0207656_10252514
817 Ga0207653_10390959
818 Ga0207682_10051708
819 Ga0207682_10093419
820 Ga0207682_10308192
821 Ga0207688_10621307
822 Ga0207688_10890020
823 Ga0207680_10057416
824 Ga0207699_10217330
825 Ga0207643_10076865
826 Ga0207643_10373917
827 Ga0207654_11038353
828 Ga0207695_11075160
829 Ga0207660_10703232
830 Ga0207662_10422864
831 Ga0207657_10001144
832 Ga0207657_10100004
833 Ga0207649_10168425
834 Ga0207652_10287278
835 Ga0207652_10340758
836 Ga0207646_10737571
837 Ga0207681_10096797
838 Ga0207681_11171369
839 Ga0207650_10049774
840 Ga0207650_10166514
841 Ga0207650_10341135
842 Ga0207650_10538403
843 Ga0207650_10638773
844 Ga0207659_10005490
845 Ga0207659_10026676
846 Ga0207659_10246429
847 Ga0207659_10265734
848 Ga0207659_10290926
849 Ga0207659_10674803
850 Ga0207659_11745195
851 Ga0207687_10308195
852 Ga0207687_10444089
853 Ga0207644_10981229
854 Ga0207644_11034203
855 Ga0207690_10428085
856 Ga0207706_10953268
857 Ga0207686_10007531
858 Ga0207686_10076345
859 Ga0207686_10211292
860 Ga0207686_10552229
861 Ga0207686_11610031
862 Ga0207670_10059012
863 Ga0207670_10111471
864 Ga0207670_10679958
865 Ga0207669_10281484
866 Ga0207704_10190357
867 Ga0207704_10411394
868 Ga0207704_10411999
869 Ga0207665_10017925
870 Ga0207665_10047293
871 Ga0207691_10182797
872 Ga0207691_10731836
873 Ga0207711_10049598
874 Ga0207711_10300601
875 Ga0207711_10377278
876 Ga0207711_10758842
877 Ga0207711_10794831
878 Ga0207711_11219448
879 Ga0207689_10788656
880 Ga0207661_11293347
881 Ga0207661_11490100
882 Ga0207679_10100086
883 Ga0207679_10272988
884 Ga0207679_10857028
885 Ga0207679_11527034
886 Ga0207667_10177306
887 Ga0207667_10362541
888 Ga0207667_12088735
889 Ga0207651_10013993
890 Ga0207651_10239372
891 Ga0207651_11135373
892 Ga0207712_10275319
893 Ga0207712_11649615
894 Ga0207668_10527208
895 Ga0207640_10423752
896 Ga0207658_11091772
897 Ga0207677_10082662
898 Ga0207677_10128227
899 Ga0207677_10141372
900 Ga0207703_10005411
901 Ga0207703_10013580
902 Ga0207703_10032088
903 Ga0207703_10461715
904 Ga0207678_11837160
905 Ga0207708_10267849
906 Ga0207708_10585344
907 Ga0207702_10463796
908 Ga0207702_10489231
909 Ga0207641_10225233
910 Ga0207641_10383922
911 Ga0207641_10509645
912 Ga0207648_11142969
913 Ga0207676_10013448
914 Ga0207676_10027935
915 Ga0207676_10119250
916 Ga0207676_10174260
917 Ga0207676_10208570
918 Ga0207676_10213425
919 Ga0207676_10296509
920 Ga0207676_10329986
921 Ga0207676_10510435
922 Ga0207676_10713622
923 Ga0207676_11619528
924 Ga0207674_10206829
925 Ga0207674_10785218
926 Ga0207675_100061324
927 Ga0207683_10004066
928 Ga0207683_10156816
929 Ga0207683_10261943
930 Ga0207683_10579679
931 Ga0210002_1026741
932 Ga0209971_1008761
933 Ga0209974_10007850
934 Ga0207428_10023815
935 Ga0207428_10392677
936 Ga0268266_10036398
937 Ga0268266_10055887
938 Ga0268266_10166617
939 Ga0268266_10945747
940 Ga0268265_11233581
941 Ga0268265_11241759
942 Ga0268265_12322513
943 Ga0268265_12374833
944 Ga0268264_10184333
945 Ga0268264_10207500
946 Ga0268264_10333307
947 Ga0268264_11530268
948 Ga0268264_11811611
949 Ga0307408_100046801
950 Ga0307408_100738826
951 Ga0307408_102480626
952 Ga0307406_10712962
953 Ga0307407_11111495
954 Ga0307409_100913261
955 Ga0307416_100171348
956 Ga0307416_103822289
957 Ga0307411_10157532
958 Ga0307411_11514256
959 Ga0307415_100523473
960 Ga0373948_0050466
961 Ga0373955_0817064
962 Ga0373961_0045737
963 Ga0373931_0683026
964 Ga0373931_1272828
965 Ga0373935_0743516
966 Ga0373927_0364444
967 Ga0373933_0207499
968 Ga0373937_0081415
969 Ga0373937_0499345
970 Ga0373937_0693933
971 Ga0373937_1639573
972 Ga0439453_0000845
973 Ga0439453_0008065
974 Ga0439453_0048548
975 Ga0451839_0537203
976 Ga0451853_3534482
977 Ga0451853_3938810
978 Ga0439457_094233
979 Ga0439435_0000840
980 Ga0439435_0070283
981 Ga0439464_0025325
982 Ga0453683_0491334
983 Ga0466957_1347656
984 Ga0451576_2065721
985 Ga0495629_1099235
986 Ga0495638_0010842
987 Ga0495651_0398544
988 Ga0495664_0627467
989 Ga0495652_0599355
990 Ga0495621_0205741
991 Ga0495645_0000774
992 Ga0495645_0418618
993 Ga0495622_0364250
994 Ga0495635_0184980
995 Ga0495647_0056987
996 Ga0495647_0160706
997 Ga0495647_0214231
998 Ga0495647_0236680
999 Ga0495658_0019146
1000 Ga0495658_0231205
1001 Ga0495674_0324903
1002 Ga0495675_0801970
1003 Ga0495684_0034530
1004 Ga0495684_0602743
1005 Ga0496101_0067661
1006 Ga0496101_0805749
1007 Ga0496102_0012205
1008 Ga0496103_0171262
1009 Ga0496104_0210466
1010 Ga0496104_0211922
1011 Ga0496104_0409263
1012 Ga0496104_0886853
1013 Ga0496104_0911018
1014 Ga0496105_0282592
1015 Ga0496106_0239688
1016 Ga0496107_0740402
1017 Ga0496107_0802511
1018 Ga0496108_0289398
1019 Ga0496108_0766629
1020 Ga0496108_0903294
1021 Ga0496109_0239597
1022 Ga0496109_0633698
1023 Ga0496110_0106415
1024 Ga0496112_0010301
1025 Ga0496112_0176080
1026 Ga0496112_0240766
1027 Ga0496113_0065006
1028 Ga0496113_0148362
1029 Ga0496114_0024256
1030 Ga0496114_0127253
1031 Ga0496115_0061177
1032 Ga0501031_0135015
1033 Ga0501036_0018743
1034 Ga0501036_0229463
1035 Ga0501036_0964115
1036 Ga0501036_1034202
1037 Ga0501040_0012710
1038 Ga0501040_1405966
1039 Ga0501041_1127665
1040 Ga0501042_0016139
1041 Ga0501046_0281276
1042 Ga0501047_0020449
1043 Ga0501048_0011914
1044 Ga0501048_0736824
1045 Ga0501067_0317409
1046 Ga0501068_0987334
1047 Ga0501069_0402882
1048 Ga0501071_0029544
1049 Ga0501072_0149937
1050 Ga0501073_0293453
1051 Ga0501073_0558909
1052 Ga0501076_0706823
1053 Ga0501077_0009219
1054 Ga0501077_0776405
1055 Ga0501077_0896136
1056 Ga0501217_266608
1057 Ga0501079_0231022
1058 Ga0501080_0526050
1059 Ga0501080_0876248
1060 Ga0501044_0001483
1061 Ga0501045_0637146
1062 nmdc:mga0k408_174598_c1
1063 nmdc:mga06z11_59186_c2
1064 nmdc:mga05p37_1156607_c1
1065 nmdc:mga05p37_127187_c1
1066 nmdc:mga05p37_14672_c1
1067 nmdc:mga05p37_1782028_c1
1068 nmdc:mga05p37_340789_c1
1069 nmdc:mga05p37_60657_c1
1070 nmdc:mga05p37_662777_c1
1071 nmdc:mga09592_109547_c1
1072 nmdc:mga09592_1105237_c1
1073 nmdc:mga09592_1682254_c1
1074 nmdc:mga09592_317353_c1
1075 nmdc:mga09592_95353_c1
1076 nmdc:mga0qj67_34098_c1
1077 nmdc:mga0qj67_38860_c1
1078 nmdc:mga06r32_672326_c1
1079 nmdc:mga06r32_9901_c1
1080 nmdc:mga08y16_126468_c1
1081 nmdc:mga08y16_1385005_c1
1082 nmdc:mga08y16_18709_c1
1083 nmdc:mga08y16_2000815_c1
1084 nmdc:mga08y16_21215_c1
1085 nmdc:mga08y16_277858_c1
1086 nmdc:mga08y16_318254_c1
1087 nmdc:mga08y16_8409_c1
1088 nmdc:mga0n895_1289291_c1
1089 nmdc:mga0n895_1747761_c1
1090 nmdc:mga0n895_349975_c1
1091 nmdc:mga0n895_37660_c1
1092 nmdc:mga0n895_650_c1
1093 nmdc:mga0n895_929653_c1
1094 nmdc:mga0rr50_451013_c1
1095 nmdc:mga0rr50_726536_c1
1096 nmdc:mga0rr50_8_c1
1097 nmdc:mga08x19_586036_c1
1098 nmdc:mga08x19_906_c1
1099 nmdc:mga0a205_150292_c1
1100 Ga0495601_0017299
1101 Ga0495601_0477239
1102 Ga0495619_0004150
1103 Ga0495619_0064520
1104 Ga0500588_0349046
1105 Ga0500588_0421859
1106 Ga0501084_1365338
1107 Ga0501084_1849623
1108 Ga0590075_173165
1109 Ga0590077_180344
1110 Ga0587091_176744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y0o-assembly1.cif.gz_A-2 the structure of a d-lyxose isomerase from the sigmab regulon of bacillus subtilis 0.8983 15 109
5vg3-assembly1.cif.gz_A structure of oxalate decarboxylase from bacillus subtilis at ph 4.6 0.8976 6 110
2uy8-assembly1.cif.gz_A r92a mutant of bacillus subtilis oxalate decarboxylase oxdc 0.8962 6 110
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.8961 16 101
1gqg-assembly2.cif.gz_B quercetin 2,3-dioxygenase in complex with the inhibitor diethyldithiocarbamate 0.8954 8 100
ID Description Score Start End Superfamily
2vqaB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.902 7 101 2.60.120.10
1l3jA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8977 7 110 2.60.120.10
5fljL00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8938 8 102 2.60.120.10
1gqhB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8934 8 102 2.60.120.10
af_Q9S772_37_227_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8929 25 110 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2D6MEI5-F1-model_v4 Mannose-6-phosphate isomerase type II C-terminal domain-containing protein 0.9798 7 112 GO:0005976
GO:0016779
AF-A0A7C3LW36-F1-model_v4 Cupin 0.9793 7 112 GO:0005976
GO:0016779
AF-A0A2D6RLH4-F1-model_v4 Cupin 0.9781 7 112 GO:0005976
GO:0016779
AF-A0A2E1E8Z6-F1-model_v4 Mannose-6-phosphate isomerase type II C-terminal domain-containing protein 0.9754 5 112 GO:0005976
GO:0016779
AF-A0A3R7B337-F1-model_v4 Cupin domain-containing protein 0.9679 6 112 GO:0005976
GO:0016779

Map