F463136

General Info

Members Datasets Scaffolds Average Seq Length
555 418 1110 357

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0010980|Ga0466966_0010980_4441_5709
Length 422
Sequence MSASDRYAGRSALPSTSVGQTDADRPEIREVGTRGLASLRPLTRNRRGPFTPIRECPMAAVSYVDATCVYPGNPVPAVDTLNLDIKDGEFMVLVGPSGSGKSTALRMLAGLEDVSSGSITIDGVDVSNAPPKDRDIAMVFQNYALYPHMTVGENMGFALKLKGVPKAERQKKVAEVAKILGLEEFLERKPKALSGGQRQRVAMGRAIVREPKVFLMDEPLSNLDAKLRVETRANVAALQARLGTTTVYVTHDQVEAMTMGHRVAVLRDGKLQQCDTPRNLYDKPGNAFVAGFIGSPAMNLRKVKVVSGGVQFGDMVVPLQPDVTAAVNDANLSEVTLGLRPEAFAPTANGNAITLTVDLVEELGADSYVHARLPGDDPLIDQHLVVRFEERFTPRIGDVIKVGVRSEEEHVFNPDTGARLGA

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
48 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
108 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
217 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
218 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
219 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
220 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
221 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
222 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
223 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
224 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
225 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
226 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
227 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
228 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
229 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
230 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
231 2516143018 Ensifer sp. BR816 Isolate Nodule
232 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
233 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
234 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
235 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
236 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
237 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
238 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
239 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
240 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
241 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
242 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
243 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
244 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
245 2643221651 Afipia sp. Root123D2 Isolate Unclassified
246 2718217882 Rhizobium sp. N741 Isolate Nodule
247 2718217927 Rhizobium sp. N324 Isolate Nodule
248 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
249 2718218009 Rhizobium sp. N561 Isolate Nodule
250 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
251 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
252 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
253 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
254 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
255 2718218363 Rhizobium sp. N113 Isolate Nodule
256 2718218365 Rhizobium sp. N731 Isolate Nodule
257 2718218366 Rhizobium sp. N621 Isolate Nodule
258 2718218423 Rhizobium sp. N941 Isolate Nodule
259 2721755514 Rhizobium sp. N6212 Isolate Nodule
260 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
261 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
262 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
263 2721755809 Rhizobium sp. N541 Isolate Nodule
264 2721755810 Rhizobium sp. N871 Isolate Nodule
265 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
266 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
267 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
268 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
269 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
270 2728369365 Rhizobium sp. N1341 Isolate Nodule
271 2728369397 Rhizobium sp. N1314 Isolate Nodule
272 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
273 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
274 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
275 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
276 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
277 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
278 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
279 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
280 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
281 2791355256 Rhizobium sp. M10 Isolate Nodule
282 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
283 2791355260 Rhizobium sp. L9 Isolate Nodule
284 2791355261 Rhizobium sp. J15 Isolate Nodule
285 2791355262 Rhizobium sp. M1 Isolate Nodule
286 2791355263 Rhizobium chutanense C5 Isolate Nodule
287 2791355264 Rhizobium sp. S9 Isolate Nodule
288 2791355265 Rhizobium sp. H4 Isolate Nodule
289 2791355266 Rhizobium sp. L43 Isolate Nodule
290 2791355267 Rhizobium sp. L18 Isolate Nodule
291 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
292 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
293 2802429633 Rhizobium anhuiense J3 Isolate Nodule
294 2802429634 Rhizobium anhuiense S10 Isolate Nodule
295 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
296 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
297 2802429637 Rhizobium anhuiense C15 Isolate Nodule
298 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
299 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
300 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
301 2838048938 Rhizobium pisi 27/80 Isolate Nodule
302 2838061910 Rhizobium phaseoli L15 Isolate Nodule
303 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
304 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
305 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
306 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
307 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
308 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
309 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
310 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
311 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
312 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
313 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
314 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
315 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
316 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
317 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
318 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
319 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
320 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
321 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
322 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
323 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
324 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
325 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
326 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
327 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
328 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
329 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
330 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
331 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
332 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
333 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
334 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
335 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
336 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
337 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
338 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
339 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
340 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
341 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
342 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
343 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
344 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
345 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
346 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
347 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
348 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
349 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
350 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
351 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
352 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
353 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
354 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
355 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
356 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
357 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
358 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
359 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
360 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
361 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
362 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
363 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
364 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
365 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
366 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
367 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
368 2922554459 Rhodococcus sp. 66b Isolate Unclassified
369 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
370 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
371 2933599457 Rhizobium phaseoli M3 Isolate Nodule
372 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
373 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
374 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
375 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
376 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
377 2936381700 Rhizobium chutanense C16 Isolate Unclassified
378 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
379 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
380 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
381 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
382 2996893221 Rhizobium sp. R635 Isolate Nodule
383 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
384 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
385 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
386 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
387 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
388 8005275841 Rhizobium sp. N4311 Isolate Nodule
389 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
390 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
391 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
392 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
393 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
394 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
395 8005382845 Rhizobium sp. R634 Isolate Nodule
396 8005395548 Rhizobium sp. R339 Isolate Nodule
397 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
398 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
399 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
400 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
401 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
402 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
403 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
404 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
405 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
406 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
407 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
408 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
409 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
410 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
411 8018176218 Rhizobium sp. N122 Isolate Nodule
412 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
413 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
414 8024501048 Rhizobium sp. H4 Isolate Nodule
415 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
416 8056382006 Rhizobium croatiense 13T Isolate Nodule
417 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
418 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.7
Metatranscriptomes 0.54
Isolates 36.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 14.77
Nodule 29.01
Rhizoplane 3.06
Rhizosphere 44.68
Stem 0
Stem Tuber 0.18
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0010980 3300044684 Bacteria 6011
2 JGI25159J45721_1002194 3300002987 Bacteria 7593
3 Ga0006778J45830_1030432 3300003162 Bacteria 1344
4 JGI25151J46595_10000508 3300003187 Bacteria 36520
5 JGI25406J46586_10000433 3300003203 Bacteria 19355
6 JGI25153J46596_10000302 3300003215 Bacteria 36803
7 JGI25153J46596_10006535 3300003215 Bacteria 5878
8 JGI25153J46596_10011027 3300003215 Bacteria 4029
9 Ga0006777J48905_1046470 3300003308 Bacteria 1337
10 JGI25160J50197_1001578 3300003354 Bacteria 11244
11 JGI25160J50197_1012442 3300003354 Bacteria 2953
12 JGI25161J50226_1000075 3300003374 Bacteria 84775
13 JGI25161J50226_1003688 3300003374 Bacteria 3423
14 Ga0007416J51690_1022159 3300003577 Bacteria 1347
15 Ga0055526_1004947 3300003771 Bacteria 7826
16 Ga0055526_1007334 3300003771 Bacteria 5761
17 Ga0055526_1010170 3300003771 Bacteria 4412
18 Ga0055524_1006216 3300003775 Bacteria 5210
19 Ga0055524_1006521 3300003775 Bacteria 5052
20 Ga0055524_1006553 3300003775 Bacteria 5036
21 Ga0055528_1000054 3300003790 Bacteria 90334
22 Ga0055528_1002349 3300003790 Bacteria 10235
23 Ga0055528_1010065 3300003790 Bacteria 3885
24 Ga0055540_1000255 3300003792 Bacteria 48177
25 Ga0055540_1013717 3300003792 Bacteria 2458
26 Ga0055543_1000096 3300004625 Bacteria 75972
27 Ga0065165_1007353 3300005262 Bacteria 5443
28 Ga0070668_100269910 3300005347 Bacteria 1418
29 Ga0070713_100069522 3300005436 Bacteria 2969
30 Ga0070713_100116093 3300005436 Bacteria 2341
31 Ga0070710_10001891 3300005437 Bacteria 9901
32 Ga0070663_100043637 3300005455 Bacteria 3156
33 Ga0070707_100021286 3300005468 Bacteria 6129
34 Ga0070707_100114099 3300005468 Bacteria 2622
35 Ga0068853_100209651 3300005539 Bacteria 1775
36 Ga0068854_100117886 3300005578 Bacteria 2011
37 Ga0068856_100236940 3300005614 Bacteria 1840
38 Ga0068852_100272265 3300005616 Bacteria 1630
39 Ga0068858_100183247 3300005842 Bacteria 1978
40 Ga0081455_10039977 3300005937 Bacteria 4140
41 Ga0081538_10046713 3300005981 Bacteria 2666
42 Ga0081540_1006260 3300005983 Bacteria 8713
43 Ga0081539_10000549 3300005985 Bacteria 77428
44 Ga0075365_10000426 3300006038 Bacteria 15611
45 Ga0075365_10049881 3300006038 Bacteria 2759
46 Ga0075365_10093913 3300006038 Bacteria 2046
47 Ga0075365_10120270 3300006038 Bacteria 1811
48 Ga0075365_10122827 3300006038 Bacteria 1793
49 Ga0075368_10044017 3300006042 Bacteria 1760
50 Ga0075364_10003990 3300006051 Bacteria 8470
51 Ga0075364_10008917 3300006051 Bacteria 6008
52 Ga0075364_10014844 3300006051 Bacteria 4820
53 Ga0070712_100069302 3300006175 Bacteria 2516
54 Ga0075362_10020272 3300006177 Bacteria 2776
55 Ga0075367_10031946 3300006178 Bacteria 3026
56 Ga0075369_10008201 3300006186 Bacteria 4011
57 Ga0075369_10022082 3300006186 Bacteria 2623
58 Ga0075370_10002191 3300006353 Bacteria 8971
59 Ga0075434_100068928 3300006871 Bacteria 3525
60 Ga0097620_100005795 3300006931 Bacteria 12549
61 Ga0105240_10006559 3300009093 Bacteria 17088
62 Ga0105240_10213235 3300009093 Bacteria 2255
63 Ga0105245_10053786 3300009098 Bacteria 3614
64 Ga0105247_10008443 3300009101 Bacteria 6275
65 Ga0105241_10145841 3300009174 Bacteria 1931
66 Ga0105237_10001582 3300009545 Bacteria 29631
67 Ga0105237_10483960 3300009545 Bacteria 1244
68 Ga0105238_10002762 3300009551 Bacteria 17514
69 Ga0123341_1000012 3300009765 Bacteria 105056
70 Ga0123342_1030913 3300009766 Bacteria 2639
71 Ga0105239_10001198 3300010375 Bacteria 35468
72 Ga0163162_10360006 3300013306 Bacteria 1588
73 Ga0213875_10002422 3300021388 Bacteria 11188
74 Ga0213875_10017304 3300021388 Bacteria 3484
75 Ga0209436_100035 3300025208 Bacteria 79010
76 Ga0209129_1003154 3300025258 Bacteria 7387
77 Ga0209673_1000067 3300025273 Bacteria 249077
78 Ga0209673_1000750 3300025273 Bacteria 44330
79 Ga0209673_1001376 3300025273 Bacteria 23910
80 Ga0209673_1002427 3300025273 Bacteria 12963
81 Ga0209673_1004094 3300025273 Bacteria 8025
82 Ga0209130_1000031 3300025284 Bacteria 322932
83 Ga0209025_1000397 3300025294 Bacteria 89703
84 Ga0209564_1000092 3300025295 Bacteria 249018
85 Ga0209564_1000511 3300025295 Bacteria 63773
86 Ga0209564_1000925 3300025295 Bacteria 38190
87 Ga0209758_1000504 3300025297 Bacteria 63308
88 Ga0209758_1000585 3300025297 Bacteria 56861
89 Ga0209758_1006713 3300025297 Bacteria 8111
90 Ga0209758_1010123 3300025297 Bacteria 5709
91 Ga0209050_1004942 3300025298 Bacteria 8693
92 Ga0209256_1000170 3300025299 Bacteria 130504
93 Ga0209256_1004342 3300025299 Bacteria 8997
94 Ga0209256_1007078 3300025299 Bacteria 5669
95 Ga0209256_1009391 3300025299 Bacteria 4300
96 Ga0207426_1000042 3300025302 Bacteria 433289
97 Ga0207426_1000355 3300025302 Bacteria 83450
98 Ga0209051_1000062 3300025303 Bacteria 251081
99 Ga0209051_1023955 3300025303 Bacteria 2525
100 Ga0209257_1000970 3300025304 Bacteria 39244
101 Ga0207692_10001625 3300025898 Bacteria 8476
102 Ga0207710_10004334 3300025900 Bacteria 6208
103 Ga0207685_10000084 3300025905 Bacteria 17469
104 Ga0207699_10004982 3300025906 Bacteria 6350
105 Ga0207695_10010499 3300025913 Bacteria 11328
106 Ga0207671_10001614 3300025914 Bacteria 25651
107 Ga0207646_10020312 3300025922 Bacteria 6155
108 Ga0207646_10119088 3300025922 Bacteria 2372
109 Ga0207694_10006920 3300025924 Bacteria 8609
110 Ga0207687_10095488 3300025927 Bacteria 2177
111 Ga0207700_10004729 3300025928 Bacteria 8076
112 Ga0207700_10007267 3300025928 Bacteria 6758
113 Ga0207700_10062087 3300025928 Bacteria 2837
114 Ga0207664_10001469 3300025929 Bacteria 15461
115 Ga0207664_10052628 3300025929 Bacteria 3220
116 Ga0207664_10066221 3300025929 Bacteria 2895
117 Ga0207664_10073182 3300025929 Bacteria 2765
118 Ga0207669_10027886 3300025937 Bacteria 3099
119 Ga0207648_10065979 3300026089 Bacteria 3156
120 Ga0207698_10003168 3300026142 Bacteria 9865
121 Ga0209813_10005880 3300027866 Bacteria 3006
122 Ga0307409_100464050 3300031995 Bacteria 1225
123 Ga0307416_100260386 3300032002 Bacteria 1695
124 Ga0316214_1000327 3300033545 Bacteria 4631
125 Ga0373934_0013842 3300035086 Bacteria 3052
126 Ga0373934_0023170 3300035086 Bacteria 2398
127 Ga0373944_0007109 3300035089 Bacteria 2993
128 Ga0373923_0028833 3300035111 Bacteria 2222
129 Ga0373936_0003887 3300035113 Bacteria 5630
130 Ga0373941_0022473 3300035115 Bacteria 1790
131 Ga0373953_0008250 3300035117 Bacteria 3530
132 Ga0373953_0079272 3300035117 Bacteria 1363
133 Ga0373956_0031986 3300035119 Bacteria 2307
134 Ga0373957_0043176 3300035120 Bacteria 1703
135 Ga0373943_0019917 3300035170 Bacteria 3090
136 Ga0373955_0073595 3300035172 Bacteria 1915
137 Ga0373961_0040937 3300035241 Bacteria 1337
138 Ga0373924_0050018 3300035410 Bacteria 1731
139 Ga0373935_0067894 3300035692 Bacteria 2293
140 Ga0373927_0020945 3300035695 Bacteria 4286
141 Ga0373933_0003612 3300035724 Bacteria 8578
142 Ga0373933_0065984 3300035724 Bacteria 2192
143 Ga0373947_0133965 3300035725 Bacteria 1584
144 Ga0373937_0004094 3300036401 Bacteria 12371
145 Ga0373937_0012421 3300036401 Bacteria 7490
146 Ga0373937_0067909 3300036401 Bacteria 3286
147 Ga0316584_0066251 3300036712 Bacteria 2706
148 Ga0373925_0000245 3300037068 Bacteria 57711
149 Ga0373925_0007347 3300037068 Bacteria 8043
150 Ga0373925_0018535 3300037068 Bacteria 5059
151 Ga0373925_0029100 3300037068 Bacteria 4052
152 Ga0395898_0016663 3300037466 Bacteria 7511
153 Ga0395898_0170844 3300037466 Bacteria 2078
154 Ga0395905_0020574 3300037471 Bacteria 6248
155 Ga0436364_0258924 3300037853 Bacteria 15643
156 Ga0436364_0593349 3300037853 Bacteria 3839
157 Ga0395901_0194785 3300038443 Bacteria 2125
158 Ga0436363_1067117 3300039450 Bacteria 3274
159 Ga0451853_1019146 3300041512 Bacteria 7271
160 Ga0439449_0004309 3300042007 Bacteria 5496
161 Ga0439462_0004678 3300042015 Bacteria 3348
162 Ga0466966_0137113 3300044684 Bacteria 1496
163 Ga0466963_0000256 3300044694 Bacteria 23361
164 Ga0466963_0056015 3300044694 Bacteria 2623
165 Ga0466963_0065845 3300044694 Bacteria 2430
166 Ga0466964_0035038 3300044706 Bacteria 2005
167 Ga0466959_0084113 3300045049 Bacteria 2290
168 Ga0466958_0036362 3300045836 Bacteria 2947
169 Ga0466967_0040414 3300045976 Bacteria 4015
170 Ga0466967_0059585 3300045976 Bacteria 3380
171 Ga0466967_0070163 3300045976 Bacteria 3134
172 Ga0495592_0005282 3300046454 Bacteria 9520
173 Ga0495592_0012799 3300046454 Bacteria 6378
174 Ga0495592_0049324 3300046454 Bacteria 3129
175 Ga0495629_0048828 3300046459 Bacteria 2967
176 Ga0495629_0203750 3300046459 Bacteria 1367
177 Ga0495638_0000475 3300046460 Bacteria 48300
178 Ga0495638_0082741 3300046460 Bacteria 1946
179 Ga0495641_0019344 3300046461 Bacteria 3487
180 Ga0495641_0034621 3300046461 Bacteria 2386
181 Ga0495641_0036652 3300046461 Bacteria 2304
182 Ga0495651_0002066 3300046462 Bacteria 15492
183 Ga0495651_0013735 3300046462 Bacteria 6262
184 Ga0495653_0009695 3300046463 Bacteria 7874
185 Ga0495653_0073264 3300046463 Bacteria 2556
186 Ga0495653_0076807 3300046463 Bacteria 2481
187 Ga0495653_0122882 3300046463 Bacteria 1847
188 Ga0495605_0059298 3300046474 Bacteria 1838
189 Ga0495662_0026789 3300046476 Bacteria 2784
190 Ga0495664_0015511 3300046477 Bacteria 4332
191 Ga0495664_0063883 3300046477 Bacteria 2194
192 Ga0495585_0008333 3300046492 Bacteria 6287
193 Ga0495594_0123906 3300046499 Bacteria 1462
194 Ga0495596_0037943 3300046500 Bacteria 1905
195 Ga0495607_0056076 3300046501 Bacteria 2263
196 Ga0495608_0011152 3300046511 Bacteria 6256
197 Ga0495608_0033366 3300046511 Bacteria 3480
198 Ga0495608_0041948 3300046511 Bacteria 3060
199 Ga0495610_0041661 3300046512 Bacteria 2303
200 Ga0495618_0032951 3300046514 Bacteria 3247
201 Ga0495618_0069935 3300046514 Bacteria 2232
202 Ga0495618_0139577 3300046514 Bacteria 1550
203 Ga0495628_0008662 3300046516 Bacteria 8711
204 Ga0495628_0053388 3300046516 Bacteria 3189
205 Ga0495630_0001360 3300046517 Bacteria 16815
206 Ga0495630_0047247 3300046517 Bacteria 3219
207 Ga0495630_0252102 3300046517 Bacteria 1348
208 Ga0495632_0023298 3300046519 Bacteria 3308
209 Ga0495643_0021930 3300046522 Bacteria 3653
210 Ga0495648_0010754 3300046524 Bacteria 6949
211 Ga0495663_0013087 3300046525 Bacteria 2318
212 Ga0495666_0018688 3300046526 Bacteria 3444
213 Ga0495652_0006264 3300046529 Bacteria 11089
214 Ga0495652_0076993 3300046529 Bacteria 2765
215 Ga0495640_0012451 3300046533 Bacteria 6497
216 Ga0495640_0032193 3300046533 Bacteria 3736
217 Ga0495640_0044750 3300046533 Bacteria 3076
218 Ga0495640_0066294 3300046533 Bacteria 2435
219 Ga0495640_0116046 3300046533 Bacteria 1744
220 Ga0495586_0007270 3300046535 Bacteria 5912
221 Ga0495586_0065838 3300046535 Bacteria 1975
222 Ga0495586_0070335 3300046535 Bacteria 1911
223 Ga0495587_0004220 3300046536 Bacteria 9509
224 Ga0495587_0015119 3300046536 Bacteria 4824
225 Ga0495609_0067888 3300046538 Bacteria 1570
226 Ga0495621_0016989 3300046539 Bacteria 2344
227 Ga0495645_0008007 3300046543 Bacteria 7358
228 Ga0495645_0025788 3300046543 Bacteria 4268
229 Ga0495633_0017374 3300046558 Bacteria 3681
230 Ga0495667_0000527 3300046559 Bacteria 24480
231 Ga0495667_0006240 3300046559 Bacteria 8080
232 Ga0495668_0000043 3300046616 Bacteria 227636
233 Ga0495634_0010448 3300046642 Bacteria 6800
234 Ga0495634_0037127 3300046642 Bacteria 3330
235 Ga0495634_0044210 3300046642 Bacteria 3015
236 Ga0495634_0045279 3300046642 Bacteria 2975
237 Ga0495625_0037963 3300046660 Bacteria 3528
238 Ga0495625_0074507 3300046660 Bacteria 2377
239 Ga0495635_0008812 3300046663 Bacteria 7044
240 Ga0495635_0009393 3300046663 Bacteria 6838
241 Ga0495635_0096523 3300046663 Bacteria 2020
242 Ga0495661_0068206 3300046665 Bacteria 2087
243 Ga0495657_0002073 3300046675 Bacteria 17020
244 Ga0495657_0027361 3300046675 Bacteria 4026
245 Ga0495599_0031043 3300046678 Bacteria 3354
246 Ga0495599_0037685 3300046678 Bacteria 3037
247 Ga0495599_0043973 3300046678 Bacteria 2802
248 Ga0495623_0007850 3300046679 Bacteria 6940
249 Ga0495647_0022451 3300046681 Bacteria 2279
250 Ga0495613_0023642 3300046689 Bacteria 4580
251 Ga0495613_0044541 3300046689 Bacteria 3282
252 Ga0495613_0093780 3300046689 Bacteria 2173
253 Ga0495624_0014984 3300046690 Bacteria 5251
254 Ga0495624_0033771 3300046690 Bacteria 3312
255 Ga0495670_0049092 3300046691 Bacteria 2111
256 Ga0495600_0013996 3300046809 Bacteria 5055
257 Ga0495600_0054356 3300046809 Bacteria 2615
258 Ga0495600_0054485 3300046809 Bacteria 2612
259 Ga0495660_0029512 3300046810 Bacteria 3093
260 Ga0495581_0022849 3300047315 Bacteria 3622
261 Ga0495604_0006231 3300047317 Bacteria 9462
262 Ga0495604_0039359 3300047317 Bacteria 3716
263 Ga0495604_0068836 3300047317 Bacteria 2685
264 Ga0495636_0035377 3300047318 Bacteria 2057
265 Ga0495674_0002886 3300047319 Bacteria 16724
266 Ga0495674_0008383 3300047319 Bacteria 9849
267 Ga0495674_0010753 3300047319 Bacteria 8656
268 Ga0495674_0136068 3300047319 Bacteria 2067
269 Ga0495674_0181733 3300047319 Bacteria 1751
270 Ga0495672_0027403 3300047320 Bacteria 3621
271 Ga0495672_0054098 3300047320 Bacteria 2348
272 Ga0495676_0062630 3300047321 Bacteria 2903
273 Ga0495676_0139954 3300047321 Bacteria 1735
274 Ga0495680_0001251 3300047322 Bacteria 27849
275 Ga0495680_0032306 3300047322 Bacteria 4249
276 Ga0495680_0046165 3300047322 Bacteria 3436
277 Ga0495683_0002342 3300047323 Bacteria 11506
278 Ga0495675_0038655 3300047444 Bacteria 3039
279 Ga0495677_0047020 3300047445 Bacteria 1584
280 Ga0495684_0016432 3300047471 Bacteria 5699
281 Ga0495684_0029261 3300047471 Bacteria 4228
282 Ga0495684_0117288 3300047471 Bacteria 2006
283 Ga0495686_0015129 3300047472 Bacteria 5284
284 Ga0495602_0081689 3300048088 Bacteria 2716
285 Ga0495614_0024930 3300048089 Bacteria 2581
286 Ga0496100_0005890 3300048903 Bacteria 6639
287 Ga0496100_0009032 3300048903 Bacteria 5584
288 Ga0496101_0002535 3300048904 Bacteria 11218
289 Ga0496102_0000029 3300048905 Bacteria 222195
290 Ga0496102_0001044 3300048905 Bacteria 25698
291 Ga0496102_0010976 3300048905 Bacteria 7806
292 Ga0496103_0000143 3300048906 Bacteria 74753
293 Ga0496103_0007336 3300048906 Bacteria 6571
294 Ga0496103_0021706 3300048906 Bacteria 3864
295 Ga0496105_0036068 3300048908 Bacteria 4072
296 Ga0496106_0007534 3300048909 Bacteria 8052
297 Ga0496106_0010831 3300048909 Bacteria 6739
298 Ga0496107_0022072 3300048910 Bacteria 4497
299 Ga0496110_0178211 3300048913 Bacteria 1929
300 Ga0496112_0088395 3300048915 Bacteria 3066
301 Ga0496112_0107680 3300048915 Bacteria 2757
302 Ga0496114_0002202 3300048917 Bacteria 14834
303 Ga0496117_0037175 3300048920 Bacteria 3631
304 Ga0496118_0002068 3300048921 Bacteria 28261
305 Ga0496118_0012604 3300048921 Bacteria 8092
306 Ga0496118_0113216 3300048921 Bacteria 1793
307 Ga0496119_0043646 3300048922 Bacteria 2831
308 Ga0496121_0000239 3300048924 Bacteria 118051
309 Ga0496121_0008048 3300048924 Bacteria 12568
310 Ga0496121_0102165 3300048924 Bacteria 2209
311 Ga0496123_0043322 3300048926 Bacteria 3093
312 Ga0496124_0188952 3300048927 Bacteria 1578
313 Ga0496125_0010847 3300048928 Bacteria 9172
314 Ga0496126_0004802 3300048929 Bacteria 15878
315 Ga0496126_0013697 3300048929 Bacteria 8231
316 Ga0496126_0017262 3300048929 Bacteria 7191
317 Ga0501038_0090073 3300049574 Bacteria 2572
318 Ga0501046_0028159 3300049580 Bacteria 4579
319 Ga0501047_0028779 3300049581 Bacteria 5359
320 Ga0501047_0156270 3300049581 Bacteria 2154
321 Ga0501069_0076571 3300049585 Bacteria 1881
322 Ga0501083_0081721 3300049744 Bacteria 2141
323 Ga0501035_0049351 3300049822 Bacteria 3772
324 nmdc:mga03683_21728_c1 3300050489 Bacteria 2479
325 nmdc:mga03683_90379_c1 3300050489 Bacteria 1334
326 nmdc:mga03n38_104631_c1 3300050490 Bacteria 1370
327 nmdc:mga00v17_14_c1 3300050491 Bacteria 126589
328 nmdc:mga00v17_6312_c1 3300050491 Bacteria 6286
329 nmdc:mga0yw44_106520_c1 3300050492 Bacteria 1792
330 nmdc:mga0yw44_116970_c1 3300050492 Bacteria 1714
331 nmdc:mga0yw44_125351_c1 3300050492 Bacteria 1658
332 nmdc:mga0yw44_41066_c1 3300050492 Bacteria 2752
333 nmdc:mga0yw44_7067_c1 3300050492 Bacteria 5495
334 nmdc:mga0k408_18677_c1 3300050493 Bacteria 3873
335 nmdc:mga0k408_58865_c1 3300050493 Bacteria 2232
336 nmdc:mga06z11_10002_c2 3300050494 Bacteria 2874
337 nmdc:mga06z11_38758_c1 3300050494 Bacteria 2368
338 nmdc:mga07m45_41041_c1 3300050496 Bacteria 2591
339 nmdc:mga08y16_584078_c1 3300050511 Bacteria 1128
340 nmdc:mga0n895_56819_c1 3300050512 Bacteria 3857
341 nmdc:mga08x19_86918_c1 3300050514 Bacteria 2059
342 Ga0495601_0335720 3300053077 Bacteria 983
343 Ga0495595_0024047 3300053084 Bacteria 2688
344 Ga0495619_0033849 3300053085 Bacteria 3319
345 Ga0495619_0041047 3300053085 Bacteria 3026
346 Ga0500578_0068416 3300053086 Bacteria 2263
347 Ga0500568_0000109 3300053139 Bacteria 76714
348 Ga0500568_0000162 3300053139 Bacteria 57343
349 Ga0500616_0000472 3300053153 Bacteria 52191
350 Ga0501084_0212874 3300054114 Bacteria 1631
351 Ga0501082_0034523 3300060353 Bacteria 4360
352 2509385620 2509276021 Bacteria 7634384
353 2509448332 2509276033 Bacteria 7180565
354 2510136432 2510065019 Bacteria 6903379
355 2510892311 2510461076 Bacteria 8618824
356 2511198099 2510917030 Bacteria 7460662
357 2513568061 2513237084 Bacteria 7231967
358 2513578385 2513237085 Bacteria 7695351
359 2513631002 2513237093 Bacteria 7545552
360 2513711078 2513237103 Bacteria 7647401
361 2514021108 2513237162 Bacteria 7468464
362 2515108612 2515075009 Bacteria 7288508
363 2515632218 2515154113 Bacteria 7807172
364 2515643530 2515154114 Bacteria 7848616
365 2515658329 2515154116 Bacteria 7552979
366 2515738115 2515154134 Bacteria 7220242
367 2516207117 2516143018 Bacteria 6951533
368 2517041203 2516653077 Bacteria 7555578
369 2517080171 2516653085 Bacteria 7346596
370 2517098172 2517093000 Bacteria 7412387
371 2517410065 2517287029 Bacteria 6905599
372 2524003362 2523533628 Bacteria 4098242
373 2524462976 2524023209 Bacteria 6679728
374 2530644673 2529292951 Bacteria 6916614
375 2552111969 2551306166 Bacteria 9731570
376 2566994142 2565956761 Bacteria 6601618
377 2585525581 2585427526 Bacteria 7258840
378 2585538692 2585427528 Bacteria 6842387
379 2585836645 2585427593 Bacteria 7141551
380 2616294746 2615840624 Bacteria 6557588
381 2644291346 2643221651 Bacteria 4798932
382 2719184496 2718217882 Bacteria 6556348
383 2719388584 2718217927 Bacteria 6972593
384 2719668389 2718217997 Bacteria 6740740
385 2719728516 2718218009 Bacteria 6478651
386 2720489082 2718218199 Bacteria 6740745
387 2720609774 2718218232 Bacteria 6720332
388 2720617206 2718218233 Bacteria 6662049
389 2720628347 2718218235 Bacteria 6630699
390 2720772301 2718218269 Bacteria 6906114
391 2721144204 2718218363 Bacteria 6524337
392 2721156302 2718218365 Bacteria 6274507
393 2721161579 2718218366 Bacteria 6425255
394 2721403209 2718218423 Bacteria 6438183
395 2722842724 2721755514 Bacteria 6424414
396 2723029722 2721755556 Bacteria 6745503
397 2723564091 2721755684 Bacteria 6859907
398 2723570215 2721755685 Bacteria 6704835
399 2724035566 2721755809 Bacteria 6438790
400 2724041541 2721755810 Bacteria 6479005
401 2724092330 2721755819 Bacteria 6906405
402 2724101762 2721755822 Bacteria 6726041
403 2724112706 2721755823 Bacteria 6752556
404 2725947837 2724679232 Bacteria 7646494
405 2730110255 2728369352 Bacteria 6745171
406 2730160612 2728369365 Bacteria 6555560
407 2730295835 2728369397 Bacteria 6274511
408 2738889844 2738541308 Bacteria 7020677
409 2739034115 2738541333 Bacteria 7106503
410 2739365161 2738543034 Bacteria 6084756
411 2753038637 2751185725 Bacteria 5740550
412 2753327149 2751185792 Bacteria 5739090
413 2753462753 2751185821 Bacteria 6189929
414 2766065114 2765235942 Bacteria 7445910
415 2776374439 2775506925 Bacteria 7237746
416 2792640996 2791355094 Bacteria 7011481
417 2793297448 2791355256 Bacteria 6798008
418 2793317315 2791355259 Bacteria 7254731
419 2793323113 2791355260 Bacteria 6598818
420 2793329869 2791355261 Bacteria 6661293
421 2793336605 2791355262 Bacteria 6774204
422 2793344514 2791355263 Bacteria 6872478
423 2793345376 2791355264 Bacteria 6429314
424 2793354920 2791355265 Bacteria 6539969
425 2793358160 2791355266 Bacteria 7116587
426 2793369830 2791355267 Bacteria 7222458
427 2805927140 2802429605 Bacteria 6875453
428 2805934434 2802429606 Bacteria 6346811
429 2806042912 2802429633 Bacteria 7341974
430 2806050865 2802429634 Bacteria 7083200
431 2806057967 2802429635 Bacteria 7650140
432 2806065320 2802429636 Bacteria 7597525
433 2806076803 2802429637 Bacteria 7067217
434 2838016394 2838016132 Bacteria 6577831
435 2838028331 2838022645 Bacteria 6494267
436 2838045836 2838042994 Bacteria 6046894
437 2838049495 2838048938 Bacteria 6044578
438 2838065224 2838061910 Bacteria 6794874
439 2838068930 2838068647 Bacteria 6208656
440 2838669555 2838668709 Bacteria 6671819
441 2838686241 2838680041 Bacteria 6545511
442 2838687472 2838686498 Bacteria 7807632
443 2838701927 2838701080 Bacteria 6669771
444 2838713954 2838707686 Bacteria 6619912
445 2838734116 2838729681 Bacteria 7400765
446 2838746568 2838742623 Bacteria 7396178
447 2841854022 2841851746 Bacteria 7532261
448 2841869336 2841864319 Bacteria 6742987
449 2842083352 2842077413 Bacteria 6508645
450 2842116729 2842110456 Bacteria 7656360
451 2842124299 2842118031 Bacteria 7033875
452 2842159611 2842156927 Bacteria 6894975
453 2842164060 2842163707 Bacteria 6916235
454 2842182819 2842180545 Bacteria 6888678
455 2842198536 2842192696 Bacteria 6147454
456 2842204307 2842198810 Bacteria 6608673
457 2842209367 2842205361 Bacteria 6340321
458 2842221594 2842217011 Bacteria 7497767
459 2842232530 2842229732 Bacteria 7475766
460 2842243365 2842237096 Bacteria 6620661
461 2842247227 2842243621 Bacteria 7421798
462 2842251650 2842250916 Bacteria 6579627
463 2842259086 2842257432 Bacteria 7401195
464 2842265266 2842264693 Bacteria 6472963
465 2842272494 2842271015 Bacteria 7807131
466 2842282589 2842278818 Bacteria 6340002
467 2842297547 2842291075 Bacteria 7076806
468 2842303875 2842298080 Bacteria 6123127
469 2842309828 2842304105 Bacteria 7023636
470 2842313407 2842311132 Bacteria 6616990
471 2842323364 2842317721 Bacteria 6793725
472 2842344116 2842341865 Bacteria 7003929
473 2842362694 2842357229 Bacteria 6485165
474 2842369249 2842363717 Bacteria 6844742
475 2842376582 2842370503 Bacteria 7038661
476 2842383835 2842377471 Bacteria 7140707
477 2842390972 2842384541 Bacteria 7057858
478 2842396476 2842395702 Bacteria 6780583
479 2842405723 2842402390 Bacteria 6681310
480 2842412307 2842409023 Bacteria 6687331
481 2842418953 2842415677 Bacteria 6596907
482 2842423076 2842422224 Bacteria 6239196
483 2842428681 2842428310 Bacteria 6767288
484 2842435294 2842434925 Bacteria 6502746
485 2842441843 2842441272 Bacteria 6769273
486 2842448111 2842447887 Bacteria 6754142
487 2842463105 2842462802 Bacteria 6588055
488 2842469625 2842469257 Bacteria 6752936
489 2842489627 2842489311 Bacteria 6620893
490 2842500458 2842495871 Bacteria 6820686
491 2844460468 2844454524 Bacteria 7952546
492 2854899959 2854896431 Bacteria 5869725
493 2857518033 2857516855 Bacteria 7787325
494 2863067966 2863067949 Bacteria 8541735
495 2863074238 2863067949 Bacteria 8541735
496 2885391305 2885383462 Bacteria 9473874
497 2899373946 2899370129 Bacteria 6781179
498 2904539910 2904535858 Bacteria 6308016
499 2904768988 2904765812 Bacteria 5369154
500 2904771733 2904770941 Bacteria 5580202
501 2908811776 2908811453 Bacteria 5478616
502 2919102786 2919100787 Bacteria 7710546
503 2919420103 2919420072 Bacteria 5390363
504 2919434138 2919432681 Bacteria 5390474
505 2922560484 2922554459 Bacteria 6683962
506 2933576270 2933570622 Bacteria 7023390
507 2933592945 2933586486 Bacteria 7667493
508 2933599598 2933599457 Bacteria 5858799
509 2935900990 2935894831 Bacteria 6620579
510 2935903161 2935901341 Bacteria 7341747
511 2935963943 2935959822 Bacteria 7869783
512 2936374396 2936367885 Bacteria 7324495
513 2936378762 2936375103 Bacteria 6652732
514 2936386552 2936381700 Bacteria 7006523
515 2939584842 2939582691 Bacteria 7088898
516 2956939617 2956939328 Bacteria 3474458
517 2974320036 2974315732 Bacteria 4602776
518 2984523903 2984523437 Bacteria 4508481
519 2996894488 2996893221 Bacteria 5823108
520 3003934207 3003930520 Bacteria 5667563
521 3005419789 3005416602 Bacteria 7064308
522 3005452052 3005445848 Bacteria 6906074
523 639644991 639633055 Bacteria 7751309
524 643822982 643692032 Bacteria 6891900
525 8005277300 8005275841 Bacteria 6929066
526 8005287610 8005282627 Bacteria 6675747
527 8005295516 8005289223 Bacteria 6634003
528 8005306313 8005301065 Bacteria 6614431
529 8005307930 8005307578 Bacteria 7395396
530 8005317787 8005314921 Bacteria 7072929
531 8005379801 8005376324 Bacteria 6590079
532 8005383406 8005382845 Bacteria 6732062
533 8005399000 8005395548 Bacteria 6806915
534 8005431766 8005430974 Bacteria 6689030
535 8005467214 8005460587 Bacteria 7157962
536 8005486758 8005484373 Bacteria 6297373
537 8005502597 8005497431 Bacteria 6477605
538 8005562357 8005556819 Bacteria 6908598
539 8005565519 8005563573 Bacteria 7153261
540 8005575765 8005570704 Bacteria 6957481
541 8005623804 8005619151 Bacteria 7030230
542 8005626363 8005626139 Bacteria 6534237
543 8005674026 8005668836 Bacteria 6953162
544 8005693991 8005688590 Bacteria 6610080
545 8005701813 8005695170 Bacteria 6912330
546 8018131902 8018127388 Bacteria 7351159
547 8018165505 8018163183 Bacteria 7277977
548 8018182376 8018176218 Bacteria 6896178
549 8023688082 8023680758 Bacteria 7729763
550 8024485037 8024479707 Bacteria 6954785
551 8024507166 8024501048 Bacteria 6427847
552 8056375040 8056375014 Bacteria 7006639
553 8056382487 8056382006 Bacteria 6408074
554 8056688313 8056681323 Bacteria 8472857
555 8057878012 8057874678 Bacteria 7494653
556 Ga0466966_0010980
557 JGI25159J45721_1002194
558 Ga0006778J45830_1030432
559 JGI25151J46595_10000508
560 JGI25406J46586_10000433
561 JGI25153J46596_10000302
562 JGI25153J46596_10006535
563 JGI25153J46596_10011027
564 Ga0006777J48905_1046470
565 JGI25160J50197_1001578
566 JGI25160J50197_1012442
567 JGI25161J50226_1000075
568 JGI25161J50226_1003688
569 Ga0007416J51690_1022159
570 Ga0055526_1004947
571 Ga0055526_1007334
572 Ga0055526_1010170
573 Ga0055524_1006216
574 Ga0055524_1006521
575 Ga0055524_1006553
576 Ga0055528_1000054
577 Ga0055528_1002349
578 Ga0055528_1010065
579 Ga0055540_1000255
580 Ga0055540_1013717
581 Ga0055543_1000096
582 Ga0065165_1007353
583 Ga0070668_100269910
584 Ga0070713_100069522
585 Ga0070713_100116093
586 Ga0070710_10001891
587 Ga0070663_100043637
588 Ga0070707_100021286
589 Ga0070707_100114099
590 Ga0068853_100209651
591 Ga0068854_100117886
592 Ga0068856_100236940
593 Ga0068852_100272265
594 Ga0068858_100183247
595 Ga0081455_10039977
596 Ga0081538_10046713
597 Ga0081540_1006260
598 Ga0081539_10000549
599 Ga0075365_10000426
600 Ga0075365_10049881
601 Ga0075365_10093913
602 Ga0075365_10120270
603 Ga0075365_10122827
604 Ga0075368_10044017
605 Ga0075364_10003990
606 Ga0075364_10008917
607 Ga0075364_10014844
608 Ga0070712_100069302
609 Ga0075362_10020272
610 Ga0075367_10031946
611 Ga0075369_10008201
612 Ga0075369_10022082
613 Ga0075370_10002191
614 Ga0075434_100068928
615 Ga0097620_100005795
616 Ga0105240_10006559
617 Ga0105240_10213235
618 Ga0105245_10053786
619 Ga0105247_10008443
620 Ga0105241_10145841
621 Ga0105237_10001582
622 Ga0105237_10483960
623 Ga0105238_10002762
624 Ga0123341_1000012
625 Ga0123342_1030913
626 Ga0105239_10001198
627 Ga0163162_10360006
628 Ga0213875_10002422
629 Ga0213875_10017304
630 Ga0209436_100035
631 Ga0209129_1003154
632 Ga0209673_1000067
633 Ga0209673_1000750
634 Ga0209673_1001376
635 Ga0209673_1002427
636 Ga0209673_1004094
637 Ga0209130_1000031
638 Ga0209025_1000397
639 Ga0209564_1000092
640 Ga0209564_1000511
641 Ga0209564_1000925
642 Ga0209758_1000504
643 Ga0209758_1000585
644 Ga0209758_1006713
645 Ga0209758_1010123
646 Ga0209050_1004942
647 Ga0209256_1000170
648 Ga0209256_1004342
649 Ga0209256_1007078
650 Ga0209256_1009391
651 Ga0207426_1000042
652 Ga0207426_1000355
653 Ga0209051_1000062
654 Ga0209051_1023955
655 Ga0209257_1000970
656 Ga0207692_10001625
657 Ga0207710_10004334
658 Ga0207685_10000084
659 Ga0207699_10004982
660 Ga0207695_10010499
661 Ga0207671_10001614
662 Ga0207646_10020312
663 Ga0207646_10119088
664 Ga0207694_10006920
665 Ga0207687_10095488
666 Ga0207700_10004729
667 Ga0207700_10007267
668 Ga0207700_10062087
669 Ga0207664_10001469
670 Ga0207664_10052628
671 Ga0207664_10066221
672 Ga0207664_10073182
673 Ga0207669_10027886
674 Ga0207648_10065979
675 Ga0207698_10003168
676 Ga0209813_10005880
677 Ga0307409_100464050
678 Ga0307416_100260386
679 Ga0316214_1000327
680 Ga0373934_0013842
681 Ga0373934_0023170
682 Ga0373944_0007109
683 Ga0373923_0028833
684 Ga0373936_0003887
685 Ga0373941_0022473
686 Ga0373953_0008250
687 Ga0373953_0079272
688 Ga0373956_0031986
689 Ga0373957_0043176
690 Ga0373943_0019917
691 Ga0373955_0073595
692 Ga0373961_0040937
693 Ga0373924_0050018
694 Ga0373935_0067894
695 Ga0373927_0020945
696 Ga0373933_0003612
697 Ga0373933_0065984
698 Ga0373947_0133965
699 Ga0373937_0004094
700 Ga0373937_0012421
701 Ga0373937_0067909
702 Ga0316584_0066251
703 Ga0373925_0000245
704 Ga0373925_0007347
705 Ga0373925_0018535
706 Ga0373925_0029100
707 Ga0395898_0016663
708 Ga0395898_0170844
709 Ga0395905_0020574
710 Ga0436364_0258924
711 Ga0436364_0593349
712 Ga0395901_0194785
713 Ga0436363_1067117
714 Ga0451853_1019146
715 Ga0439449_0004309
716 Ga0439462_0004678
717 Ga0466966_0137113
718 Ga0466963_0000256
719 Ga0466963_0056015
720 Ga0466963_0065845
721 Ga0466964_0035038
722 Ga0466959_0084113
723 Ga0466958_0036362
724 Ga0466967_0040414
725 Ga0466967_0059585
726 Ga0466967_0070163
727 Ga0495592_0005282
728 Ga0495592_0012799
729 Ga0495592_0049324
730 Ga0495629_0048828
731 Ga0495629_0203750
732 Ga0495638_0000475
733 Ga0495638_0082741
734 Ga0495641_0019344
735 Ga0495641_0034621
736 Ga0495641_0036652
737 Ga0495651_0002066
738 Ga0495651_0013735
739 Ga0495653_0009695
740 Ga0495653_0073264
741 Ga0495653_0076807
742 Ga0495653_0122882
743 Ga0495605_0059298
744 Ga0495662_0026789
745 Ga0495664_0015511
746 Ga0495664_0063883
747 Ga0495585_0008333
748 Ga0495594_0123906
749 Ga0495596_0037943
750 Ga0495607_0056076
751 Ga0495608_0011152
752 Ga0495608_0033366
753 Ga0495608_0041948
754 Ga0495610_0041661
755 Ga0495618_0032951
756 Ga0495618_0069935
757 Ga0495618_0139577
758 Ga0495628_0008662
759 Ga0495628_0053388
760 Ga0495630_0001360
761 Ga0495630_0047247
762 Ga0495630_0252102
763 Ga0495632_0023298
764 Ga0495643_0021930
765 Ga0495648_0010754
766 Ga0495663_0013087
767 Ga0495666_0018688
768 Ga0495652_0006264
769 Ga0495652_0076993
770 Ga0495640_0012451
771 Ga0495640_0032193
772 Ga0495640_0044750
773 Ga0495640_0066294
774 Ga0495640_0116046
775 Ga0495586_0007270
776 Ga0495586_0065838
777 Ga0495586_0070335
778 Ga0495587_0004220
779 Ga0495587_0015119
780 Ga0495609_0067888
781 Ga0495621_0016989
782 Ga0495645_0008007
783 Ga0495645_0025788
784 Ga0495633_0017374
785 Ga0495667_0000527
786 Ga0495667_0006240
787 Ga0495668_0000043
788 Ga0495634_0010448
789 Ga0495634_0037127
790 Ga0495634_0044210
791 Ga0495634_0045279
792 Ga0495625_0037963
793 Ga0495625_0074507
794 Ga0495635_0008812
795 Ga0495635_0009393
796 Ga0495635_0096523
797 Ga0495661_0068206
798 Ga0495657_0002073
799 Ga0495657_0027361
800 Ga0495599_0031043
801 Ga0495599_0037685
802 Ga0495599_0043973
803 Ga0495623_0007850
804 Ga0495647_0022451
805 Ga0495613_0023642
806 Ga0495613_0044541
807 Ga0495613_0093780
808 Ga0495624_0014984
809 Ga0495624_0033771
810 Ga0495670_0049092
811 Ga0495600_0013996
812 Ga0495600_0054356
813 Ga0495600_0054485
814 Ga0495660_0029512
815 Ga0495581_0022849
816 Ga0495604_0006231
817 Ga0495604_0039359
818 Ga0495604_0068836
819 Ga0495636_0035377
820 Ga0495674_0002886
821 Ga0495674_0008383
822 Ga0495674_0010753
823 Ga0495674_0136068
824 Ga0495674_0181733
825 Ga0495672_0027403
826 Ga0495672_0054098
827 Ga0495676_0062630
828 Ga0495676_0139954
829 Ga0495680_0001251
830 Ga0495680_0032306
831 Ga0495680_0046165
832 Ga0495683_0002342
833 Ga0495675_0038655
834 Ga0495677_0047020
835 Ga0495684_0016432
836 Ga0495684_0029261
837 Ga0495684_0117288
838 Ga0495686_0015129
839 Ga0495602_0081689
840 Ga0495614_0024930
841 Ga0496100_0005890
842 Ga0496100_0009032
843 Ga0496101_0002535
844 Ga0496102_0000029
845 Ga0496102_0001044
846 Ga0496102_0010976
847 Ga0496103_0000143
848 Ga0496103_0007336
849 Ga0496103_0021706
850 Ga0496105_0036068
851 Ga0496106_0007534
852 Ga0496106_0010831
853 Ga0496107_0022072
854 Ga0496110_0178211
855 Ga0496112_0088395
856 Ga0496112_0107680
857 Ga0496114_0002202
858 Ga0496117_0037175
859 Ga0496118_0002068
860 Ga0496118_0012604
861 Ga0496118_0113216
862 Ga0496119_0043646
863 Ga0496121_0000239
864 Ga0496121_0008048
865 Ga0496121_0102165
866 Ga0496123_0043322
867 Ga0496124_0188952
868 Ga0496125_0010847
869 Ga0496126_0004802
870 Ga0496126_0013697
871 Ga0496126_0017262
872 Ga0501038_0090073
873 Ga0501046_0028159
874 Ga0501047_0028779
875 Ga0501047_0156270
876 Ga0501069_0076571
877 Ga0501083_0081721
878 Ga0501035_0049351
879 nmdc:mga03683_21728_c1
880 nmdc:mga03683_90379_c1
881 nmdc:mga03n38_104631_c1
882 nmdc:mga00v17_14_c1
883 nmdc:mga00v17_6312_c1
884 nmdc:mga0yw44_106520_c1
885 nmdc:mga0yw44_116970_c1
886 nmdc:mga0yw44_125351_c1
887 nmdc:mga0yw44_41066_c1
888 nmdc:mga0yw44_7067_c1
889 nmdc:mga0k408_18677_c1
890 nmdc:mga0k408_58865_c1
891 nmdc:mga06z11_10002_c2
892 nmdc:mga06z11_38758_c1
893 nmdc:mga07m45_41041_c1
894 nmdc:mga08y16_584078_c1
895 nmdc:mga0n895_56819_c1
896 nmdc:mga08x19_86918_c1
897 Ga0495601_0335720
898 Ga0495595_0024047
899 Ga0495619_0033849
900 Ga0495619_0041047
901 Ga0500578_0068416
902 Ga0500568_0000109
903 Ga0500568_0000162
904 Ga0500616_0000472
905 Ga0501084_0212874
906 Ga0501082_0034523
907 2509385620
908 2509448332
909 2510136432
910 2510892311
911 2511198099
912 2513568061
913 2513578385
914 2513631002
915 2513711078
916 2514021108
917 2515108612
918 2515632218
919 2515643530
920 2515658329
921 2515738115
922 2516207117
923 2517041203
924 2517080171
925 2517098172
926 2517410065
927 2524003362
928 2524462976
929 2530644673
930 2552111969
931 2566994142
932 2585525581
933 2585538692
934 2585836645
935 2616294746
936 2644291346
937 2719184496
938 2719388584
939 2719668389
940 2719728516
941 2720489082
942 2720609774
943 2720617206
944 2720628347
945 2720772301
946 2721144204
947 2721156302
948 2721161579
949 2721403209
950 2722842724
951 2723029722
952 2723564091
953 2723570215
954 2724035566
955 2724041541
956 2724092330
957 2724101762
958 2724112706
959 2725947837
960 2730110255
961 2730160612
962 2730295835
963 2738889844
964 2739034115
965 2739365161
966 2753038637
967 2753327149
968 2753462753
969 2766065114
970 2776374439
971 2792640996
972 2793297448
973 2793317315
974 2793323113
975 2793329869
976 2793336605
977 2793344514
978 2793345376
979 2793354920
980 2793358160
981 2793369830
982 2805927140
983 2805934434
984 2806042912
985 2806050865
986 2806057967
987 2806065320
988 2806076803
989 2838016394
990 2838028331
991 2838045836
992 2838049495
993 2838065224
994 2838068930
995 2838669555
996 2838686241
997 2838687472
998 2838701927
999 2838713954
1000 2838734116
1001 2838746568
1002 2841854022
1003 2841869336
1004 2842083352
1005 2842116729
1006 2842124299
1007 2842159611
1008 2842164060
1009 2842182819
1010 2842198536
1011 2842204307
1012 2842209367
1013 2842221594
1014 2842232530
1015 2842243365
1016 2842247227
1017 2842251650
1018 2842259086
1019 2842265266
1020 2842272494
1021 2842282589
1022 2842297547
1023 2842303875
1024 2842309828
1025 2842313407
1026 2842323364
1027 2842344116
1028 2842362694
1029 2842369249
1030 2842376582
1031 2842383835
1032 2842390972
1033 2842396476
1034 2842405723
1035 2842412307
1036 2842418953
1037 2842423076
1038 2842428681
1039 2842435294
1040 2842441843
1041 2842448111
1042 2842463105
1043 2842469625
1044 2842489627
1045 2842500458
1046 2844460468
1047 2854899959
1048 2857518033
1049 2863067966
1050 2863074238
1051 2885391305
1052 2899373946
1053 2904539910
1054 2904768988
1055 2904771733
1056 2908811776
1057 2919102786
1058 2919420103
1059 2919434138
1060 2922560484
1061 2933576270
1062 2933592945
1063 2933599598
1064 2935900990
1065 2935903161
1066 2935963943
1067 2936374396
1068 2936378762
1069 2936386552
1070 2939584842
1071 2956939617
1072 2974320036
1073 2984523903
1074 2996894488
1075 3003934207
1076 3005419789
1077 3005452052
1078 639644991
1079 643822982
1080 8005277300
1081 8005287610
1082 8005295516
1083 8005306313
1084 8005307930
1085 8005317787
1086 8005379801
1087 8005383406
1088 8005399000
1089 8005431766
1090 8005467214
1091 8005486758
1092 8005502597
1093 8005562357
1094 8005565519
1095 8005575765
1096 8005623804
1097 8005626363
1098 8005674026
1099 8005693991
1100 8005701813
1101 8018131902
1102 8018165505
1103 8018182376
1104 8023688082
1105 8024485037
1106 8024507166
1107 8056375040
1108 8056382487
1109 8056688313
1110 8057878012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

78

221

0.97

PF17912

OB_MalK

MalK OB fold domain

294

344

0.96

PF08402

TOBE_2

TOBE domain

337

412

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9611 2 348
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9562 4 350
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9478 2 348
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9429 4 350
3gfo-assembly1.cif.gz_A structure of cbio1 from clostridium perfringens: part of the abc transporter complex cbionq. 0.9377 4 221
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.984 3 216 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9741 1 217 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9703 3 216 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9653 1 217 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9623 4 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9864 48 191 GO:0005524
GO:0016887
GO:0055052
AF-A0A0D6JVA7-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9814 1 233 GO:0005524
GO:0016887
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9797 48 191 GO:0005524
GO:0016887
GO:0055052
AF-A0A4Q3TF12-F1-model_v4 ABC transporter ATP-binding protein 0.9725 1 153 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9715 1 225 GO:0005524
GO:0016887

Map